F400382

General Info

Members Datasets Scaffolds Average Seq Length
309 187 618 369

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0036246|Ga0496110_0036246_1144_2400
Length 418
Sequence VAGVDIATTVVVIAVPFGAATLVDHRVSSARPAAVRPRLRLVECRGFAMKTNAAILWEVNAPWSVEEIELDPPKEGEVLVKLAASGLCHSDEHLVTGDLPFALPIIGGHEGSGVVQEVGEGVSWLKPGDHVVFGFIPSCGRCPSCSTGHQNLCDLGAALGLGMQITDGTARHHAKGQDLGLMCLLGTFGHHTVVNEASCIKIDDDIPLDRACLLGCGVVTGWGSSVYAAEVGPGDNVVVVGVGGIGANAIQGAKLAGAKRIFAIDPLENKREKAMEFGATHTSASMEEALPLVQEVTWGTMANKVIMTMGVGSGELMASALALASKRGRVVVTNLHPGLEMSATMSLLDMTLMEKQVVGSLFGSGNPRADIPKLLGLYREGQLDLDGLVTKTYTLDTVNDGYDDMRAGKNIRGVMVYE

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
179 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
180 2619618881 Frankia sp. ACN1ag Isolate Unclassified
181 2619619003 Frankia sp. CpI1-P Isolate Nodule
182 2626541554 Frankia sp. AvcI.1 Isolate Nodule
183 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
184 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
185 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
186 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
187 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.47
Metatranscriptomes 1.62
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.06
Nodule 1.29
Rhizoplane 8.41
Rhizosphere 75.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0036246 3300048913 Bacteria 4283
2 Ga0070683_100059936 3300005329 Bacteria 3536
3 Ga0070683_100208724 3300005329 Bacteria 1855
4 Ga0070680_100053608 3300005336 Bacteria 3293
5 Ga0070689_100089924 3300005340 Bacteria 2419
6 Ga0070687_100013484 3300005343 Bacteria 3645
7 Ga0070659_100030458 3300005366 Bacteria 4176
8 Ga0070709_10073528 3300005434 Bacteria 2213
9 Ga0070714_100093014 3300005435 Bacteria 2644
10 Ga0070714_100162549 3300005435 Bacteria 2021
11 Ga0070713_100081441 3300005436 Bacteria 2762
12 Ga0070713_100142231 3300005436 Bacteria 2126
13 Ga0070713_100163154 3300005436 Bacteria 1991
14 Ga0070713_100253953 3300005436 Bacteria 1604
15 Ga0070711_100060239 3300005439 Bacteria 2638
16 Ga0070678_100163834 3300005456 Bacteria 1804
17 Ga0070681_10011602 3300005458 Bacteria 8723
18 Ga0070684_100015172 3300005535 Bacteria 6266
19 Ga0070686_100011387 3300005544 Bacteria 5044
20 Ga0070665_100063949 3300005548 Bacteria 3689
21 Ga0068855_100116280 3300005563 Bacteria 3065
22 Ga0068855_100563610 3300005563 Bacteria 1232
23 Ga0068856_100011126 3300005614 Bacteria 8735
24 Ga0068856_100122638 3300005614 Bacteria 2601
25 Ga0070702_100141713 3300005615 Bacteria 1532
26 Ga0068866_10009765 3300005718 Bacteria 4088
27 Ga0068861_100101507 3300005719 Bacteria 2289
28 Ga0068863_100009095 3300005841 Bacteria 9699
29 Ga0068863_100073980 3300005841 Bacteria 3223
30 Ga0068863_100170671 3300005841 Bacteria 2086
31 Ga0068858_100000087 3300005842 Bacteria 95622
32 Ga0068860_100002503 3300005843 Bacteria 19281
33 Ga0068862_100202603 3300005844 Bacteria 1790
34 Ga0070717_10013535 3300006028 Bacteria 6256
35 Ga0070717_10066140 3300006028 Bacteria 3006
36 Ga0075365_10000647 3300006038 Bacteria 13832
37 Ga0075365_10006945 3300006038 Bacteria 6289
