F400406

General Info

Members Datasets Scaffolds Average Seq Length
309 179 618 185

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0080203|Ga0501031_0080203_683_1327
Length 214
Sequence MALTLPRICYTFDADLPMRCNTAPAGRIARMSTPSPDVSVRVAWSEDADAIAAVQVRAWREEYAGTLPGDVLSSLDPADFAEAWRASLARPKDARNRVLVALERNTVRGFAVTGPASDPDCDPVSDGEIVELTVDPGQTRHGHGSRLVQACAETLKADRFTAAVIWLGSSDDVRRGFLTGAGWATDGAHRELDLHGDGTVRVKQVRLHTDLSDV

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
93 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
94 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
95 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
96 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2643221561 Nocardioides sp. Root151 Isolate Unclassified
173 2643221615 Nocardioides sp. Root224 Isolate Unclassified
174 2643221641 Nocardioides sp. Root122 Isolate Unclassified
175 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
176 2643221696 Nocardioides sp. Root140 Isolate Unclassified
177 2739367898 Nocardioides sp. CF479 Isolate Unclassified
178 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
179 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0.65
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.56
Nodule 0
Rhizoplane 6.15
Rhizosphere 76.38
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0080203 3300049568 Bacteria 2127
2 LJQas_1005131 3300000549 Bacteria 1672
3 rootH1_10105145 3300003316 Bacteria 1289
4 Ga0070658_10335925 3300005327 Bacteria 1292
5 Ga0070683_100088511 3300005329 Bacteria 2905
6 Ga0070683_100865769 3300005329 Bacteria 867
7 Ga0070670_100583926 3300005331 Bacteria 999
8 Ga0070677_10195308 3300005333 Bacteria 973
9 Ga0070680_100070536 3300005336 Bacteria 2870
10 Ga0070680_101176071 3300005336 Bacteria 663
11 Ga0070682_100947090 3300005337 Bacteria 711
12 Ga0068868_100328389 3300005338 Bacteria 1305
13 Ga0068868_100822092 3300005338 Bacteria 840
14 Ga0070660_100225453 3300005339 Bacteria 1524
15 Ga0070687_100072110 3300005343 Bacteria 1858
16 Ga0070675_100525774 3300005354 Bacteria 1068
17 Ga0070671_100282359 3300005355 Bacteria 1412
18 Ga0070674_100898807 3300005356 Bacteria 771
19 Ga0070688_100618050 3300005365 Bacteria 831
20 Ga0070659_101200272 3300005366 Bacteria 671
21 Ga0070667_100189420 3300005367 Bacteria 1822
22 Ga0070667_101184397 3300005367 Bacteria 715
23 Ga0070714_100159991 3300005435 Bacteria 2037
24 Ga0070700_100139872 3300005441 Bacteria 1644
25 Ga0070662_100647632 3300005457 Bacteria 891
26 Ga0070681_10502506 3300005458 Bacteria 1126
27 Ga0068867_100669938 3300005459 Bacteria 912
28 Ga0070684_100262503 3300005535 Bacteria 1580
29 Ga0070672_100205582 3300005543 Bacteria 1648
30 Ga0068854_100611153 3300005578 Bacteria 932
31 Ga0068856_100050954 3300005614 Bacteria 4082
32 Ga0070702_100133823 3300005615 Bacteria 1570
33 Ga0068852_100225752 3300005616 Bacteria 1783
34 Ga0068870_10489433 3300005840 Bacteria 818
35 Ga0081455_10183143 3300005937 Bacteria 1584
36 Ga0081539_10068154 3300005985 Bacteria 1921
37 Ga0075365_10027151 3300006038 Bacteria 3639
