F400702

General Info

Members Datasets Scaffolds Average Seq Length
310 170 620 268

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000558|Ga0105243_1000055810
Length 302
Sequence LECGGKRKRDTALDYSLNVLFGIGKAPSPLRSAGALQKMNPVISEWLNFIARWVHVFAGIMWVGTTYYFTWLDARLTEEEKAVANVGKPAQIWMVHSGGFYVVEKRKIPDELSRKLHWFKWEAGTTWLSGFALLIALIDRDVADIGVGPAVGIGIGTLIVGWLVYDLLMISPLGRSEKLFAVIAYLLIVATAYGLTRVFSGRGAYIHVGALFGTIMAANVWMRILPAQRKMIEAIKSGQKPDEKLSAQAKLRSKQNTFMAVPVVFLMISNHFGGVTTGGYDWIHLAILVPAGWLAAKFIRRA

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
148 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
157 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
158 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
159 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
160 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
161 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.29
Rhizosphere 98.39
Stem 0
Stem Tuber 0
Unclassified 25.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10000558 3300009148 Bacteria 37622
2 JGI24034J14986_100008 3300001432 Bacteria 6582
3 JGI24748J21848_1000018 3300002074 Bacteria 129847
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 JGI25406J46586_10000713 3300003203 Bacteria 15562
6 JGI25406J46586_10007675 3300003203 Bacteria 4906
7 JGI25406J46586_10048319 3300003203 Bacteria 1443
8 Ga0065704_10110863 3300005289 Bacteria 1959
9 Ga0065712_10032193 3300005290 Bacteria 1144
10 Ga0065715_10126674 3300005293 Unclassified 2103
11 Ga0065707_10089222 3300005295 Unclassified 4435
12 Ga0070683_100096887 3300005329 Bacteria 2774
13 Ga0070690_100116939 3300005330 Unclassified 1786
14 Ga0070670_100044234 3300005331 Bacteria 3829
15 Ga0070670_100053135 3300005331 Bacteria 3479
16 Ga0068869_100056807 3300005334 Bacteria 2855
17 Ga0070680_100034889 3300005336 Bacteria 4058
18 Ga0068868_100052504 3300005338 Bacteria 3209
19 Ga0070689_100000223 3300005340 Bacteria 33953
20 Ga0070689_100034793 3300005340 Bacteria 3844
21 Ga0070689_100146451 3300005340 Bacteria 1902
22 Ga0070692_10033370 3300005345 Bacteria 2593
23 Ga0070692_10096567 3300005345 Unclassified 1614
24 Ga0070668_100015647 3300005347 Bacteria 5672
25 Ga0070669_100046266 3300005353 Bacteria 3173
26 Ga0070669_100247026 3300005353 Bacteria 1420
27 Ga0070675_100107933 3300005354 Unclassified 2351
28 Ga0070675_100222324 3300005354 Bacteria 1645
29 Ga0070673_100105177 3300005364 Unclassified 2331
30 Ga0070688_100296801 3300005365 Bacteria 1167
31 Ga0070659_100005490 3300005366 Bacteria 9110
32 Ga0070659_100056258 3300005366 Bacteria 3102
33 Ga0070703_10000180 3300005406 Bacteria 30778
34 Ga0070701_10010476 3300005438 Bacteria 4101
35 Ga0070705_100189867 3300005440 Bacteria 1399
36 Ga0070705_100193405 3300005440 Bacteria 1389
37 Ga0070694_100032278 3300005444 Unclassified 3439
38 Ga0070694_100067804 3300005444 Bacteria 2450
39 Ga0070694_100312620 3300005444 Bacteria 1207
40 Ga0070708_100000103 3300005445 Bacteria 56127
41 Ga0070708_100466415 3300005445 Unclassified 1191
42 Ga0070663_100129148 3300005455 Unclassified 1917
43 Ga0070662_100037904 3300005457 Bacteria 3421
44 Ga0070681_10015639 3300005458 Bacteria 7557
45 Ga0068867_100056755 3300005459 Bacteria 2898