38 Ga0075365_10014214 3300006038 Bacteria 4784
39 Ga0075365_10049736 3300006038 Bacteria 2762
40 Ga0075363_100029829 3300006048 Bacteria 2818
41 Ga0075363_100039841 3300006048 Bacteria 2475
42 Ga0075363_100086270 3300006048 Bacteria 1723
43 Ga0075364_10001464 3300006051 Bacteria 12836
44 Ga0075364_10001579 3300006051 Bacteria 12467
45 Ga0075364_10035569 3300006051 Bacteria 3219
46 Ga0075362_10032610 3300006177 Bacteria 2261
47 Ga0075367_10058189 3300006178 Bacteria 2300
48 Ga0075430_100206603 3300006846 Bacteria 1630
49 Ga0068865_100009853 3300006881 Bacteria 5937
50 Ga0099795_10009892 3300007788 Bacteria 2785
51 Ga0111539_10244493 3300009094 Bacteria 2089
52 Ga0105245_10439041 3300009098 Bacteria 1312
53 Ga0105247_10001266 3300009101 Bacteria 18721
54 Ga0105247_10007288 3300009101 Bacteria 6797
55 Ga0105243_10010153 3300009148 Bacteria 7158
56 Ga0105243_10055091 3300009148 Bacteria 3159
57 Ga0105243_10097175 3300009148 Bacteria 2437
58 Ga0105242_10012117 3300009176 Bacteria 6633
59 Ga0105248_10277874 3300009177 Bacteria 1885
60 Ga0105237_10002970 3300009545 Bacteria 20510
61 Ga0105238_10086105 3300009551 Bacteria 3129
62 Ga0105249_10014341 3300009553 Bacteria 7008
63 Ga0105249_10066713 3300009553 Bacteria 3314
64 Ga0157370_10105834 3300013104 Bacteria 2633
65 Ga0157370_10127924 3300013104 Bacteria 2371
66 Ga0157369_10190372 3300013105 Bacteria 2156
67 Ga0157374_10099732 3300013296 Bacteria 2782
68 Ga0157378_10013748 3300013297 Bacteria 7079
69 Ga0157372_10304332 3300013307 Bacteria 1854
70 Ga0157375_10041671 3300013308 Bacteria 4436
71 Ga0157375_10048698 3300013308 Bacteria 4147
72 Ga0163163_10176598 3300014325 Bacteria 2182
73 Ga0157380_10382762 3300014326 Bacteria 1328
74 Ga0157379_10000018 3300014968 Bacteria 95259
75 Ga0157379_10002368 3300014968 Bacteria 15753
76 Ga0157379_10038797 3300014968 Bacteria 4249
77 Ga0163161_10022336 3300017792 Bacteria 4455
78 Ga0197907_10255104 3300020069 Bacteria 1854
79 Ga0206350_10231700 3300020080 Bacteria 1212
80 Ga0206350_11283589 3300020080 Bacteria 1285
81 Ga0206353_11556449 3300020082 Bacteria 1603
82 Ga0213876_10002825 3300021384 Bacteria 10102
83 Ga0224712_10026521 3300022467 Bacteria 2049
84 Ga0207653_10025298 3300025885 Bacteria 1898
85 Ga0207642_10049061 3300025899 Bacteria 1896
86 Ga0207710_10012346 3300025900 Bacteria 3594
87 Ga0207699_10027418 3300025906 Bacteria 3153
88 Ga0207705_10034402 3300025909 Bacteria 3623
89 Ga0207707_10006044 3300025912 Bacteria 10589
90 Ga0207671_10008470 3300025914 Bacteria 8718
91 Ga0207693_10066042 3300025915 Bacteria 2833
92 Ga0207660_10058331 3300025917 Bacteria 2768
93 Ga0207662_10010882 3300025918 Bacteria 5029
94 Ga0207657_10066508 3300025919 Bacteria 3068
95 Ga0207657_10106565 3300025919 Bacteria 2319
96 Ga0207694_10080951 3300025924 Bacteria 2550
97 Ga0207659_10141809 3300025926 Bacteria 1866
98 Ga0207700_10001648 3300025928 Bacteria 12690
99 Ga0207664_10065590 3300025929 Bacteria 2907
100 Ga0207664_10141104 3300025929 Bacteria 2038
101 Ga0207644_10029967 3300025931 Bacteria 3778
102 Ga0207644_10178993 3300025931 Bacteria 1661
103 Ga0207690_10043111 3300025932 Bacteria 2968
