F400429

General Info

Members Datasets Scaffolds Average Seq Length
309 185 618 289

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_360819_c1|nmdc:mga09592_360819_c1_34_1014
Length 326
Sequence MFGFAAADRHGTMAVLLQHGYGGAGMSVPQGLGIIDTMMGTRAGQIAKEQNYAPLRQGQLKDADSQAMNFPAQYMFKDVPWSDQARGASGPVDEPAQGADLLLPLMDKWDIEISMVGVSPSNEIAQKTLTSHPDRFVGAFEIDPNKGIEGIREMVHMYEKWGIKAVTAFPCGYFPQVPINDKKMYPFYAKCCELDIPIFCCAGIPGPRVPFKPQHVELIDEVMYDFPELTFVTRHGCEPWTALAVKLMLKWPGLHYSTSAFAPKHYPKDIIDYANTRGADKIIYAGYFPMGMHLDRIMTDMQSVPFKDEVWPKFLRENAKRVLKLS

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
104 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
105 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
106 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
107 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
108 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
109 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
180 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2738543028 Mycobacterium sp. YR782 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.32
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.01
Nodule 0
Rhizoplane 8.74
Rhizosphere 65.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_360819_c1 3300050508 Bacteria 1257
2 JGI25407J50210_10000537 3300003373 Bacteria 7625
3 JGI25407J50210_10023143 3300003373 Bacteria 1612
4 JGI25405J52794_10034687 3300003911 Bacteria 1055
5 Ga0065707_10131932 3300005295 Bacteria 1905
6 Ga0070676_10082938 3300005328 Bacteria 1949
7 Ga0070683_100322777 3300005329 Bacteria 1469
8 Ga0070683_100653048 3300005329 Bacteria 1007
9 Ga0068869_100166813 3300005334 Bacteria 1718
10 Ga0068868_100167114 3300005338 Bacteria 1820
11 Ga0070668_100227758 3300005347 Bacteria 1540
12 Ga0070675_100437151 3300005354 Bacteria 1172
13 Ga0070671_100003264 3300005355 Bacteria 12656
14 Ga0070671_100066735 3300005355 Bacteria 2998
15 Ga0070671_100518038 3300005355 Bacteria 1027
16 Ga0070709_10064240 3300005434 Bacteria 2347
17 Ga0070711_100012747 3300005439 Bacteria 5263
18 Ga0070706_100533075 3300005467 Bacteria 1092
19 Ga0070679_100289720 3300005530 Bacteria 1589
20 Ga0070684_100504616 3300005535 Bacteria 1120
21 Ga0068853_100079030 3300005539 Bacteria 2876
22 Ga0068855_100003349 3300005563 Bacteria 19619
23 Ga0068854_100178371 3300005578 Bacteria 1658
24 Ga0068856_100274834 3300005614 Bacteria 1701
25 Ga0068861_100219773 3300005719 Bacteria 1605
26 Ga0068858_100005694 3300005842 Bacteria 12179
27 Ga0068858_100054747 3300005842 Bacteria 3689
28 Ga0081455_10001431 3300005937 Bacteria 29530
29 Ga0081455_10032728 3300005937 Bacteria 4683
30 Ga0081455_10137553 3300005937 Bacteria 1901
31 Ga0081538_10000236 3300005981 Bacteria 62334
32 Ga0081538_10003587 3300005981 Bacteria 14593
33 Ga0081539_10016544 3300005985 Bacteria 5254
34 Ga0070717_10341630 3300006028 Bacteria 1337
35 Ga0075365_10007397 3300006038 Bacteria 6145
36 Ga0075365_10027596 3300006038 Bacteria 3614
37 Ga0075365_10041072 3300006038 Bacteria 3020
38 Ga0075365_10221796 3300006038 Bacteria 1326
39 Ga0075365_10262101 3300006038 Bacteria 1215