46 Ga0068867_100204093 3300005459 Unclassified 1584
47 Ga0068867_100392328 3300005459 Bacteria 1169
48 Ga0070685_10072371 3300005466 Bacteria 2046
49 Ga0070706_100001796 3300005467 Bacteria 22211
50 Ga0070706_100003065 3300005467 Bacteria 16548
51 Ga0070706_100011523 3300005467 Bacteria 8218
52 Ga0070706_100041360 3300005467 Bacteria 4256
53 Ga0070706_100163294 3300005467 Bacteria 2080
54 Ga0070706_100193073 3300005467 Unclassified 1902
55 Ga0070706_100450010 3300005467 Bacteria 1198
56 Ga0070707_100000053 3300005468 Bacteria 100755
57 Ga0070707_100004457 3300005468 Bacteria 13110
58 Ga0070707_100048575 3300005468 Bacteria 4065
59 Ga0070707_100118031 3300005468 Unclassified 2575
60 Ga0070707_100135869 3300005468 Bacteria 2392
61 Ga0070707_100158038 3300005468 Unclassified 2208
62 Ga0070707_100315945 3300005468 Bacteria 1518
63 Ga0070698_100000127 3300005471 Bacteria 66092
64 Ga0070698_100001947 3300005471 Bacteria 22931
65 Ga0070698_100003853 3300005471 Bacteria 16501
66 Ga0070698_100105799 3300005471 Unclassified 2783
67 Ga0070698_100212928 3300005471 Unclassified 1866
68 Ga0070698_100318697 3300005471 Bacteria 1485
69 Ga0070699_100005101 3300005518 Bacteria 11551
70 Ga0070699_100045920 3300005518 Bacteria 3780
71 Ga0070699_100051694 3300005518 Bacteria 3558
72 Ga0070699_100337897 3300005518 Bacteria 1355
73 Ga0070679_100024801 3300005530 Bacteria 5878
74 Ga0070697_100000062 3300005536 Bacteria 84791
75 Ga0070697_100000394 3300005536 Bacteria 33837
76 Ga0070697_100003479 3300005536 Bacteria 12102
77 Ga0070672_100390096 3300005543 Unclassified 1192
78 Ga0070686_100018795 3300005544 Bacteria 4063
79 Ga0070686_100117119 3300005544 Unclassified 1824
80 Ga0070695_100039557 3300005545 Bacteria 2982
81 Ga0070696_100057721 3300005546 Bacteria 2709
82 Ga0070696_100063062 3300005546 Bacteria 2595
83 Ga0070696_100412144 3300005546 Bacteria 1059
84 Ga0070693_100042330 3300005547 Bacteria 2566
85 Ga0070704_100002410 3300005549 Bacteria 10500
86 Ga0070704_100055936 3300005549 Bacteria 2799
87 Ga0070704_100086432 3300005549 Unclassified 2324
88 Ga0070664_100008339 3300005564 Bacteria 8378
89 Ga0070664_100085651 3300005564 Unclassified 2722
90 Ga0068857_100001693 3300005577 Bacteria 17720
91 Ga0068854_100048309 3300005578 Unclassified 3036
92 Ga0070702_100033427 3300005615 Unclassified 2828
93 Ga0068859_100116164 3300005617 Bacteria 2740
94 Ga0068859_100128397 3300005617 Unclassified 2606
95 Ga0068859_100346087 3300005617 Bacteria 1581
96 Ga0068859_100417188 3300005617 Bacteria 1438
97 Ga0068864_100008419 3300005618 Bacteria 8510
98 Ga0068864_100057611 3300005618 Bacteria 3357
99 Ga0068864_100059841 3300005618 Unclassified 3296
100 Ga0068864_100066645 3300005618 Unclassified 3125
101 Ga0068864_100079521 3300005618 Bacteria 2871
102 Ga0068864_100156911 3300005618 Bacteria 2066
103 Ga0068864_100405028 3300005618 Bacteria 1297
104 Ga0068861_100004992 3300005719 Bacteria 8942
105 Ga0068861_100119686 3300005719 Bacteria 2122
106 Ga0068861_100256455 3300005719 Bacteria 1495
107 Ga0068861_100651641 3300005719 Bacteria 973
108 Ga0068870_10017951 3300005840 Bacteria 3407
109 Ga0068870_10081137 3300005840 Bacteria 1793