104 Ga0207706_10114747 3300025933 Bacteria 2369
105 Ga0207709_10004135 3300025935 Bacteria 8447
106 Ga0207704_10014131 3300025938 Bacteria 4023
107 Ga0207691_10262193 3300025940 Bacteria 1490
108 Ga0207689_10026260 3300025942 Bacteria 4877
109 Ga0207661_10090934 3300025944 Bacteria 2542
110 Ga0207667_10162897 3300025949 Bacteria 2293
111 Ga0207712_10236517 3300025961 Bacteria 1469
112 Ga0207668_10031015 3300025972 Bacteria 3517
113 Ga0207640_10128131 3300025981 Bacteria 1830
114 Ga0207703_10000005 3300026035 Bacteria 506356
115 Ga0207703_10110920 3300026035 Bacteria 2341
116 Ga0207703_10112385 3300026035 Bacteria 2327
117 Ga0207678_10037790 3300026067 Bacteria 4198
118 Ga0207702_10028443 3300026078 Bacteria 4646
119 Ga0207702_10168605 3300026078 Bacteria 2005
120 Ga0207641_10065845 3300026088 Bacteria 3100
121 Ga0207641_10070432 3300026088 Bacteria 3005
122 Ga0207676_10020205 3300026095 Bacteria 4869
123 Ga0207674_10110480 3300026116 Bacteria 2724
124 Ga0207674_10166368 3300026116 Bacteria 2159
125 Ga0207675_100013998 3300026118 Bacteria 7479
126 Ga0207675_100082420 3300026118 Bacteria 3017
127 Ga0268266_10123741 3300028379 Bacteria 2305
128 Ga0268264_10030034 3300028381 Bacteria 4456
129 Ga0268264_10076203 3300028381 Bacteria 2853
130 Ga0307515_10225765 3300028794 Bacteria 1678
131 Ga0265327_10005659 3300031251 Bacteria 10345
132 Ga0265327_10007203 3300031251 Bacteria 8643
133 Ga0265327_10014672 3300031251 Bacteria 5113
134 Ga0316579_10033457 3300031691 Bacteria 2361
135 Ga0316579_10035765 3300031691 Bacteria 2290
136 Ga0316576_10011983 3300031727 Bacteria 5707
137 Ga0316576_10030466 3300031727 Bacteria 3821
138 Ga0316576_10039852 3300031727 Bacteria 3374
139 Ga0316576_10225163 3300031727 Bacteria 1410
140 Ga0316578_10023183 3300031728 Bacteria 3472
141 Ga0316578_10028255 3300031728 Bacteria 3175
142 Ga0316577_10096276 3300031733 Bacteria 1658
143 Ga0307409_100138974 3300031995 Bacteria 2089
144 Ga0373932_0024020 3300035112 Bacteria 1637
145 Ga0316574_0027128 3300035398 Bacteria 3449
146 Ga0316574_0028828 3300035398 Bacteria 3350
147 Ga0373927_0001956 3300035695 Bacteria 15223
148 Ga0316582_0107690 3300036647 Bacteria 1852
149 Ga0316582_0219539 3300036647 Bacteria 1300
150 Ga0316584_0053772 3300036712 Bacteria 3013
151 Ga0316584_0391509 3300036712 Bacteria 991
152 Ga0373925_0000013 3300037068 Bacteria 188673
153 Ga0373925_0000164 3300037068 Bacteria 71540
154 Ga0395898_0097577 3300037466 Bacteria 2822
155 Ga0400483_069265 3300039062 Bacteria 3164
156 Ga0400483_090997 3300039062 Bacteria 47687
157 Ga0400483_206454 3300039062 Bacteria 2560
158 Ga0400483_279754 3300039062 Bacteria 139594
159 Ga0400483_287777 3300039062 Bacteria 1701
160 Ga0436365_0942585 3300039437 Bacteria 49962
161 Ga0451853_1818577 3300041512 Bacteria 1616
162 Ga0451577_0002372 3300042876 Bacteria 22597
163 Ga0466961_0069282 3300044693 Bacteria 2240
164 Ga0466963_0095429 3300044694 Bacteria 2030
165 Ga0466963_0158735 3300044694 Bacteria 1573
166 Ga0466963_0167495 3300044694 Bacteria 1531
167 Ga0466963_0171237 3300044694 Bacteria 1514
168 Ga0466963_0193083 3300044694 Bacteria 1423
169 Ga0466963_0240527 3300044694 Bacteria 1269