38 Ga0075365_10048610 3300006038 Bacteria 2792
39 Ga0075365_10058745 3300006038 Bacteria 2561
40 Ga0075365_10443288 3300006038 Bacteria 917
41 Ga0075365_10655503 3300006038 Bacteria 742
42 Ga0075368_10109289 3300006042 Bacteria 1139
43 Ga0075363_100056459 3300006048 Bacteria 2105
44 Ga0075363_100061799 3300006048 Bacteria 2019
45 Ga0075363_100111353 3300006048 Bacteria 1522
46 Ga0075363_100179664 3300006048 Bacteria 1203
47 Ga0075364_10007132 3300006051 Bacteria 6611
48 Ga0075364_10021783 3300006051 Bacteria 4040
49 Ga0075364_10047790 3300006051 Bacteria 2788
50 Ga0075364_10079982 3300006051 Bacteria 2160
51 Ga0075364_10338938 3300006051 Bacteria 1024
52 Ga0075362_10004426 3300006177 Bacteria 5046
53 Ga0075362_10054191 3300006177 Bacteria 1802
54 Ga0075367_10040612 3300006178 Bacteria 2717
55 Ga0075367_10134524 3300006178 Bacteria 1529
56 Ga0075370_10006064 3300006353 Bacteria 6057
57 Ga0075370_10090173 3300006353 Bacteria 1768
58 Ga0075428_100001062 3300006844 Bacteria 29171
59 Ga0075430_100002892 3300006846 Bacteria 14365
60 Ga0075431_100027745 3300006847 Bacteria 5811
61 Ga0075429_100001461 3300006880 Bacteria 19411
62 Ga0111539_10572624 3300009094 Bacteria 1315
63 Ga0111539_10613529 3300009094 Bacteria 1267
64 Ga0105245_10423838 3300009098 Bacteria 1334
65 Ga0114129_10006100 3300009147 Bacteria 17093
66 Ga0105243_10018194 3300009148 Bacteria 5320
67 Ga0105238_11122751 3300009551 Bacteria 809
68 Ga0105249_10592300 3300009553 Bacteria 1163
69 Ga0105246_10466485 3300011119 Bacteria 1065
70 Ga0157371_10388005 3300013102 Bacteria 1020
71 Ga0157369_10276691 3300013105 Bacteria 1748
72 Ga0157369_10769450 3300013105 Bacteria 990
73 Ga0157372_10203893 3300013307 Bacteria 2291
74 Ga0157372_10347870 3300013307 Bacteria 1727
75 Ga0157372_10800420 3300013307 Bacteria 1095
76 Ga0157375_10138395 3300013308 Bacteria 2560
77 Ga0157375_10168134 3300013308 Bacteria 2339
78 Ga0157380_10294684 3300014326 Bacteria 1491
79 Ga0163161_10444052 3300017792 Bacteria 1047
80 Ga0206353_10086135 3300020082 Bacteria 2346
81 Ga0206353_10465933 3300020082 Bacteria 1552
82 Ga0207647_10021088 3300025904 Bacteria 4355
83 Ga0207643_10355677 3300025908 Bacteria 920
84 Ga0207707_11058543 3300025912 Bacteria 663
85 Ga0207662_10135694 3300025918 Bacteria 1555
86 Ga0207657_10272610 3300025919 Bacteria 1345
87 Ga0207694_10353548 3300025924 Unclassified 1216
88 Ga0207687_10162458 3300025927 Bacteria 1715
89 Ga0207664_10078409 3300025929 Bacteria 2679
90 Ga0207709_10178077 3300025935 Bacteria 1499
91 Ga0207691_10182808 3300025940 Bacteria 1831
92 Ga0207661_10122234 3300025944 Bacteria 2218
93 Ga0207658_11212806 3300025986 Bacteria 690
94 Ga0207677_10492568 3300026023 Bacteria 1058
95 Ga0207708_10117987 3300026075 Bacteria 2066
96 Ga0207708_10800375 3300026075 Bacteria 811
97 Ga0207702_10229964 3300026078 Bacteria 1732
98 Ga0207702_10695536 3300026078 Bacteria 1002
99 Ga0207648_10564064 3300026089 Bacteria 1047
100 Ga0207674_10109040 3300026116 Bacteria 2745
101 Ga0207675_100105691 3300026118 Bacteria 2654
102 Ga0207675_100123181 3300026118 Bacteria 2454