40 Ga0075368_10045454 3300006042 Bacteria 1735
41 Ga0075368_10071688 3300006042 Bacteria 1400
42 Ga0075363_100087380 3300006048 Bacteria 1712
43 Ga0075363_100113916 3300006048 Bacteria 1505
44 Ga0075363_100136446 3300006048 Bacteria 1379
45 Ga0075363_100287294 3300006048 Bacteria 953
46 Ga0075364_10001366 3300006051 Bacteria 13162
47 Ga0075364_10004615 3300006051 Bacteria 7940
48 Ga0075364_10005504 3300006051 Bacteria 7368
49 Ga0075364_10016780 3300006051 Bacteria 4561
50 Ga0075364_10034291 3300006051 Bacteria 3273
51 Ga0070712_100034131 3300006175 Bacteria 3447
52 Ga0075362_10003515 3300006177 Bacteria 5501
53 Ga0075362_10046102 3300006177 Bacteria 1938
54 Ga0075367_10032123 3300006178 Bacteria 3018
55 Ga0075367_10043969 3300006178 Bacteria 2616
56 Ga0075367_10072771 3300006178 Bacteria 2070
57 Ga0075367_10081143 3300006178 Bacteria 1962
58 Ga0075367_10089316 3300006178 Bacteria 1873
59 Ga0075367_10092320 3300006178 Bacteria 1843
60 Ga0075367_10208951 3300006178 Bacteria 1220
61 Ga0075367_10279227 3300006178 Bacteria 1050
62 Ga0075366_10183526 3300006195 Bacteria 1271
63 Ga0075370_10019231 3300006353 Bacteria 3718
64 Ga0075428_100001556 3300006844 Bacteria 24578
65 Ga0075428_100097030 3300006844 Bacteria 3213
66 Ga0075428_100112002 3300006844 Bacteria 2973
67 Ga0075428_100207438 3300006844 Bacteria 2118
68 Ga0075430_100002842 3300006846 Bacteria 14489
69 Ga0075431_100012267 3300006847 Bacteria 8649
70 Ga0075431_100194847 3300006847 Bacteria 2075
71 Ga0075429_100000385 3300006880 Bacteria 32534
72 Ga0075429_100073672 3300006880 Bacteria 2974
73 Ga0075429_100227118 3300006880 Bacteria 1635
74 Ga0105240_10006829 3300009093 Bacteria 16694
75 Ga0105240_10266916 3300009093 Bacteria 1972
76 Ga0105245_10397639 3300009098 Bacteria 1376
77 Ga0105245_10516316 3300009098 Bacteria 1213
78 Ga0114129_10003531 3300009147 Bacteria 21990
79 Ga0114129_10319335 3300009147 Bacteria 2065
80 Ga0105243_10539457 3300009148 Bacteria 1112
81 Ga0105241_10186449 3300009174 Bacteria 1724
82 Ga0105237_10120287 3300009545 Bacteria 2620
83 Ga0105238_10011947 3300009551 Bacteria 8749
84 Ga0105239_10041113 3300010375 Bacteria 5067
85 Ga0157374_10614900 3300013296 Bacteria 1097
86 Ga0157380_10202102 3300014326 Bacteria 1764
87 Ga0163161_10000882 3300017792 Bacteria 23332
88 Ga0213873_10002066 3300021358 Bacteria 3434
89 Ga0209051_1040209 3300025303 Bacteria 1679
90 Ga0207692_10082501 3300025898 Bacteria 1723
91 Ga0207684_10454408 3300025910 Bacteria 1100
92 Ga0207654_10151398 3300025911 Bacteria 1489
93 Ga0207695_10010176 3300025913 Bacteria 11534
94 Ga0207693_10047128 3300025915 Bacteria 3387
95 Ga0207663_10031434 3300025916 Bacteria 3142
96 Ga0207657_10156649 3300025919 Bacteria 1852
97 Ga0207652_10165674 3300025921 Bacteria 1982
98 Ga0207694_10260901 3300025924 Bacteria 1419
99 Ga0207659_10369791 3300025926 Bacteria 1193
100 Ga0207644_10008035 3300025931 Bacteria 6901
101 Ga0207644_10021235 3300025931 Bacteria 4420
102 Ga0207665_10045600 3300025939 Bacteria 2935
103 Ga0207667_10000328 3300025949 Bacteria 65878
104 Ga0207668_10207852 3300025972 Bacteria 1564