170 Ga0453684_0011654 3300044712 Bacteria 14674
171 Ga0466971_0013470 3300044719 Bacteria 3593
172 Ga0466957_0009521 3300044842 Bacteria 5548
173 Ga0466960_0011330 3300044901 Bacteria 3727
174 Ga0466959_0141347 3300045049 Bacteria 1701
175 Ga0466958_0006636 3300045836 Bacteria 6312
176 Ga0466958_0019067 3300045836 Bacteria 3990
177 Ga0466958_0221675 3300045836 Bacteria 1206
178 Ga0466967_0014352 3300045976 Bacteria 6168
179 Ga0466967_0068890 3300045976 Bacteria 3161
180 Ga0466967_0167005 3300045976 Bacteria 2068
181 Ga0466967_0322100 3300045976 Bacteria 1491
182 Ga0495641_0043047 3300046461 Bacteria 2089
183 Ga0495657_0121369 3300046675 Bacteria 1645
184 Ga0495670_0073588 3300046691 Bacteria 1732
185 Ga0495676_0062950 3300047321 Bacteria 2894
186 Ga0496102_0120609 3300048905 Bacteria 2449
187 Ga0496102_0327008 3300048905 Bacteria 1444
188 Ga0496104_0032517 3300048907 Bacteria 4855
189 Ga0496104_0033213 3300048907 Bacteria 4805
190 Ga0496105_0023787 3300048908 Bacteria 4974
191 Ga0496105_0042227 3300048908 Bacteria 3759
192 Ga0496107_0005926 3300048910 Bacteria 8377
193 Ga0496108_0184869 3300048911 Bacteria 1805
194 Ga0496109_0013522 3300048912 Bacteria 7084
195 Ga0496109_0106247 3300048912 Bacteria 2607
196 Ga0496109_0369688 3300048912 Bacteria 1355
197 Ga0496110_0005123 3300048913 Bacteria 10242
198 Ga0496110_0102134 3300048913 Bacteria 2571
199 Ga0496110_0114559 3300048913 Bacteria 2426
200 Ga0496110_0117871 3300048913 Bacteria 2391
201 Ga0496110_0170211 3300048913 Bacteria 1976
202 Ga0496111_0008879 3300048914 Bacteria 6681
203 Ga0496111_0036687 3300048914 Bacteria 3506
204 Ga0496112_0062775 3300048915 Bacteria 3665
205 Ga0496112_0132293 3300048915 Bacteria 2465
206 Ga0496113_0003142 3300048916 Bacteria 9828
207 Ga0496113_0178162 3300048916 Bacteria 1685
208 Ga0496114_0014097 3300048917 Bacteria 6409
209 Ga0496114_0194115 3300048917 Bacteria 1777
210 Ga0496115_0200477 3300048918 Bacteria 1649
211 Ga0496119_0011508 3300048922 Bacteria 7314
212 Ga0496120_0062116 3300048923 Bacteria 2082
213 Ga0496126_0000036 3300048929 Bacteria 354901
214 Ga0496126_0000529 3300048929 Bacteria 73936
215 Ga0496126_0198222 3300048929 Bacteria 1697
216 Ga0501031_0146326 3300049568 Bacteria 1544
217 Ga0501032_0018837 3300049569 Bacteria 4830
218 Ga0501032_0200616 3300049569 Bacteria 1302
219 Ga0501034_0004509 3300049571 Bacteria 15482
220 Ga0501034_0058213 3300049571 Bacteria 3884
221 Ga0501034_0072738 3300049571 Bacteria 3447
222 Ga0501034_0075142 3300049571 Bacteria 3387
223 Ga0501034_0121100 3300049571 Bacteria 2603
224 Ga0501034_0130158 3300049571 Bacteria 2500
225 Ga0501036_0065986 3300049572 Bacteria 3062
226 Ga0501036_0072335 3300049572 Bacteria 2915
227 Ga0501036_0231986 3300049572 Bacteria 1549
228 Ga0501036_0359743 3300049572 Bacteria 1215
229 Ga0501037_0054484 3300049573 Bacteria 2925
230 Ga0501039_0122101 3300049575 Bacteria 2042
231 Ga0501039_0306529 3300049575 Bacteria 1248
232 Ga0501040_0026986 3300049576 Bacteria 3864
233 Ga0501040_0053947 3300049576 Bacteria 2755
234 Ga0501041_0129742 3300049577 Bacteria 1570
235 Ga0501041_0169619 3300049577 Bacteria 1365