103 Ga0207675_101804567 3300026118 Bacteria 631
104 Ga0209813_10045130 3300027866 Bacteria 1357
105 Ga0268265_11266665 3300028380 Bacteria 737
106 Ga0307513_10414827 3300031456 Bacteria 1078
107 Ga0307408_100361497 3300031548 Bacteria 1235
108 Ga0307405_10124700 3300031731 Bacteria 1769
109 Ga0307413_10016942 3300031824 Bacteria 3783
110 Ga0307413_10283724 3300031824 Bacteria 1247
111 Ga0307413_10370760 3300031824 Bacteria 1112
112 Ga0307413_10672239 3300031824 Bacteria 857
113 Ga0307410_10338922 3300031852 Bacteria 1198
114 Ga0307410_10381395 3300031852 Bacteria 1134
115 Ga0307410_10648070 3300031852 Bacteria 886
116 Ga0307406_10374849 3300031901 Bacteria 1120
117 Ga0307407_10047888 3300031903 Bacteria 2429
118 Ga0307407_10068502 3300031903 Bacteria 2102
119 Ga0307407_10458092 3300031903 Bacteria 927
120 Ga0307407_10644436 3300031903 Bacteria 793
121 Ga0307412_10343684 3300031911 Bacteria 1195
122 Ga0307409_100040103 3300031995 Bacteria 3482
123 Ga0307409_100075438 3300031995 Bacteria 2700
124 Ga0307409_100204296 3300031995 Bacteria 1770
125 Ga0307409_100681707 3300031995 Bacteria 1025
126 Ga0307416_100210705 3300032002 Bacteria 1853
127 Ga0307416_100246376 3300032002 Bacteria 1736
128 Ga0307416_101113338 3300032002 Bacteria 894
129 Ga0307414_10194320 3300032004 Bacteria 1645
130 Ga0307414_10854413 3300032004 Bacteria 832
131 Ga0307411_10068950 3300032005 Bacteria 2386
132 Ga0307411_10609436 3300032005 Bacteria 940
133 Ga0307415_100252923 3300032126 Bacteria 1433
134 Ga0307415_100302540 3300032126 Bacteria 1325
135 Ga0307415_100441144 3300032126 Bacteria 1123
136 Ga0395901_0068859 3300038443 Bacteria 3686
137 Ga0395901_0079697 3300038443 Bacteria 3419
138 Ga0439436_0071934 3300041404 Bacteria 964
139 Ga0439438_012542 3300041405 Bacteria 2596
140 Ga0439447_048418 3300041407 Bacteria 1020
141 Ga0439461_0015980 3300041410 Bacteria 1443
142 Ga0439431_0023198 3300041997 Bacteria 1500
143 Ga0439445_0118821 3300042004 Bacteria 758
144 Ga0439446_0003731 3300042156 Bacteria 3806
145 Ga0439434_0029454 3300042435 Bacteria 1664
146 Ga0466972_0086669 3300044658 Bacteria 1488
147 Ga0466965_0198663 3300044683 Bacteria 1063
148 Ga0466966_0044839 3300044684 Bacteria 2829
149 Ga0466961_0744845 3300044693 Bacteria 586
150 Ga0466963_0130188 3300044694 Bacteria 1738
151 Ga0466970_0047388 3300044765 Bacteria 2290
152 Ga0466970_0248752 3300044765 Bacteria 996
153 Ga0466960_0000585 3300044901 Bacteria 12614
154 Ga0466960_0001472 3300044901 Bacteria 8579
155 Ga0466960_0006362 3300044901 Bacteria 4735
156 Ga0466960_0024769 3300044901 Bacteria 2710
157 Ga0466960_0120837 3300044901 Bacteria 1372
158 Ga0466967_0020988 3300045976 Bacteria 5291
159 Ga0466967_0157617 3300045976 Bacteria 2128
160 Ga0466967_0163913 3300045976 Bacteria 2088
161 Ga0466967_0295798 3300045976 Bacteria 1557
162 Ga0495664_0113239 3300046477 Bacteria 1638
163 Ga0495620_0178084 3300046515 Bacteria 823
164 Ga0495633_0234884 3300046558 Bacteria 838
165 Ga0496100_0102344 3300048903 Bacteria 1976
166 Ga0496102_0098023 3300048905 Bacteria 2720