105 Ga0207640_10374648 3300025981 Bacteria 1151
106 Ga0207658_10250481 3300025986 Bacteria 1505
107 Ga0207677_10403148 3300026023 Bacteria 1160
108 Ga0207703_10015705 3300026035 Bacteria 5906
109 Ga0207648_10508043 3300026089 Bacteria 1103
110 Ga0207675_100098646 3300026118 Bacteria 2751
111 Ga0207675_100276468 3300026118 Bacteria 1631
112 Ga0207675_100454896 3300026118 Bacteria 1269
113 Ga0207675_100567328 3300026118 Bacteria 1135
114 Ga0207683_10341828 3300026121 Bacteria 1373
115 Ga0207698_10059558 3300026142 Bacteria 2966
116 Ga0265334_10000111 3300028573 Bacteria 53728
117 Ga0265338_10054760 3300028800 Bacteria 3554
118 Ga0307511_10000965 3300030521 Bacteria 30473
119 Ga0265327_10000504 3300031251 Bacteria 67749
120 Ga0265327_10001495 3300031251 Bacteria 28999
121 Ga0265327_10023790 3300031251 Bacteria 3616
122 Ga0265327_10031349 3300031251 Bacteria 2988
123 Ga0307513_10027131 3300031456 Bacteria 6582
124 Ga0316576_10012535 3300031727 Bacteria 5604
125 Ga0316576_10021655 3300031727 Bacteria 4450
126 Ga0316576_10115493 3300031727 Bacteria 2014
127 Ga0316578_10027952 3300031728 Bacteria 3191
128 Ga0307516_10000142 3300031730 Bacteria 87194
129 Ga0316577_10010435 3300031733 Bacteria 5015
130 Ga0307413_10021852 3300031824 Bacteria 3435
131 Ga0307407_10017126 3300031903 Bacteria 3627
132 Ga0307407_10447911 3300031903 Bacteria 936
133 Ga0307409_100135340 3300031995 Bacteria 2113
134 Ga0307416_100047198 3300032002 Bacteria 3407
135 Ga0307416_100279502 3300032002 Bacteria 1645
136 Ga0307414_10106055 3300032004 Bacteria 2126
137 Ga0307415_100016372 3300032126 Bacteria 4419
138 Ga0307415_100103814 3300032126 Bacteria 2092
139 Ga0316580_10042050 3300032139 Bacteria 1411
140 Ga0307507_10013757 3300033179 Bacteria 9766
141 Ga0316574_0005666 3300035398 Bacteria 6680
142 Ga0316574_0006153 3300035398 Bacteria 6463
143 Ga0316574_0260061 3300035398 Bacteria 1108
144 Ga0316574_0445779 3300035398 Bacteria 811
145 Ga0373931_0029966 3300035691 Bacteria 2798
146 Ga0373935_0212835 3300035692 Bacteria 1340
147 Ga0373937_0695620 3300036401 Bacteria 963
148 Ga0316582_0015768 3300036647 Bacteria 4331
149 Ga0316582_0036075 3300036647 Bacteria 3058
150 Ga0316584_0002929 3300036712 Bacteria 10964
151 Ga0316584_0090281 3300036712 Bacteria 2293
152 Ga0316584_0360120 3300036712 Bacteria 1043
153 Ga0373925_0072167 3300037068 Bacteria 2612
154 Ga0400483_082499 3300039062 Bacteria 7003
155 Ga0436365_1099673 3300039437 Bacteria 6277
156 Ga0436363_0286477 3300039450 Bacteria 1144
157 Ga0436363_1390401 3300039450 Bacteria 1337
158 Ga0436362_0982343 3300039453 Bacteria 8162
159 Ga0439448_0158708 3300042005 Bacteria 786
160 Ga0439450_006561 3300042008 Bacteria 2100
161 Ga0439463_001899 3300042016 Bacteria 5424
162 Ga0439444_0006197 3300042437 Bacteria 1801
163 Ga0439464_0019792 3300042439 Bacteria 1839
164 Ga0439460_0003908 3300042461 Bacteria 3617
165 Ga0439440_0001242 3300042993 Bacteria 4597
166 Ga0466963_0056775 3300044694 Bacteria 2606
167 Ga0466968_0150795 3300044735 Bacteria 1069
168 Ga0466967_0017764 3300045976 Bacteria 5661
169 Ga0466967_0091069 3300045976 Bacteria 2771