236 Ga0501042_0112743 3300049578 Bacteria 1958
237 Ga0501042_0149765 3300049578 Bacteria 1682
238 Ga0501043_0117867 3300049579 Bacteria 2083
239 Ga0501048_0007115 3300049582 Bacteria 8503
240 Ga0501069_0000079 3300049585 Bacteria 47599
241 Ga0501069_0004940 3300049585 Bacteria 6917
242 Ga0501070_0000092 3300049586 Bacteria 76642
243 Ga0501070_0007291 3300049586 Bacteria 9390
244 Ga0501070_0017434 3300049586 Bacteria 6028
245 Ga0501070_0028858 3300049586 Bacteria 4652
246 Ga0501070_0141371 3300049586 Bacteria 1987
247 Ga0501070_0223075 3300049586 Bacteria 1545
248 Ga0501071_0007702 3300049587 Bacteria 7097
249 Ga0501071_0028118 3300049587 Bacteria 3960
250 Ga0501071_0063131 3300049587 Bacteria 2685
251 Ga0501072_0034595 3300049588 Bacteria 3960
252 Ga0501072_0037588 3300049588 Bacteria 3797
253 Ga0501072_0104699 3300049588 Bacteria 2250
254 Ga0501074_0000989 3300049590 Bacteria 18460
255 Ga0501075_0008062 3300049591 Bacteria 7324
256 Ga0501075_0062214 3300049591 Bacteria 2813
257 Ga0501075_0133244 3300049591 Bacteria 1893
258 Ga0501075_0161834 3300049591 Bacteria 1707
259 Ga0501076_0023796 3300049592 Bacteria 4726
260 Ga0501076_0032990 3300049592 Bacteria 4043
261 Ga0501076_0114118 3300049592 Bacteria 2186
262 Ga0501076_0254474 3300049592 Bacteria 1437
263 Ga0501079_0000017 3300049741 Bacteria 65652
264 Ga0501079_0040306 3300049741 Bacteria 3602
265 Ga0501079_0169989 3300049741 Bacteria 1700
266 Ga0501080_0000419 3300049742 Bacteria 32644
267 Ga0501080_0005386 3300049742 Bacteria 11408
268 Ga0501080_0012840 3300049742 Bacteria 7683
269 Ga0501080_0105670 3300049742 Bacteria 2610
270 Ga0501081_0075164 3300049743 Bacteria 2358
271 Ga0501081_0118549 3300049743 Bacteria 1883
272 Ga0501083_0011790 3300049744 Bacteria 6125
273 Ga0501035_0086269 3300049822 Bacteria 2766
274 Ga0501044_0002564 3300049823 Bacteria 20686
275 Ga0501044_0063430 3300049823 Bacteria 3775
276 Ga0501045_0052966 3300049824 Bacteria 2964
277 nmdc:mga03683_32413_c1 3300050489 Bacteria 2102
278 nmdc:mga03n38_43520_c1 3300050490 Bacteria 1968
279 nmdc:mga00v17_133736_c1 3300050491 Bacteria 1586
280 nmdc:mga00v17_2207_c1 3300050491 Bacteria 10012
281 nmdc:mga00v17_27902_c1 3300050491 Bacteria 3300
282 nmdc:mga00v17_28403_c1 3300050491 Bacteria 3276
283 nmdc:mga00v17_31104_c1 3300050491 Bacteria 3146
284 nmdc:mga00v17_8119_c1 3300050491 Bacteria 5635
285 nmdc:mga0yw44_2354_c1 3300050492 Bacteria 8016
286 nmdc:mga0yw44_7618_c1 3300050492 Bacteria 5337
287 nmdc:mga0yw44_77174_c1 3300050492 Bacteria 2081
288 nmdc:mga06z11_117617_c1 3300050494 Bacteria 1479
289 nmdc:mga07m45_58890_c2 3300050496 Bacteria 1778
290 nmdc:mga08y16_142938_c1 3300050511 Bacteria 2487
291 nmdc:mga0n895_176933_c1 3300050512 Bacteria 2164
292 nmdc:mga0n895_7508_c1 3300050512 Bacteria 9364
293 nmdc:mga0a205_271864_c1 3300050515 Bacteria 1571
294 Ga0500635_0059145 3300053080 Bacteria 1332
295 Ga0500556_0000592 3300053104 Bacteria 23867
296 Ga0500593_000926 3300053117 Bacteria 10883
297 Ga0501084_0081260 3300054114 Bacteria 2718
298 Ga0501084_0253104 3300054114 Bacteria 1487
299 Ga0501082_0198420 3300060353 Bacteria 1746