167 Ga0496102_0488761 3300048905 Bacteria 1153
168 Ga0496103_0015924 3300048906 Bacteria 4483
169 Ga0496104_0423221 3300048907 Bacteria 1244
170 Ga0496106_0056792 3300048909 Bacteria 2959
171 Ga0496107_0534029 3300048910 Bacteria 869
172 Ga0496108_0078463 3300048911 Bacteria 2795
173 Ga0496109_0277958 3300048912 Bacteria 1578
174 Ga0496109_0516143 3300048912 Bacteria 1128
175 Ga0496110_0030446 3300048913 Bacteria 4653
176 Ga0496110_0246247 3300048913 Bacteria 1627
177 Ga0496110_0344349 3300048913 Bacteria 1358
178 Ga0496110_0453575 3300048913 Bacteria 1168
179 Ga0496110_0536590 3300048913 Bacteria 1064
180 Ga0496111_0545457 3300048914 Bacteria 851
181 Ga0496113_0061643 3300048916 Bacteria 2830
182 Ga0496113_0540793 3300048916 Bacteria 935
183 Ga0496114_0163631 3300048917 Bacteria 1936
184 Ga0501031_0003326 3300049568 Bacteria 10320
185 Ga0501031_0029455 3300049568 Bacteria 3581
186 Ga0501031_0048192 3300049568 Bacteria 2778
187 Ga0501032_0032496 3300049569 Bacteria 3577
188 Ga0501032_0072075 3300049569 Bacteria 2302
189 Ga0501032_0613430 3300049569 Bacteria 692
190 Ga0501033_0647265 3300049570 Bacteria 722
191 Ga0501034_0570964 3300049571 Bacteria 1039
192 Ga0501034_0772278 3300049571 Bacteria 855
193 Ga0501036_0065283 3300049572 Bacteria 3081
194 Ga0501036_0083859 3300049572 Bacteria 2694
195 Ga0501036_0225231 3300049572 Bacteria 1574
196 Ga0501036_0534351 3300049572 Bacteria 975
197 Ga0501036_0943574 3300049572 Bacteria 707
198 Ga0501037_0196115 3300049573 Bacteria 1428
199 Ga0501038_0027061 3300049574 Bacteria 5105
200 Ga0501038_0486358 3300049574 Bacteria 945
201 Ga0501039_0009537 3300049575 Bacteria 7399
202 Ga0501039_0041041 3300049575 Bacteria 3572
203 Ga0501039_0129165 3300049575 Bacteria 1983
204 Ga0501039_0401181 3300049575 Bacteria 1077
205 Ga0501039_0507542 3300049575 Bacteria 947
206 Ga0501040_0006078 3300049576 Bacteria 7826
207 Ga0501040_0089629 3300049576 Bacteria 2137
208 Ga0501040_0352098 3300049576 Bacteria 1055
209 Ga0501041_0051771 3300049577 Bacteria 2502
210 Ga0501041_0531731 3300049577 Bacteria 749
211 Ga0501042_0009797 3300049578 Bacteria 6401
212 Ga0501042_0081715 3300049578 Bacteria 2316
213 Ga0501042_0223475 3300049578 Bacteria 1358
214 Ga0501042_0234371 3300049578 Bacteria 1324
215 Ga0501042_0271837 3300049578 Bacteria 1224
216 Ga0501042_0798869 3300049578 Bacteria 687
217 Ga0501043_0081795 3300049579 Bacteria 2538
218 Ga0501043_0855492 3300049579 Bacteria 655
219 Ga0501046_0015973 3300049580 Bacteria 6297
220 Ga0501048_0032209 3300049582 Bacteria 3789
221 Ga0501048_0257885 3300049582 Bacteria 1239
222 Ga0501048_0331962 3300049582 Bacteria 1084
223 Ga0501048_0582366 3300049582 Unclassified 803
224 Ga0501067_0068637 3300049583 Bacteria 1963
225 Ga0501067_0131001 3300049583 Bacteria 1396
226 Ga0501068_0015955 3300049584 Bacteria 4326
227 Ga0501068_0051661 3300049584 Bacteria 2487
228 Ga0501068_0069246 3300049584 Bacteria 2151
229 Ga0501069_0049484 3300049585 Bacteria 2336
230 Ga0501069_0072790 3300049585 Bacteria 1927
231 Ga0501069_0221851 3300049585 Bacteria 1099