110 Ga0068863_100002518 3300005841 Bacteria 18195
111 Ga0068858_100000005 3300005842 Bacteria 305830
112 Ga0068860_100227579 3300005843 Unclassified 1812
113 Ga0068862_100066794 3300005844 Bacteria 3099
114 Ga0068862_100202250 3300005844 Bacteria 1791
115 Ga0068862_100810878 3300005844 Unclassified 915
116 Ga0081539_10000067 3300005985 Bacteria 246361
117 Ga0081539_10000073 3300005985 Bacteria 231470
118 Ga0081539_10000398 3300005985 Bacteria 93250
119 Ga0070715_10000034 3300006163 Bacteria 80012
120 Ga0070716_100000003 3300006173 Bacteria 312721
121 Ga0097621_100167575 3300006237 Bacteria 1892
122 Ga0075428_100046685 3300006844 Bacteria 4756
123 Ga0075430_100127808 3300006846 Unclassified 2119
124 Ga0075431_100040545 3300006847 Bacteria 4799
125 Ga0075433_10170135 3300006852 Unclassified 1939
126 Ga0075433_10365592 3300006852 Bacteria 1274
127 Ga0075434_100006736 3300006871 Bacteria 10556
128 Ga0075434_100291737 3300006871 Unclassified 1651
129 Ga0075429_100034266 3300006880 Bacteria 4412
130 Ga0068865_100013218 3300006881 Bacteria 5212
131 Ga0097620_100116171 3300006931 Bacteria 2740
132 Ga0097620_100128396 3300006931 Unclassified 2606
133 Ga0097620_100417191 3300006931 Bacteria 1438
134 Ga0075435_100383274 3300007076 Bacteria 1208
135 Ga0099794_10028928 3300007265 Bacteria 2579
136 Ga0099794_10122698 3300007265 Bacteria 1308
137 Ga0111539_10013159 3300009094 Bacteria 10347
138 Ga0111539_10157951 3300009094 Bacteria 2653
139 Ga0105245_10032424 3300009098 Bacteria 4625
140 Ga0105247_10000002 3300009101 Bacteria 724587
141 Ga0114129_10017168 3300009147 Bacteria 10308
142 Ga0114129_10140285 3300009147 Unclassified 3314
143 Ga0114129_10174753 3300009147 Bacteria 2926
144 Ga0114129_10217055 3300009147 Unclassified 2582
145 Ga0114129_10392097 3300009147 Bacteria 1831
146 Ga0114129_10703751 3300009147 Bacteria 1298
147 Ga0105243_10000493 3300009148 Bacteria 40228
148 Ga0105243_10108064 3300009148 Bacteria 2322
149 Ga0105242_10000817 3300009176 Bacteria 24173
150 Ga0105242_10009656 3300009176 Bacteria 7393
151 Ga0105242_10174289 3300009176 Unclassified 1892
152 Ga0105248_10078914 3300009177 Bacteria 3700
153 Ga0105248_10095785 3300009177 Bacteria 3342
154 Ga0105249_10000003 3300009553 Bacteria 370855
155 Ga0105249_10013960 3300009553 Bacteria 7100
156 Ga0105249_10187283 3300009553 Unclassified 2017
157 Ga0105239_10057361 3300010375 Bacteria 4271
158 Ga0105239_10371077 3300010375 Bacteria 1617
159 Ga0157373_10050677 3300013100 Bacteria 2956
160 Ga0157378_10000077 3300013297 Bacteria 89664
161 Ga0157378_10004689 3300013297 Bacteria 11992
162 Ga0157378_10026615 3300013297 Bacteria 5097
163 Ga0157378_10030759 3300013297 Unclassified 4740
164 Ga0157378_10031466 3300013297 Bacteria 4686
165 Ga0157378_10101318 3300013297 Unclassified 2630
166 Ga0157378_10105554 3300013297 Bacteria 2576
167 Ga0163162_10000020 3300013306 Bacteria 220558
168 Ga0157372_10124935 3300013307 Bacteria 2958
169 Ga0157375_10004099 3300013308 Bacteria 12637
170 Ga0157375_10102616 3300013308 Bacteria 2946
171 Ga0157375_10359005 3300013308 Unclassified 1623
172 Ga0157375_10979009 3300013308 Bacteria 986
173 Ga0163163_10055265 3300014325 Bacteria 3924
174 Ga0163163_10134589 3300014325 Unclassified 2512