300 Ga0466962_0009716 3300061719 Bacteria 4616
301 2579855967 2579778521 Bacteria 7624758
302 2619855103 2619618881 Bacteria 7521104
303 2620352033 2619619003 Bacteria 7619552
304 2626635896 2626541554 Bacteria 7741902
305 2739332569 2738543028 Bacteria 6917070
306 2776369607 2775506925 Bacteria 7237746
307 2863072591 2863067949 Bacteria 8541735
308 8054916217 8054913762 Bacteria 7713009
309 8054926078 8054920844 Bacteria 7068637
310 Ga0496110_0036246
311 Ga0070683_100059936
312 Ga0070683_100208724
313 Ga0070680_100053608
314 Ga0070689_100089924
315 Ga0070687_100013484
316 Ga0070659_100030458
317 Ga0070709_10073528
318 Ga0070714_100093014
319 Ga0070714_100162549
320 Ga0070713_100081441
321 Ga0070713_100142231
322 Ga0070713_100163154
323 Ga0070713_100253953
324 Ga0070711_100060239
325 Ga0070678_100163834
326 Ga0070681_10011602
327 Ga0070684_100015172
328 Ga0070686_100011387
329 Ga0070665_100063949
330 Ga0068855_100116280
331 Ga0068855_100563610
332 Ga0068856_100011126
333 Ga0068856_100122638
334 Ga0070702_100141713
335 Ga0068866_10009765
336 Ga0068861_100101507
337 Ga0068863_100009095
338 Ga0068863_100073980
339 Ga0068863_100170671
340 Ga0068858_100000087
341 Ga0068860_100002503
342 Ga0068862_100202603
343 Ga0070717_10013535
344 Ga0070717_10066140
345 Ga0075365_10000647
346 Ga0075365_10006945
347 Ga0075365_10014214
348 Ga0075365_10049736
349 Ga0075363_100029829
350 Ga0075363_100039841
351 Ga0075363_100086270
352 Ga0075364_10001464
353 Ga0075364_10001579
354 Ga0075364_10035569
355 Ga0075362_10032610
356 Ga0075367_10058189
357 Ga0075430_100206603
358 Ga0068865_100009853
359 Ga0099795_10009892
360 Ga0111539_10244493
361 Ga0105245_10439041
362 Ga0105247_10001266
363 Ga0105247_10007288
364 Ga0105243_10010153
365 Ga0105243_10055091
366 Ga0105243_10097175
367 Ga0105242_10012117
368 Ga0105248_10277874
369 Ga0105237_10002970
370 Ga0105238_10086105
371 Ga0105249_10014341
372 Ga0105249_10066713
373 Ga0157370_10105834
374 Ga0157370_10127924
375 Ga0157369_10190372
376 Ga0157374_10099732
377 Ga0157378_10013748
378 Ga0157372_10304332
379 Ga0157375_10041671
380 Ga0157375_10048698
381 Ga0163163_10176598
382 Ga0157380_10382762
383 Ga0157379_10000018
384 Ga0157379_10002368
385 Ga0157379_10038797
386 Ga0163161_10022336
387 Ga0197907_10255104
388 Ga0206350_10231700
389 Ga0206350_11283589
390 Ga0206353_11556449
391 Ga0213876_10002825
392 Ga0224712_10026521
393 Ga0207653_10025298
394 Ga0207642_10049061
395 Ga0207710_10012346
396 Ga0207699_10027418
397 Ga0207705_10034402
398 Ga0207707_10006044
399 Ga0207671_10008470
400 Ga0207693_10066042
401 Ga0207660_10058331
402 Ga0207662_10010882
403 Ga0207657_10066508
404 Ga0207657_10106565
405 Ga0207694_10080951
406 Ga0207659_10141809
407 Ga0207700_10001648
408 Ga0207664_10065590
409 Ga0207664_10141104
410 Ga0207644_10029967
411 Ga0207644_10178993
412 Ga0207690_10043111
413 Ga0207706_10114747
414 Ga0207709_10004135
415 Ga0207704_10014131
416 Ga0207691_10262193
417 Ga0207689_10026260
418 Ga0207661_10090934
419 Ga0207667_10162897
420 Ga0207712_10236517
421 Ga0207668_10031015
422 Ga0207640_10128131
423 Ga0207703_10000005
424 Ga0207703_10110920
425 Ga0207703_10112385