232 Ga0501070_0540740 3300049586 Bacteria 933
233 Ga0501071_0025442 3300049587 Bacteria 4146
234 Ga0501071_0086630 3300049587 Bacteria 2298
235 Ga0501071_0109417 3300049587 Bacteria 2041
236 Ga0501072_0005730 3300049588 Bacteria 9460
237 Ga0501073_0061852 3300049589 Bacteria 2612
238 Ga0501074_0091436 3300049590 Bacteria 2179
239 Ga0501074_0350696 3300049590 Bacteria 1047
240 Ga0501074_0435453 3300049590 Bacteria 930
241 Ga0501075_0037522 3300049591 Bacteria 3620
242 Ga0501075_0123046 3300049591 Bacteria 1975
243 Ga0501075_0234282 3300049591 Bacteria 1400
244 Ga0501075_0329129 3300049591 Bacteria 1164
245 Ga0501076_0052242 3300049592 Bacteria 3237
246 Ga0501076_0078864 3300049592 Bacteria 2643
247 Ga0501076_0795535 3300049592 Bacteria 780
248 Ga0501077_0303379 3300049593 Bacteria 1017
249 Ga0501077_0359424 3300049593 Bacteria 930
250 Ga0501079_0028908 3300049741 Bacteria 4254
251 Ga0501080_0168659 3300049742 Bacteria 2020
252 Ga0501080_0259679 3300049742 Bacteria 1583
253 Ga0501080_0861839 3300049742 Bacteria 791
254 Ga0501080_1144499 3300049742 Bacteria 671
255 Ga0501081_0053651 3300049743 Bacteria 2783
256 Ga0501081_0060969 3300049743 Bacteria 2615
257 Ga0501081_0245498 3300049743 Bacteria 1306
258 Ga0501081_0411548 3300049743 Bacteria 1002
259 Ga0501083_0069080 3300049744 Bacteria 2351
260 Ga0501035_0041780 3300049822 Bacteria 4139
261 Ga0501045_0053893 3300049824 Bacteria 2939
262 Ga0501045_0116620 3300049824 Bacteria 1982
263 Ga0501045_0550486 3300049824 Bacteria 856
264 Ga0501045_0917191 3300049824 Bacteria 643
265 nmdc:mga03683_121738_c1 3300050489 Bacteria 1160
266 nmdc:mga03n38_113589_c1 3300050490 Bacteria 1322
267 nmdc:mga03n38_175185_c1 3300050490 Bacteria 1095
268 nmdc:mga03n38_221077_c1 3300050490 Bacteria 989
269 nmdc:mga03n38_258910_c1 3300050490 Bacteria 921
270 nmdc:mga03n38_32027_c1 3300050490 Bacteria 2224
271 nmdc:mga00v17_33120_c1 3300050491 Bacteria 3060
272 nmdc:mga00v17_660991_c1 3300050491 Bacteria 672
273 nmdc:mga00v17_88379_c1 3300050491 Bacteria 1943
274 nmdc:mga00v17_9471_c1 3300050491 Bacteria 5273
275 nmdc:mga0yw44_174901_c1 3300050492 Bacteria 1411
276 nmdc:mga0yw44_35210_c1 3300050492 Bacteria 2940
277 nmdc:mga0yw44_42529_c1 3300050492 Bacteria 2709
278 nmdc:mga0yw44_646844_c1 3300050492 Bacteria 718
279 nmdc:mga0yw44_79532_c1 3300050492 Bacteria 2051
280 nmdc:mga06z11_25660_c1 3300050494 Bacteria 2795
281 nmdc:mga04h51_6733_c1 3300050495 Bacteria 2997
282 nmdc:mga04h51_9704_c1 3300050495 Bacteria 2619
283 nmdc:mga07m45_114814_c1 3300050496 Bacteria 1553
284 nmdc:mga07m45_339689_c1 3300050496 Bacteria 873
285 nmdc:mga05p37_4732_c1 3300050507 Bacteria 15901
286 nmdc:mga09592_147537_c1 3300050508 Bacteria 2029
287 nmdc:mga0qj67_2268_c1 3300050509 Bacteria 13669
288 nmdc:mga06r32_30004_c1 3300050510 Bacteria 5101
289 nmdc:mga08y16_263283_c1 3300050511 Bacteria 1780
290 Ga0500644_0000981 3300053088 Bacteria 8889
291 Ga0500556_0001934 3300053104 Bacteria 7343
292 Ga0500593_008260 3300053117 Bacteria 4270
293 Ga0501084_0004926 3300054114 Bacteria 10910