175 Ga0163163_10188493 3300014325 Unclassified 2111
176 Ga0157380_10012926 3300014326 Bacteria 6068
177 Ga0157380_10022586 3300014326 Unclassified 4740
178 Ga0157377_10196538 3300014745 Bacteria 1278
179 Ga0157376_10089643 3300014969 Unclassified 2659
180 Ga0207672_1000032 3300025223 Bacteria 18064
181 Ga0207653_10000154 3300025885 Bacteria 48375
182 Ga0207653_10045050 3300025885 Unclassified 1456
183 Ga0207710_10000002 3300025900 Bacteria 1251998
184 Ga0207685_10000006 3300025905 Bacteria 284255
185 Ga0207643_10006124 3300025908 Bacteria 6434
186 Ga0207684_10004349 3300025910 Bacteria 13378
187 Ga0207684_10017526 3300025910 Bacteria 6143
188 Ga0207684_10031701 3300025910 Bacteria 4496
189 Ga0207684_10161521 3300025910 Unclassified 1929
190 Ga0207684_10162240 3300025910 Unclassified 1925
191 Ga0207684_10413398 3300025910 Bacteria 1159
192 Ga0207654_10235022 3300025911 Bacteria 1222
193 Ga0207707_10229203 3300025912 Unclassified 1616
194 Ga0207660_10031934 3300025917 Bacteria 3631
195 Ga0207662_10014559 3300025918 Bacteria 4415
196 Ga0207652_10204444 3300025921 Unclassified 1777
197 Ga0207646_10000575 3300025922 Bacteria 48116
198 Ga0207646_10001854 3300025922 Bacteria 25492
199 Ga0207646_10313887 3300025922 Bacteria 1416
200 Ga0207681_10284718 3300025923 Bacteria 1303
201 Ga0207650_10038662 3300025925 Bacteria 3486
202 Ga0207659_10137565 3300025926 Bacteria 1892
203 Ga0207644_10000361 3300025931 Bacteria 29606
204 Ga0207644_10353752 3300025931 Unclassified 1193
205 Ga0207690_10098103 3300025932 Bacteria 2086
206 Ga0207706_10022521 3300025933 Bacteria 5653
207 Ga0207706_10178185 3300025933 Bacteria 1867
208 Ga0207686_10000257 3300025934 Bacteria 40231
209 Ga0207686_10000802 3300025934 Bacteria 19287
210 Ga0207686_10002748 3300025934 Bacteria 9540
211 Ga0207709_10000325 3300025935 Bacteria 51529
212 Ga0207709_10000427 3300025935 Bacteria 40208
213 Ga0207670_10001017 3300025936 Bacteria 14833
214 Ga0207670_10023351 3300025936 Bacteria 3849
215 Ga0207670_10345441 3300025936 Bacteria 1177
216 Ga0207665_10000003 3300025939 Bacteria 220666
217 Ga0207665_10278175 3300025939 Bacteria 1245
218 Ga0207691_10480284 3300025940 Bacteria 1056
219 Ga0207689_10005332 3300025942 Bacteria 11523
220 Ga0207689_10006798 3300025942 Bacteria 10065
221 Ga0207689_10022221 3300025942 Bacteria 5334
222 Ga0207679_10030836 3300025945 Unclassified 3748
223 Ga0207679_10064024 3300025945 Unclassified 2747
224 Ga0207651_10074598 3300025960 Unclassified 2416
225 Ga0207712_10000232 3300025961 Bacteria 54804
226 Ga0207668_10005784 3300025972 Bacteria 7286
227 Ga0207677_10645060 3300026023 Unclassified 934
228 Ga0207703_10001954 3300026035 Bacteria 18218
229 Ga0207703_10066608 3300026035 Unclassified 2963
230 Ga0207639_10149379 3300026041 Unclassified 1955
231 Ga0207708_10037147 3300026075 Bacteria 3710
232 Ga0207708_10047289 3300026075 Bacteria 3276
233 Ga0207708_10050402 3300026075 Unclassified 3169
234 Ga0207708_10101936 3300026075 Bacteria 2222
235 Ga0207641_10025386 3300026088 Bacteria 4886
236 Ga0207641_10744806 3300026088 Unclassified 967
237 Ga0207648_10063159 3300026089 Bacteria 3228
238 Ga0207648_10177424 3300026089 Unclassified 1884