426 Ga0207678_10037790
427 Ga0207702_10028443
428 Ga0207702_10168605
429 Ga0207641_10065845
430 Ga0207641_10070432
431 Ga0207676_10020205
432 Ga0207674_10110480
433 Ga0207674_10166368
434 Ga0207675_100013998
435 Ga0207675_100082420
436 Ga0268266_10123741
437 Ga0268264_10030034
438 Ga0268264_10076203
439 Ga0307515_10225765
440 Ga0265327_10005659
441 Ga0265327_10007203
442 Ga0265327_10014672
443 Ga0316579_10033457
444 Ga0316579_10035765
445 Ga0316576_10011983
446 Ga0316576_10030466
447 Ga0316576_10039852
448 Ga0316576_10225163
449 Ga0316578_10023183
450 Ga0316578_10028255
451 Ga0316577_10096276
452 Ga0307409_100138974
453 Ga0373932_0024020
454 Ga0316574_0027128
455 Ga0316574_0028828
456 Ga0373927_0001956
457 Ga0316582_0107690
458 Ga0316582_0219539
459 Ga0316584_0053772
460 Ga0316584_0391509
461 Ga0373925_0000013
462 Ga0373925_0000164
463 Ga0395898_0097577
464 Ga0400483_069265
465 Ga0400483_090997
466 Ga0400483_206454
467 Ga0400483_279754
468 Ga0400483_287777
469 Ga0436365_0942585
470 Ga0451853_1818577
471 Ga0451577_0002372
472 Ga0466961_0069282
473 Ga0466963_0095429
474 Ga0466963_0158735
475 Ga0466963_0167495
476 Ga0466963_0171237
477 Ga0466963_0193083
478 Ga0466963_0240527
479 Ga0453684_0011654
480 Ga0466971_0013470
481 Ga0466957_0009521
482 Ga0466960_0011330
483 Ga0466959_0141347
484 Ga0466958_0006636
485 Ga0466958_0019067
486 Ga0466958_0221675
487 Ga0466967_0014352
488 Ga0466967_0068890
489 Ga0466967_0167005
490 Ga0466967_0322100
491 Ga0495641_0043047
492 Ga0495657_0121369
493 Ga0495670_0073588
494 Ga0495676_0062950
495 Ga0496102_0120609
496 Ga0496102_0327008
497 Ga0496104_0032517
498 Ga0496104_0033213
499 Ga0496105_0023787
500 Ga0496105_0042227
501 Ga0496107_0005926
502 Ga0496108_0184869
503 Ga0496109_0013522
504 Ga0496109_0106247
505 Ga0496109_0369688
506 Ga0496110_0005123
507 Ga0496110_0102134
508 Ga0496110_0114559
509 Ga0496110_0117871
510 Ga0496110_0170211
511 Ga0496111_0008879
512 Ga0496111_0036687
513 Ga0496112_0062775
514 Ga0496112_0132293
515 Ga0496113_0003142
516 Ga0496113_0178162
517 Ga0496114_0014097
518 Ga0496114_0194115
519 Ga0496115_0200477
520 Ga0496119_0011508
521 Ga0496120_0062116
522 Ga0496126_0000036
523 Ga0496126_0000529
524 Ga0496126_0198222
525 Ga0501031_0146326
526 Ga0501032_0018837
527 Ga0501032_0200616
528 Ga0501034_0004509
529 Ga0501034_0058213
530 Ga0501034_0072738
531 Ga0501034_0075142
532 Ga0501034_0121100
533 Ga0501034_0130158
534 Ga0501036_0065986
535 Ga0501036_0072335
536 Ga0501036_0231986
537 Ga0501036_0359743
538 Ga0501037_0054484
539 Ga0501039_0122101
540 Ga0501039_0306529
541 Ga0501040_0026986
542 Ga0501040_0053947
543 Ga0501041_0129742
544 Ga0501041_0169619
545 Ga0501042_0112743
546 Ga0501042_0149765
547 Ga0501043_0117867
548 Ga0501048_0007115
549 Ga0501069_0000079
550 Ga0501069_0004940
551 Ga0501070_0000092
552 Ga0501070_0007291
553 Ga0501070_0017434
554 Ga0501070_0028858
555 Ga0501070_0141371
556 Ga0501070_0223075
557 Ga0501071_0007702
558 Ga0501071_0028118
559 Ga0501071_0063131
560 Ga0501072_0034595
561 Ga0501072_0037588
562 Ga0501072_0104699
563 Ga0501074_0000989
564 Ga0501075_0008062
565 Ga0501075_0062214