294 Ga0501084_0340378 3300054114 Bacteria 1267
295 Ga0590071_069364 3300059421 Bacteria 868
296 Ga0501082_0104911 3300060353 Bacteria 2445
297 Ga0501082_0544209 3300060353 Bacteria 1015
298 Ga0501082_0757325 3300060353 Bacteria 850
299 Ga0530510_0013622 3300061734 Bacteria 5720
300 Ga0530510_0079446 3300061734 Bacteria 2386
301 Ga0530510_0409848 3300061734 Bacteria 1022
302 2643825458 2643221561 Bacteria 4984412
303 2644089710 2643221615 Bacteria 5487866
304 2644229020 2643221641 Bacteria 4490190
305 2644319555 2643221657 Bacteria 5490246
306 2644531454 2643221696 Bacteria 5431823
307 2740166886 2739367898 Bacteria 4367674
308 2816425337 2816332119 Bacteria 8120218
309 2855387705 2855386786 Bacteria 4752232
310 Ga0501031_0080203
311 LJQas_1005131
312 rootH1_10105145
313 Ga0070658_10335925
314 Ga0070683_100088511
315 Ga0070683_100865769
316 Ga0070670_100583926
317 Ga0070677_10195308
318 Ga0070680_100070536
319 Ga0070680_101176071
320 Ga0070682_100947090
321 Ga0068868_100328389
322 Ga0068868_100822092
323 Ga0070660_100225453
324 Ga0070687_100072110
325 Ga0070675_100525774
326 Ga0070671_100282359
327 Ga0070674_100898807
328 Ga0070688_100618050
329 Ga0070659_101200272
330 Ga0070667_100189420
331 Ga0070667_101184397
332 Ga0070714_100159991
333 Ga0070700_100139872
334 Ga0070662_100647632
335 Ga0070681_10502506
336 Ga0068867_100669938
337 Ga0070684_100262503
338 Ga0070672_100205582
339 Ga0068854_100611153
340 Ga0068856_100050954
341 Ga0070702_100133823
342 Ga0068852_100225752
343 Ga0068870_10489433
344 Ga0081455_10183143
345 Ga0081539_10068154
346 Ga0075365_10027151
347 Ga0075365_10048610
348 Ga0075365_10058745
349 Ga0075365_10443288
350 Ga0075365_10655503
351 Ga0075368_10109289
352 Ga0075363_100056459
353 Ga0075363_100061799
354 Ga0075363_100111353
355 Ga0075363_100179664
356 Ga0075364_10007132
357 Ga0075364_10021783
358 Ga0075364_10047790
359 Ga0075364_10079982
360 Ga0075364_10338938
361 Ga0075362_10004426
362 Ga0075362_10054191
363 Ga0075367_10040612
364 Ga0075367_10134524
365 Ga0075370_10006064
366 Ga0075370_10090173
367 Ga0075428_100001062
368 Ga0075430_100002892
369 Ga0075431_100027745
370 Ga0075429_100001461
371 Ga0111539_10572624
372 Ga0111539_10613529
373 Ga0105245_10423838
374 Ga0114129_10006100
375 Ga0105243_10018194
376 Ga0105238_11122751
377 Ga0105249_10592300
378 Ga0105246_10466485
379 Ga0157371_10388005
380 Ga0157369_10276691
381 Ga0157369_10769450
382 Ga0157372_10203893
383 Ga0157372_10347870
384 Ga0157372_10800420
385 Ga0157375_10138395
386 Ga0157375_10168134
387 Ga0157380_10294684
388 Ga0163161_10444052
389 Ga0206353_10086135
390 Ga0206353_10465933
391 Ga0207647_10021088
392 Ga0207643_10355677
393 Ga0207707_11058543
394 Ga0207662_10135694
395 Ga0207657_10272610
396 Ga0207694_10353548
397 Ga0207687_10162458
398 Ga0207664_10078409
399 Ga0207709_10178077
400 Ga0207691_10182808
401 Ga0207661_10122234
402 Ga0207658_11212806
403 Ga0207677_10492568
404 Ga0207708_10117987
405 Ga0207708_10800375
406 Ga0207702_10229964
407 Ga0207702_10695536
408 Ga0207648_10564064