239 Ga0207676_10036485 3300026095 Bacteria 3740
240 Ga0207676_10069573 3300026095 Unclassified 2819
241 Ga0207676_10092659 3300026095 Bacteria 2486
242 Ga0207676_10612040 3300026095 Bacteria 1047
243 Ga0207674_10000391 3300026116 Bacteria 56809
244 Ga0207674_10156757 3300026116 Bacteria 2232
245 Ga0207674_10287244 3300026116 Unclassified 1593
246 Ga0207675_100399322 3300026118 Bacteria 1354
247 Ga0207675_100645146 3300026118 Bacteria 1064
248 Ga0207428_10026232 3300027907 Bacteria 4865
249 Ga0268265_10201985 3300028380 Bacteria 1725
250 Ga0268264_10257509 3300028381 Bacteria 1624
251 Ga0265327_10013172 3300031251 Bacteria 5511
252 Ga0307513_10003044 3300031456 Bacteria 22870
253 Ga0307414_10229096 3300032004 Bacteria 1531
254 Ga0395898_0218067 3300037466 Bacteria 1820
255 Ga0242420_009507 3300038996 Bacteria 1597
256 Ga0453683_0071734 3300044673 Bacteria 2167
257 Ga0453683_0091926 3300044673 Bacteria 1902
258 Ga0451576_0055815 3300045051 Bacteria 4131
259 Ga0451576_0761936 3300045051 Bacteria 1017
260 Ga0451576_1033518 3300045051 Bacteria 861
261 Ga0495629_0300272 3300046459 Unclassified 1100
262 Ga0495641_0150947 3300046461 Unclassified 1038
263 Ga0495651_0379817 3300046462 Unclassified 927
264 Ga0495586_0004661 3300046535 Bacteria 7331
265 Ga0495658_0130506 3300046683 Unclassified 1529
266 Ga0495636_0061761 3300047318 Unclassified 1585
267 Ga0495614_0085539 3300048089 Unclassified 1369
268 Ga0496104_0356130 3300048907 Unclassified 1376
269 Ga0496106_0000981 3300048909 Bacteria 20812
270 Ga0496107_0314353 3300048910 Bacteria 1166
271 Ga0496113_0057966 3300048916 Unclassified 2913
272 Ga0501296_011701 3300049519 Unclassified 1052
273 Ga0501300_015225 3300049523 Unclassified 1124
274 Ga0501036_0541179 3300049572 Unclassified 968
275 Ga0501037_0196015 3300049573 Bacteria 1429
276 Ga0501041_0110201 3300049577 Unclassified 1708
277 Ga0501071_0156417 3300049587 Unclassified 1702
278 Ga0501072_0055383 3300049588 Bacteria 3126
279 Ga0501074_0288504 3300049590 Unclassified 1166
280 Ga0501076_0085084 3300049592 Bacteria 2541
281 Ga0501076_0232619 3300049592 Bacteria 1507
282 Ga0501199_003338 3300049650 Unclassified 1535
283 Ga0501206_012783 3300049653 Bacteria 1143
284 Ga0501227_029066 3300049665 Bacteria 1316
285 Ga0501249_046532 3300049679 Unclassified 991
286 Ga0501272_004503 3300049769 Bacteria 1449
287 Ga0501283_020217 3300049779 Unclassified 1060
288 nmdc:mga05p37_33355_c1 3300050507 Unclassified 1606
289 nmdc:mga05p37_38262_c1 3300050507 Bacteria 5884
290 nmdc:mga05p37_570676_c1 3300050507 Bacteria 1283
291 nmdc:mga05p37_63039_c1 3300050507 Bacteria 4562
292 nmdc:mga05p37_685638_c1 3300050507 Bacteria 1141
293 nmdc:mga09592_209315_c1 3300050508 Bacteria 1689
294 nmdc:mga09592_31880_c1 3300050508 Bacteria 4392
295 nmdc:mga0qj67_338243_c1 3300050509 Bacteria 1218
296 nmdc:mga06r32_114183_c1 3300050510 Unclassified 2659
297 nmdc:mga08y16_172056_c1 3300050511 Bacteria 2250
298 nmdc:mga08y16_23578_c1 3300050511 Bacteria 6500
299 nmdc:mga08y16_498274_c1 3300050511 Bacteria 1238
300 nmdc:mga0n895_277920_c1 3300050512 Bacteria 1698
301 nmdc:mga0n895_453818_c1 3300050512 Bacteria 1294
302 nmdc:mga0n895_510925_c1 3300050512 Bacteria 1210