170 Ga0495629_0141535 3300046459 Bacteria 1674
171 Ga0495638_0021729 3300046460 Bacteria 4221
172 Ga0495638_0120831 3300046460 Bacteria 1548
173 Ga0495653_0026468 3300046463 Bacteria 4651
174 Ga0495608_0020933 3300046511 Bacteria 4493
175 Ga0495628_0155603 3300046516 Bacteria 1739
176 Ga0495628_0197251 3300046516 Bacteria 1518
177 Ga0495630_0052968 3300046517 Bacteria 3038
178 Ga0495648_0120183 3300046524 Bacteria 1414
179 Ga0495654_0052325 3300046530 Bacteria 1989
180 Ga0495586_0059239 3300046535 Bacteria 2081
181 Ga0495587_0008662 3300046536 Bacteria 6536
182 Ga0495667_0001401 3300046559 Bacteria 15883
183 Ga0495667_0076942 3300046559 Bacteria 2171
184 Ga0495625_0083994 3300046660 Bacteria 2212
185 Ga0495657_0002333 3300046675 Bacteria 15985
186 Ga0495672_0002396 3300047320 Bacteria 17320
187 Ga0495680_0001093 3300047322 Bacteria 30065
188 Ga0495680_0102373 3300047322 Bacteria 2132
189 Ga0495680_0112301 3300047322 Bacteria 2019
190 Ga0495680_0148704 3300047322 Bacteria 1709
191 Ga0495602_0064753 3300048088 Bacteria 3158
192 Ga0496100_0025521 3300048903 Bacteria 3615
193 Ga0496100_0037005 3300048903 Bacteria 3082
194 Ga0496101_0007956 3300048904 Bacteria 6908
195 Ga0496102_0014049 3300048905 Bacteria 6953
196 Ga0496102_0085376 3300048905 Bacteria 2914
197 Ga0496103_0033644 3300048906 Bacteria 3132
198 Ga0496103_0042300 3300048906 Bacteria 2803
199 Ga0496104_0040193 3300048907 Bacteria 4383
200 Ga0496104_0091726 3300048907 Bacteria 2904
201 Ga0496105_0042213 3300048908 Bacteria 3759
202 Ga0496105_0290259 3300048908 Bacteria 1317
203 Ga0496107_0017426 3300048910 Bacteria 5054
204 Ga0496107_0154385 3300048910 Bacteria 1699
205 Ga0496108_0513994 3300048911 Bacteria 1046
206 Ga0496109_0004757 3300048912 Bacteria 11337
207 Ga0496109_0093415 3300048912 Bacteria 2784
208 Ga0496109_0143922 3300048912 Bacteria 2230
209 Ga0496109_0163418 3300048912 Bacteria 2086
210 Ga0496109_0221612 3300048912 Bacteria 1779
211 Ga0496110_0040684 3300048913 Bacteria 4052
212 Ga0496110_0103505 3300048913 Bacteria 2554
213 Ga0496111_0243166 3300048914 Bacteria 1336
214 Ga0496114_0063916 3300048917 Bacteria 3082
215 Ga0496114_0089297 3300048917 Bacteria 2615
216 Ga0496114_0092531 3300048917 Bacteria 2569
217 Ga0496114_0120014 3300048917 Bacteria 2261
218 Ga0496115_0011152 3300048918 Bacteria 6734
219 Ga0496126_0000027 3300048929 Bacteria 396518
220 Ga0496126_0000036 3300048929 Bacteria 354901
221 Ga0496126_0015580 3300048929 Bacteria 7639
222 Ga0501031_0131380 3300049568 Bacteria 1636
223 Ga0501033_0018252 3300049570 Bacteria 5300
224 Ga0501033_0035217 3300049570 Bacteria 3754
225 Ga0501034_0006547 3300049571 Bacteria 12510
226 Ga0501034_0009211 3300049571 Bacteria 10356
227 Ga0501034_0066573 3300049571 Bacteria 3616
228 Ga0501034_0321942 3300049571 Bacteria 1479
229 Ga0501034_0333340 3300049571 Bacteria 1448
230 Ga0501039_0251939 3300049575 Bacteria 1388
231 Ga0501040_0317979 3300049576 Bacteria 1113
232 Ga0501041_0297007 3300049577 Bacteria 1017
233 Ga0501042_0107353 3300049578 Bacteria 2010
234 Ga0501043_0574604 3300049579 Bacteria 835
235 Ga0501047_0030930 3300049581 Bacteria 5161