409 Ga0207674_10109040
410 Ga0207675_100105691
411 Ga0207675_100123181
412 Ga0207675_101804567
413 Ga0209813_10045130
414 Ga0268265_11266665
415 Ga0307513_10414827
416 Ga0307408_100361497
417 Ga0307405_10124700
418 Ga0307413_10016942
419 Ga0307413_10283724
420 Ga0307413_10370760
421 Ga0307413_10672239
422 Ga0307410_10338922
423 Ga0307410_10381395
424 Ga0307410_10648070
425 Ga0307406_10374849
426 Ga0307407_10047888
427 Ga0307407_10068502
428 Ga0307407_10458092
429 Ga0307407_10644436
430 Ga0307412_10343684
431 Ga0307409_100040103
432 Ga0307409_100075438
433 Ga0307409_100204296
434 Ga0307409_100681707
435 Ga0307416_100210705
436 Ga0307416_100246376
437 Ga0307416_101113338
438 Ga0307414_10194320
439 Ga0307414_10854413
440 Ga0307411_10068950
441 Ga0307411_10609436
442 Ga0307415_100252923
443 Ga0307415_100302540
444 Ga0307415_100441144
445 Ga0395901_0068859
446 Ga0395901_0079697
447 Ga0439436_0071934
448 Ga0439438_012542
449 Ga0439447_048418
450 Ga0439461_0015980
451 Ga0439431_0023198
452 Ga0439445_0118821
453 Ga0439446_0003731
454 Ga0439434_0029454
455 Ga0466972_0086669
456 Ga0466965_0198663
457 Ga0466966_0044839
458 Ga0466961_0744845
459 Ga0466963_0130188
460 Ga0466970_0047388
461 Ga0466970_0248752
462 Ga0466960_0000585
463 Ga0466960_0001472
464 Ga0466960_0006362
465 Ga0466960_0024769
466 Ga0466960_0120837
467 Ga0466967_0020988
468 Ga0466967_0157617
469 Ga0466967_0163913
470 Ga0466967_0295798
471 Ga0495664_0113239
472 Ga0495620_0178084
473 Ga0495633_0234884
474 Ga0496100_0102344
475 Ga0496102_0098023
476 Ga0496102_0488761
477 Ga0496103_0015924
478 Ga0496104_0423221
479 Ga0496106_0056792
480 Ga0496107_0534029
481 Ga0496108_0078463
482 Ga0496109_0277958
483 Ga0496109_0516143
484 Ga0496110_0030446
485 Ga0496110_0246247
486 Ga0496110_0344349
487 Ga0496110_0453575
488 Ga0496110_0536590
489 Ga0496111_0545457
490 Ga0496113_0061643
491 Ga0496113_0540793
492 Ga0496114_0163631
493 Ga0501031_0003326
494 Ga0501031_0029455
495 Ga0501031_0048192
496 Ga0501032_0032496
497 Ga0501032_0072075
498 Ga0501032_0613430
499 Ga0501033_0647265
500 Ga0501034_0570964
501 Ga0501034_0772278
502 Ga0501036_0065283
503 Ga0501036_0083859
504 Ga0501036_0225231
505 Ga0501036_0534351
506 Ga0501036_0943574
507 Ga0501037_0196115
508 Ga0501038_0027061
509 Ga0501038_0486358
510 Ga0501039_0009537
511 Ga0501039_0041041
512 Ga0501039_0129165
513 Ga0501039_0401181
514 Ga0501039_0507542
515 Ga0501040_0006078
516 Ga0501040_0089629
517 Ga0501040_0352098
518 Ga0501041_0051771
519 Ga0501041_0531731
520 Ga0501042_0009797
521 Ga0501042_0081715
522 Ga0501042_0223475
523 Ga0501042_0234371
524 Ga0501042_0271837
525 Ga0501042_0798869
526 Ga0501043_0081795
527 Ga0501043_0855492
528 Ga0501046_0015973
529 Ga0501048_0032209
530 Ga0501048_0257885
531 Ga0501048_0331962
532 Ga0501048_0582366
533 Ga0501067_0068637
534 Ga0501067_0131001
535 Ga0501068_0015955
536 Ga0501068_0051661
537 Ga0501068_0069246
538 Ga0501069_0049484
539 Ga0501069_0072790
540 Ga0501069_0221851
541 Ga0501070_0540740
542 Ga0501071_0025442
543 Ga0501071_0086630
544 Ga0501071_0109417
545 Ga0501072_0005730