303 nmdc:mga0rr50_102287_c1 3300050513 Bacteria 2253
304 nmdc:mga0rr50_131496_c1 3300050513 Bacteria 2004
305 nmdc:mga0rr50_219540_c1 3300050513 Bacteria 1569
306 nmdc:mga0a205_199898_c1 3300050515 Bacteria 1889
307 nmdc:mga0a205_26799_c2 3300050515 Bacteria 3291
308 nmdc:mga0a205_274243_c1 3300050515 Bacteria 1563
309 nmdc:mga0a205_56342_c1 3300050515 Bacteria 3795
310 Ga0501082_0572388 3300060353 Unclassified 988
311 Ga0105243_10000558
312 JGI24034J14986_100008
313 JGI24748J21848_1000018
314 JGI24034J26672_10000001
315 JGI25406J46586_10000713
316 JGI25406J46586_10007675
317 JGI25406J46586_10048319
318 Ga0065704_10110863
319 Ga0065712_10032193
320 Ga0065715_10126674
321 Ga0065707_10089222
322 Ga0070683_100096887
323 Ga0070690_100116939
324 Ga0070670_100044234
325 Ga0070670_100053135
326 Ga0068869_100056807
327 Ga0070680_100034889
328 Ga0068868_100052504
329 Ga0070689_100000223
330 Ga0070689_100034793
331 Ga0070689_100146451
332 Ga0070692_10033370
333 Ga0070692_10096567
334 Ga0070668_100015647
335 Ga0070669_100046266
336 Ga0070669_100247026
337 Ga0070675_100107933
338 Ga0070675_100222324
339 Ga0070673_100105177
340 Ga0070688_100296801
341 Ga0070659_100005490
342 Ga0070659_100056258
343 Ga0070703_10000180
344 Ga0070701_10010476
345 Ga0070705_100189867
346 Ga0070705_100193405
347 Ga0070694_100032278
348 Ga0070694_100067804
349 Ga0070694_100312620
350 Ga0070708_100000103
351 Ga0070708_100466415
352 Ga0070663_100129148
353 Ga0070662_100037904
354 Ga0070681_10015639
355 Ga0068867_100056755
356 Ga0068867_100204093
357 Ga0068867_100392328
358 Ga0070685_10072371
359 Ga0070706_100001796
360 Ga0070706_100003065
361 Ga0070706_100011523
362 Ga0070706_100041360
363 Ga0070706_100163294
364 Ga0070706_100193073
365 Ga0070706_100450010
366 Ga0070707_100000053
367 Ga0070707_100004457
368 Ga0070707_100048575
369 Ga0070707_100118031
370 Ga0070707_100135869
371 Ga0070707_100158038
372 Ga0070707_100315945
373 Ga0070698_100000127
374 Ga0070698_100001947
375 Ga0070698_100003853
376 Ga0070698_100105799
377 Ga0070698_100212928
378 Ga0070698_100318697
379 Ga0070699_100005101
380 Ga0070699_100045920
381 Ga0070699_100051694
382 Ga0070699_100337897
383 Ga0070679_100024801
384 Ga0070697_100000062
385 Ga0070697_100000394
386 Ga0070697_100003479
387 Ga0070672_100390096
388 Ga0070686_100018795
389 Ga0070686_100117119
390 Ga0070695_100039557
391 Ga0070696_100057721
392 Ga0070696_100063062
393 Ga0070696_100412144
394 Ga0070693_100042330
395 Ga0070704_100002410
396 Ga0070704_100055936
397 Ga0070704_100086432
398 Ga0070664_100008339
399 Ga0070664_100085651
400 Ga0068857_100001693
401 Ga0068854_100048309
402 Ga0070702_100033427
403 Ga0068859_100116164
404 Ga0068859_100128397
405 Ga0068859_100346087
406 Ga0068859_100417188
407 Ga0068864_100008419
408 Ga0068864_100057611
409 Ga0068864_100059841
410 Ga0068864_100066645
411 Ga0068864_100079521
412 Ga0068864_100156911
413 Ga0068864_100405028
414 Ga0068861_100004992
415 Ga0068861_100119686
416 Ga0068861_100256455
417 Ga0068861_100651641
418 Ga0068870_10017951
419 Ga0068870_10081137
420 Ga0068863_100002518
421 Ga0068858_100000005
422 Ga0068860_100227579
423 Ga0068862_100066794
424 Ga0068862_100202250
425 Ga0068862_100810878