236 Ga0501047_0046536 3300049581 Bacteria 4193
237 Ga0501047_0073417 3300049581 Bacteria 3294
238 Ga0501068_0043264 3300049584 Bacteria 2709
239 Ga0501068_0121014 3300049584 Bacteria 1632
240 Ga0501069_0055462 3300049585 Bacteria 2208
241 Ga0501071_0004531 3300049587 Bacteria 8813
242 Ga0501075_0186877 3300049591 Bacteria 1580
243 Ga0501076_0152263 3300049592 Bacteria 1881
244 Ga0501077_0005176 3300049593 Bacteria 7922
245 Ga0501079_0310607 3300049741 Bacteria 1234
246 Ga0501044_0000605 3300049823 Bacteria 43495
247 Ga0501044_0012203 3300049823 Bacteria 9301
248 Ga0501044_0021332 3300049823 Bacteria 6913
249 Ga0501044_0324675 3300049823 Bacteria 1463
250 nmdc:mga03683_141740_c1 3300050489 Bacteria 1081
251 nmdc:mga03683_18086_c2 3300050489 Bacteria 1659
252 nmdc:mga03683_6211_c1 3300050489 Bacteria 4077
253 nmdc:mga03n38_153119_c1 3300050490 Bacteria 1162
254 nmdc:mga03n38_54968_c1 3300050490 Bacteria 1792
255 nmdc:mga03n38_55576_c1 3300050490 Bacteria 1784
256 nmdc:mga00v17_1610_c1 3300050491 Bacteria 11786
257 nmdc:mga00v17_168202_c1 3300050491 Bacteria 1413
258 nmdc:mga00v17_199708_c1 3300050491 Bacteria 1293
259 nmdc:mga00v17_259734_c1 3300050491 Bacteria 1127
260 nmdc:mga00v17_270223_c1 3300050491 Bacteria 1103
261 nmdc:mga00v17_5199_c1 3300050491 Bacteria 6848
262 nmdc:mga00v17_9141_c1 3300050491 Bacteria 5351
263 nmdc:mga00v17_9895_c1 3300050491 Bacteria 5186
264 nmdc:mga0yw44_113633_c1 3300050492 Bacteria 1737
265 nmdc:mga0yw44_190680_c1 3300050492 Bacteria 1352
266 nmdc:mga0yw44_248600_c1 3300050492 Bacteria 1183
267 nmdc:mga0yw44_28882_c1 3300050492 Bacteria 3195
268 nmdc:mga0yw44_385040_c1 3300050492 Bacteria 947
269 nmdc:mga0yw44_51482_c1 3300050492 Bacteria 2493
270 nmdc:mga0yw44_6812_c1 3300050492 Bacteria 5555
271 nmdc:mga0k408_92750_c1 3300050493 Bacteria 1775
272 nmdc:mga06z11_113899_c1 3300050494 Bacteria 1501
273 nmdc:mga06z11_124523_c1 3300050494 Bacteria 1441
274 nmdc:mga06z11_138083_c1 3300050494 Bacteria 1375
275 nmdc:mga06z11_140890_c1 3300050494 Bacteria 1363
276 nmdc:mga06z11_148252_c1 3300050494 Bacteria 1332
277 nmdc:mga06z11_21154_c1 3300050494 Bacteria 3018
278 nmdc:mga07m45_19120_c1 3300050496 Bacteria 3708
279 nmdc:mga05p37_2063_c1 3300050507 Bacteria 23423
280 nmdc:mga09592_408_c1 3300050508 Bacteria 31545
281 nmdc:mga09592_70700_c1 3300050508 Bacteria 2962
282 nmdc:mga0qj67_218002_c1 3300050509 Bacteria 1549
283 nmdc:mga0qj67_525_c1 3300050509 Bacteria 26055
284 nmdc:mga06r32_13674_c1 3300050510 Bacteria 7361
285 nmdc:mga06r32_149678_c1 3300050510 Bacteria 2312
286 nmdc:mga06r32_78927_c1 3300050510 Bacteria 3201
287 nmdc:mga06r32_9668_c1 3300050510 Bacteria 8710
288 nmdc:mga0n895_855080_c1 3300050512 Bacteria 897
289 nmdc:mga0sz30_8347_c1 3300050516 Bacteria 3908
290 Ga0495601_0054812 3300053077 Bacteria 2523
291 Ga0495595_0038659 3300053084 Bacteria 2175
292 Ga0495595_0066828 3300053084 Bacteria 1694
293 Ga0495595_0199918 3300053084 Bacteria 995
294 Ga0495619_0010306 3300053085 Bacteria 5882
295 Ga0495619_0038905 3300053085 Bacteria 3104
296 Ga0500643_001995 3300053087 Bacteria 11030