566 Ga0501075_0133244
567 Ga0501075_0161834
568 Ga0501076_0023796
569 Ga0501076_0032990
570 Ga0501076_0114118
571 Ga0501076_0254474
572 Ga0501079_0000017
573 Ga0501079_0040306
574 Ga0501079_0169989
575 Ga0501080_0000419
576 Ga0501080_0005386
577 Ga0501080_0012840
578 Ga0501080_0105670
579 Ga0501081_0075164
580 Ga0501081_0118549
581 Ga0501083_0011790
582 Ga0501035_0086269
583 Ga0501044_0002564
584 Ga0501044_0063430
585 Ga0501045_0052966
586 nmdc:mga03683_32413_c1
587 nmdc:mga03n38_43520_c1
588 nmdc:mga00v17_133736_c1
589 nmdc:mga00v17_2207_c1
590 nmdc:mga00v17_27902_c1
591 nmdc:mga00v17_28403_c1
592 nmdc:mga00v17_31104_c1
593 nmdc:mga00v17_8119_c1
594 nmdc:mga0yw44_2354_c1
595 nmdc:mga0yw44_7618_c1
596 nmdc:mga0yw44_77174_c1
597 nmdc:mga06z11_117617_c1
598 nmdc:mga07m45_58890_c2
599 nmdc:mga08y16_142938_c1
600 nmdc:mga0n895_176933_c1
601 nmdc:mga0n895_7508_c1
602 nmdc:mga0a205_271864_c1
603 Ga0500635_0059145
604 Ga0500556_0000592
605 Ga0500593_000926
606 Ga0501084_0081260
607 Ga0501084_0253104
608 Ga0501082_0198420
609 Ga0466962_0009716
610 2579855967
611 2619855103
612 2620352033
613 2626635896
614 2739332569
615 2776369607
616 2863072591
617 8054916217
618 8054926078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

244

380

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

74

204

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f8f-assembly1.cif.gz_A crystal structure of benzyl alcohol dehydrogenase from acinetobacter calcoaceticus 0.9483 1 369
1agn-assembly1.cif.gz_A x-ray structure of human sigma alcohol dehydrogenase 0.9431 1 369
1axg-assembly2.cif.gz_D crystal structure of the val203->ala mutant of liver alcohol dehydrogenase complexed with cofactor nad and inhibitor trifluoroethanol solved to 2.5 angstrom resolution 0.9419 1 369
1d1t-assembly1.cif.gz_B mutant of human sigma alcohol dehydrogenase with leucine at position 141 0.941 1 369
1f8f-assembly1.cif.gz_A crystal structure of benzyl alcohol dehydrogenase from acinetobacter calcoaceticus 0.9407 1 369
ID Description Score Start End Superfamily
1ee2A01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9584 1 369 3.90.180.10
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9578 183 216 3.50.50.60
af_A0A1D6JR65_11_167_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9314 3 156 3.90.180.10
1ee2A01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9306 1 369 3.90.180.10
af_K7MH10_157_229_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.929 174 237 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A6J6V2Q2-F1-model_v4 Unannotated protein 0.9936 48 369 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A2S9FBW8-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.991 1 319 GO:0004022
GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A7K0VGG7-F1-model_v4 Zinc-binding dehydrogenase 0.9874 144 369 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A6J6V2Q2-F1-model_v4 Unannotated protein 0.9844 48 369 GO:0005829
GO:0008270
GO:0046294
GO:0051903
AF-A0A2S9FBW8-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9818 1 319 GO:0004022
GO:0005829
GO:0008270
GO:0046294
GO:0051903

Map