426 Ga0081539_10000067
427 Ga0081539_10000073
428 Ga0081539_10000398
429 Ga0070715_10000034
430 Ga0070716_100000003
431 Ga0097621_100167575
432 Ga0075428_100046685
433 Ga0075430_100127808
434 Ga0075431_100040545
435 Ga0075433_10170135
436 Ga0075433_10365592
437 Ga0075434_100006736
438 Ga0075434_100291737
439 Ga0075429_100034266
440 Ga0068865_100013218
441 Ga0097620_100116171
442 Ga0097620_100128396
443 Ga0097620_100417191
444 Ga0075435_100383274
445 Ga0099794_10028928
446 Ga0099794_10122698
447 Ga0111539_10013159
448 Ga0111539_10157951
449 Ga0105245_10032424
450 Ga0105247_10000002
451 Ga0114129_10017168
452 Ga0114129_10140285
453 Ga0114129_10174753
454 Ga0114129_10217055
455 Ga0114129_10392097
456 Ga0114129_10703751
457 Ga0105243_10000493
458 Ga0105243_10108064
459 Ga0105242_10000817
460 Ga0105242_10009656
461 Ga0105242_10174289
462 Ga0105248_10078914
463 Ga0105248_10095785
464 Ga0105249_10000003
465 Ga0105249_10013960
466 Ga0105249_10187283
467 Ga0105239_10057361
468 Ga0105239_10371077
469 Ga0157373_10050677
470 Ga0157378_10000077
471 Ga0157378_10004689
472 Ga0157378_10026615
473 Ga0157378_10030759
474 Ga0157378_10031466
475 Ga0157378_10101318
476 Ga0157378_10105554
477 Ga0163162_10000020
478 Ga0157372_10124935
479 Ga0157375_10004099
480 Ga0157375_10102616
481 Ga0157375_10359005
482 Ga0157375_10979009
483 Ga0163163_10055265
484 Ga0163163_10134589
485 Ga0163163_10188493
486 Ga0157380_10012926
487 Ga0157380_10022586
488 Ga0157377_10196538
489 Ga0157376_10089643
490 Ga0207672_1000032
491 Ga0207653_10000154
492 Ga0207653_10045050
493 Ga0207710_10000002
494 Ga0207685_10000006
495 Ga0207643_10006124
496 Ga0207684_10004349
497 Ga0207684_10017526
498 Ga0207684_10031701
499 Ga0207684_10161521
500 Ga0207684_10162240
501 Ga0207684_10413398
502 Ga0207654_10235022
503 Ga0207707_10229203
504 Ga0207660_10031934
505 Ga0207662_10014559
506 Ga0207652_10204444
507 Ga0207646_10000575
508 Ga0207646_10001854
509 Ga0207646_10313887
510 Ga0207681_10284718
511 Ga0207650_10038662
512 Ga0207659_10137565
513 Ga0207644_10000361
514 Ga0207644_10353752
515 Ga0207690_10098103
516 Ga0207706_10022521
517 Ga0207706_10178185
518 Ga0207686_10000257
519 Ga0207686_10000802
520 Ga0207686_10002748
521 Ga0207709_10000325
522 Ga0207709_10000427
523 Ga0207670_10001017
524 Ga0207670_10023351
525 Ga0207670_10345441
526 Ga0207665_10000003
527 Ga0207665_10278175
528 Ga0207691_10480284
529 Ga0207689_10005332
530 Ga0207689_10006798
531 Ga0207689_10022221
532 Ga0207679_10030836
533 Ga0207679_10064024
534 Ga0207651_10074598
535 Ga0207712_10000232
536 Ga0207668_10005784
537 Ga0207677_10645060
538 Ga0207703_10001954
539 Ga0207703_10066608
540 Ga0207639_10149379
541 Ga0207708_10037147
542 Ga0207708_10047289
543 Ga0207708_10050402
544 Ga0207708_10101936
545 Ga0207641_10025386
546 Ga0207641_10744806
547 Ga0207648_10063159
548 Ga0207648_10177424
549 Ga0207676_10036485
550 Ga0207676_10069573
551 Ga0207676_10092659
552 Ga0207676_10612040
553 Ga0207674_10000391
554 Ga0207674_10156757
555 Ga0207674_10287244
556 Ga0207675_100399322
557 Ga0207675_100645146
558 Ga0207428_10026232
559 Ga0268265_10201985
560 Ga0268264_10257509
561 Ga0265327_10013172
562 Ga0307513_10003044
563 Ga0307414_10229096