297 Ga0500643_023023 3300053087 Bacteria 1996
298 Ga0500566_0000200 3300053094 Bacteria 31433
299 Ga0500566_0000791 3300053094 Bacteria 17955
300 Ga0500652_075593 3300053131 Bacteria 1399
301 Ga0500616_0005117 3300053153 Bacteria 9034
302 Ga0500627_0002887 3300053158 Bacteria 5198
303 Ga0500645_000004 3300053730 Bacteria 305014
304 Ga0500645_004098 3300053730 Bacteria 5699
305 Ga0501084_0064499 3300054114 Bacteria 3065
306 Ga0587091_019702 3300059511 Bacteria 1163
307 Ga0501082_0077154 3300060353 Bacteria 2873
308 Ga0530510_0002633 3300061734 Bacteria 12332
309 2739333768 2738543028 Bacteria 6917070
310 nmdc:mga09592_360819_c1
311 JGI25407J50210_10000537
312 JGI25407J50210_10023143
313 JGI25405J52794_10034687
314 Ga0065707_10131932
315 Ga0070676_10082938
316 Ga0070683_100322777
317 Ga0070683_100653048
318 Ga0068869_100166813
319 Ga0068868_100167114
320 Ga0070668_100227758
321 Ga0070675_100437151
322 Ga0070671_100003264
323 Ga0070671_100066735
324 Ga0070671_100518038
325 Ga0070709_10064240
326 Ga0070711_100012747
327 Ga0070706_100533075
328 Ga0070679_100289720
329 Ga0070684_100504616
330 Ga0068853_100079030
331 Ga0068855_100003349
332 Ga0068854_100178371
333 Ga0068856_100274834
334 Ga0068861_100219773
335 Ga0068858_100005694
336 Ga0068858_100054747
337 Ga0081455_10001431
338 Ga0081455_10032728
339 Ga0081455_10137553
340 Ga0081538_10000236
341 Ga0081538_10003587
342 Ga0081539_10016544
343 Ga0070717_10341630
344 Ga0075365_10007397
345 Ga0075365_10027596
346 Ga0075365_10041072
347 Ga0075365_10221796
348 Ga0075365_10262101
349 Ga0075368_10045454
350 Ga0075368_10071688
351 Ga0075363_100087380
352 Ga0075363_100113916
353 Ga0075363_100136446
354 Ga0075363_100287294
355 Ga0075364_10001366
356 Ga0075364_10004615
357 Ga0075364_10005504
358 Ga0075364_10016780
359 Ga0075364_10034291
360 Ga0070712_100034131
361 Ga0075362_10003515
362 Ga0075362_10046102
363 Ga0075367_10032123
364 Ga0075367_10043969
365 Ga0075367_10072771
366 Ga0075367_10081143
367 Ga0075367_10089316
368 Ga0075367_10092320
369 Ga0075367_10208951
370 Ga0075367_10279227
371 Ga0075366_10183526
372 Ga0075370_10019231
373 Ga0075428_100001556
374 Ga0075428_100097030
375 Ga0075428_100112002
376 Ga0075428_100207438
377 Ga0075430_100002842
378 Ga0075431_100012267
379 Ga0075431_100194847
380 Ga0075429_100000385
381 Ga0075429_100073672
382 Ga0075429_100227118
383 Ga0105240_10006829
384 Ga0105240_10266916
385 Ga0105245_10397639
386 Ga0105245_10516316
387 Ga0114129_10003531
388 Ga0114129_10319335
389 Ga0105243_10539457
390 Ga0105241_10186449
391 Ga0105237_10120287
392 Ga0105238_10011947
393 Ga0105239_10041113
394 Ga0157374_10614900
395 Ga0157380_10202102
396 Ga0163161_10000882
397 Ga0213873_10002066
398 Ga0209051_1040209
399 Ga0207692_10082501
400 Ga0207684_10454408
401 Ga0207654_10151398
402 Ga0207695_10010176
403 Ga0207693_10047128
404 Ga0207663_10031434
405 Ga0207657_10156649
406 Ga0207652_10165674
407 Ga0207694_10260901
408 Ga0207659_10369791
409 Ga0207644_10008035
410 Ga0207644_10021235
411 Ga0207665_10045600
412 Ga0207667_10000328
413 Ga0207668_10207852
414 Ga0207640_10374648
415 Ga0207658_10250481
416 Ga0207677_10403148