546 Ga0501073_0061852
547 Ga0501074_0091436
548 Ga0501074_0350696
549 Ga0501074_0435453
550 Ga0501075_0037522
551 Ga0501075_0123046
552 Ga0501075_0234282
553 Ga0501075_0329129
554 Ga0501076_0052242
555 Ga0501076_0078864
556 Ga0501076_0795535
557 Ga0501077_0303379
558 Ga0501077_0359424
559 Ga0501079_0028908
560 Ga0501080_0168659
561 Ga0501080_0259679
562 Ga0501080_0861839
563 Ga0501080_1144499
564 Ga0501081_0053651
565 Ga0501081_0060969
566 Ga0501081_0245498
567 Ga0501081_0411548
568 Ga0501083_0069080
569 Ga0501035_0041780
570 Ga0501045_0053893
571 Ga0501045_0116620
572 Ga0501045_0550486
573 Ga0501045_0917191
574 nmdc:mga03683_121738_c1
575 nmdc:mga03n38_113589_c1
576 nmdc:mga03n38_175185_c1
577 nmdc:mga03n38_221077_c1
578 nmdc:mga03n38_258910_c1
579 nmdc:mga03n38_32027_c1
580 nmdc:mga00v17_33120_c1
581 nmdc:mga00v17_660991_c1
582 nmdc:mga00v17_88379_c1
583 nmdc:mga00v17_9471_c1
584 nmdc:mga0yw44_174901_c1
585 nmdc:mga0yw44_35210_c1
586 nmdc:mga0yw44_42529_c1
587 nmdc:mga0yw44_646844_c1
588 nmdc:mga0yw44_79532_c1
589 nmdc:mga06z11_25660_c1
590 nmdc:mga04h51_6733_c1
591 nmdc:mga04h51_9704_c1
592 nmdc:mga07m45_114814_c1
593 nmdc:mga07m45_339689_c1
594 nmdc:mga05p37_4732_c1
595 nmdc:mga09592_147537_c1
596 nmdc:mga0qj67_2268_c1
597 nmdc:mga06r32_30004_c1
598 nmdc:mga08y16_263283_c1
599 Ga0500644_0000981
600 Ga0500556_0001934
601 Ga0500593_008260
602 Ga0501084_0004926
603 Ga0501084_0340378
604 Ga0590071_069364
605 Ga0501082_0104911
606 Ga0501082_0544209
607 Ga0501082_0757325
608 Ga0530510_0013622
609 Ga0530510_0079446
610 Ga0530510_0409848
611 2643825458
612 2644089710
613 2644229020
614 2644319555
615 2644531454
616 2740166886
617 2816425337
618 2855387705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

49

182

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wk4-assembly1.cif.gz_A crystal structure of ttk003001606 0.8888 9 179
8a9o-assembly1.cif.gz_A structure of the polyamine acetyltransferase dpa 0.8706 8 157
8a9n-assembly1.cif.gz_B structure of dpa polyamine acetyltransferase in complex with 1,3-dap 0.8628 8 162
8a9o-assembly1.cif.gz_B structure of the polyamine acetyltransferase dpa 0.8583 8 162
3fnc-assembly1.cif.gz_B crystal structure of a putative acetyltransferase from listeria innocua 0.8535 5 180
ID Description Score Start End Superfamily
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9007 55 157 3.40.630.30
2cy2A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8951 9 179 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8858 55 157 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.883 17 180 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8801 74 157 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1H9UUG1-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9536 11 179 GO:0016747
AF-A0A6L5ZMM3-F1-model_v4 GNAT family N-acetyltransferase 0.9492 8 179 GO:0016747
AF-A0A1H4D667-F1-model_v4 L-amino acid N-acyltransferase YncA 0.9443 13 180 GO:0016747
AF-A0A7T9DZD5-F1-model_v4 deleted 0.943 1 181
AF-R6CJH5-F1-model_v4 deleted 0.9393 5 180

Map