564 Ga0395898_0218067
565 Ga0242420_009507
566 Ga0453683_0071734
567 Ga0453683_0091926
568 Ga0451576_0055815
569 Ga0451576_0761936
570 Ga0451576_1033518
571 Ga0495629_0300272
572 Ga0495641_0150947
573 Ga0495651_0379817
574 Ga0495586_0004661
575 Ga0495658_0130506
576 Ga0495636_0061761
577 Ga0495614_0085539
578 Ga0496104_0356130
579 Ga0496106_0000981
580 Ga0496107_0314353
581 Ga0496113_0057966
582 Ga0501296_011701
583 Ga0501300_015225
584 Ga0501036_0541179
585 Ga0501037_0196015
586 Ga0501041_0110201
587 Ga0501071_0156417
588 Ga0501072_0055383
589 Ga0501074_0288504
590 Ga0501076_0085084
591 Ga0501076_0232619
592 Ga0501199_003338
593 Ga0501206_012783
594 Ga0501227_029066
595 Ga0501249_046532
596 Ga0501272_004503
597 Ga0501283_020217
598 nmdc:mga05p37_33355_c1
599 nmdc:mga05p37_38262_c1
600 nmdc:mga05p37_570676_c1
601 nmdc:mga05p37_63039_c1
602 nmdc:mga05p37_685638_c1
603 nmdc:mga09592_209315_c1
604 nmdc:mga09592_31880_c1
605 nmdc:mga0qj67_338243_c1
606 nmdc:mga06r32_114183_c1
607 nmdc:mga08y16_172056_c1
608 nmdc:mga08y16_23578_c1
609 nmdc:mga08y16_498274_c1
610 nmdc:mga0n895_277920_c1
611 nmdc:mga0n895_453818_c1
612 nmdc:mga0n895_510925_c1
613 nmdc:mga0rr50_102287_c1
614 nmdc:mga0rr50_131496_c1
615 nmdc:mga0rr50_219540_c1
616 nmdc:mga0a205_199898_c1
617 nmdc:mga0a205_26799_c2
618 nmdc:mga0a205_274243_c1
619 nmdc:mga0a205_56342_c1
620 Ga0501082_0572388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

41

302

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bbg-assembly1.cif.gz_A the crac channel orai in an unlatched-closed conformation 0.5256 134 248
7ljd-assembly1.cif.gz_R allosteric modulator ly3154207 binding to dopamine-bound dopamine receptor 1 in complex with minigs protein 0.4953 109 246
7ckz-assembly1.cif.gz_R cryo-em structure of dopamine and ly3154207 bound dopamine receptor drd1-gs signaling complex 0.4553 109 246
3gm2-assembly1.cif.gz_A crystal structure of the focal adhesion targeting (fat) domain of pyk2 0.4498 133 249
3aff-assembly1.cif.gz_B crystal structure of the hsaa monooxygenase from m. tuberculosis 0.4368 151 247
ID Description Score Start End Superfamily
af_O44692_1_270_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5716 132 248 1.20.1070.10
af_O76666_7_159_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5584 110 250 1.20.1070.10
af_Q59VX1_3_118_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5569 7 99 1.10.287.370
af_O76666_7_159_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5086 110 250 1.20.1070.10
af_A5JYW5_6_210_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5069 121 248 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A355H8J7-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9601 109 209 GO:0016020
AF-A0A3B0VMC5-F1-model_v4 FIG137887: membrane protein related to purine degradation 0.9515 109 247 GO:0009055
GO:0016020
GO:0020037
AF-W7W9S0-F1-model_v4 Putative membrane protein 0.9424 126 248 GO:0009055
GO:0016020
GO:0020037
AF-A0A3D0ZYF7-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9399 110 248 GO:0009055
GO:0016020
GO:0020037
AF-A0A257RKC8-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9396 109 247 GO:0009055
GO:0016020
GO:0020037

Map