417 Ga0207703_10015705
418 Ga0207648_10508043
419 Ga0207675_100098646
420 Ga0207675_100276468
421 Ga0207675_100454896
422 Ga0207675_100567328
423 Ga0207683_10341828
424 Ga0207698_10059558
425 Ga0265334_10000111
426 Ga0265338_10054760
427 Ga0307511_10000965
428 Ga0265327_10000504
429 Ga0265327_10001495
430 Ga0265327_10023790
431 Ga0265327_10031349
432 Ga0307513_10027131
433 Ga0316576_10012535
434 Ga0316576_10021655
435 Ga0316576_10115493
436 Ga0316578_10027952
437 Ga0307516_10000142
438 Ga0316577_10010435
439 Ga0307413_10021852
440 Ga0307407_10017126
441 Ga0307407_10447911
442 Ga0307409_100135340
443 Ga0307416_100047198
444 Ga0307416_100279502
445 Ga0307414_10106055
446 Ga0307415_100016372
447 Ga0307415_100103814
448 Ga0316580_10042050
449 Ga0307507_10013757
450 Ga0316574_0005666
451 Ga0316574_0006153
452 Ga0316574_0260061
453 Ga0316574_0445779
454 Ga0373931_0029966
455 Ga0373935_0212835
456 Ga0373937_0695620
457 Ga0316582_0015768
458 Ga0316582_0036075
459 Ga0316584_0002929
460 Ga0316584_0090281
461 Ga0316584_0360120
462 Ga0373925_0072167
463 Ga0400483_082499
464 Ga0436365_1099673
465 Ga0436363_0286477
466 Ga0436363_1390401
467 Ga0436362_0982343
468 Ga0439448_0158708
469 Ga0439450_006561
470 Ga0439463_001899
471 Ga0439444_0006197
472 Ga0439464_0019792
473 Ga0439460_0003908
474 Ga0439440_0001242
475 Ga0466963_0056775
476 Ga0466968_0150795
477 Ga0466967_0017764
478 Ga0466967_0091069
479 Ga0495629_0141535
480 Ga0495638_0021729
481 Ga0495638_0120831
482 Ga0495653_0026468
483 Ga0495608_0020933
484 Ga0495628_0155603
485 Ga0495628_0197251
486 Ga0495630_0052968
487 Ga0495648_0120183
488 Ga0495654_0052325
489 Ga0495586_0059239
490 Ga0495587_0008662
491 Ga0495667_0001401
492 Ga0495667_0076942
493 Ga0495625_0083994
494 Ga0495657_0002333
495 Ga0495672_0002396
496 Ga0495680_0001093
497 Ga0495680_0102373
498 Ga0495680_0112301
499 Ga0495680_0148704
500 Ga0495602_0064753
501 Ga0496100_0025521
502 Ga0496100_0037005
503 Ga0496101_0007956
504 Ga0496102_0014049
505 Ga0496102_0085376
506 Ga0496103_0033644
507 Ga0496103_0042300
508 Ga0496104_0040193
509 Ga0496104_0091726
510 Ga0496105_0042213
511 Ga0496105_0290259
512 Ga0496107_0017426
513 Ga0496107_0154385
514 Ga0496108_0513994
515 Ga0496109_0004757
516 Ga0496109_0093415
517 Ga0496109_0143922
518 Ga0496109_0163418
519 Ga0496109_0221612
520 Ga0496110_0040684
521 Ga0496110_0103505
522 Ga0496111_0243166
523 Ga0496114_0063916
524 Ga0496114_0089297
525 Ga0496114_0092531
526 Ga0496114_0120014
527 Ga0496115_0011152
528 Ga0496126_0000027
529 Ga0496126_0000036
530 Ga0496126_0015580
531 Ga0501031_0131380
532 Ga0501033_0018252
533 Ga0501033_0035217
534 Ga0501034_0006547
535 Ga0501034_0009211
536 Ga0501034_0066573
537 Ga0501034_0321942
538 Ga0501034_0333340
539 Ga0501039_0251939
540 Ga0501040_0317979
541 Ga0501041_0297007
542 Ga0501042_0107353
543 Ga0501043_0574604
544 Ga0501047_0030930
545 Ga0501047_0046536
546 Ga0501047_0073417
547 Ga0501068_0043264
548 Ga0501068_0121014
549 Ga0501069_0055462
550 Ga0501071_0004531
551 Ga0501075_0186877
552 Ga0501076_0152263
553 Ga0501077_0005176
554 Ga0501079_0310607
555 Ga0501044_0000605
556 Ga0501044_0012203
557 Ga0501044_0021332
558 Ga0501044_0324675
559 nmdc:mga03683_141740_c1
560 nmdc:mga03683_18086_c2
561 nmdc:mga03683_6211_c1
562 nmdc:mga03n38_153119_c1
563 nmdc:mga03n38_54968_c1
564 nmdc:mga03n38_55576_c1
565 nmdc:mga00v17_1610_c1
566 nmdc:mga00v17_168202_c1
567 nmdc:mga00v17_199708_c1
568 nmdc:mga00v17_259734_c1
569 nmdc:mga00v17_270223_c1
570 nmdc:mga00v17_5199_c1
571 nmdc:mga00v17_9141_c1
572 nmdc:mga00v17_9895_c1
573 nmdc:mga0yw44_113633_c1
574 nmdc:mga0yw44_190680_c1
575 nmdc:mga0yw44_248600_c1
576 nmdc:mga0yw44_28882_c1
577 nmdc:mga0yw44_385040_c1
578 nmdc:mga0yw44_51482_c1
579 nmdc:mga0yw44_6812_c1
580 nmdc:mga0k408_92750_c1
581 nmdc:mga06z11_113899_c1
582 nmdc:mga06z11_124523_c1
583 nmdc:mga06z11_138083_c1
584 nmdc:mga06z11_140890_c1
585 nmdc:mga06z11_148252_c1
586 nmdc:mga06z11_21154_c1
587 nmdc:mga07m45_19120_c1
588 nmdc:mga05p37_2063_c1
589 nmdc:mga09592_408_c1
590 nmdc:mga09592_70700_c1
591 nmdc:mga0qj67_218002_c1
592 nmdc:mga0qj67_525_c1
593 nmdc:mga06r32_13674_c1
594 nmdc:mga06r32_149678_c1
595 nmdc:mga06r32_78927_c1
596 nmdc:mga06r32_9668_c1
597 nmdc:mga0n895_855080_c1
598 nmdc:mga0sz30_8347_c1
599 Ga0495601_0054812
600 Ga0495595_0038659
601 Ga0495595_0066828
602 Ga0495595_0199918
603 Ga0495619_0010306
604 Ga0495619_0038905
605 Ga0500643_001995
606 Ga0500643_023023
607 Ga0500566_0000200
608 Ga0500566_0000791
609 Ga0500652_075593
610 Ga0500616_0005117
611 Ga0500627_0002887
612 Ga0500645_000004
613 Ga0500645_004098
614 Ga0501084_0064499
615 Ga0587091_019702
616 Ga0501082_0077154
617 Ga0530510_0002633
618 2739333768

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

119

325

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjp-assembly1.cif.gz_B crystal structure of an uncharacterized amidohydrolase cac3332 from clostridium acetobutylicum 0.7639 63 285
4epk-assembly1.cif.gz_B evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase 0.7613 64 286
4ign-assembly2.cif.gz_B 2.32 angstrom x-ray crystal structure of r47a mutant of human acmsd 0.7609 64 287
4eri-assembly1.cif.gz_A evidence for a dual role of an active site histidine in alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase 0.7542 61 286
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.753 8 284
ID Description Score Start End Superfamily
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.895 65 285 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8261 10 287 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8203 10 287 3.20.20.140
4eraA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7689 61 285 3.20.20.140
3cjpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7631 63 285 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A7K2CR24-F1-model_v4 Amidohydrolase family protein 1.001 176 286 GO:0016787
AF-A0A6I3FIH8-F1-model_v4 Amidohydrolase family protein 0.9922 200 284 GO:0016787
AF-A0A351DH32-F1-model_v4 Amidohydrolase 0.9921 61 285 GO:0016787
GO:0016831
AF-A0A6J7R141-F1-model_v4 Unannotated protein 0.991 194 287 GO:0016787
AF-A0A6J7KSB1-F1-model_v4 Unannotated protein 0.9907 132 287 GO:0016787

Map