F400253

General Info

Members Datasets Scaffolds Average Seq Length
309 180 618 208

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10669959|Ga0207690_106699592
Length 234
Sequence LPSAAGSKGAPTKTARVGVLGLQGDFSEHLTTLRGIGADGVDVRRPEQLDDIDALIIPGGESTTIGKLAERYGFIPKLRERIAAGMPVWGTCAGAIFIAKDVPGHPHPILSAMDISVERNAFGRQLDSFEAELDVPVLGNTPVHGVFIRAPIIERTGPEVDVLARLDDGRIVAVRQRNILATAFHPELAGETRFHRLVATMAAEYAEPGDLQASLFELFGKVGGRRLSGAATCK

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 7.44
Rhizosphere 91.91
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10669959 3300025932 Bacteria 851
2 Ga0065715_10090636 3300005293 Bacteria 6696
3 Ga0065707_10199362 3300005295 Bacteria 1315
4 Ga0070690_100085023 3300005330 Bacteria 2075
5 Ga0070670_100331526 3300005331 Bacteria 1335
6 Ga0070680_100040609 3300005336 Bacteria 3768
7 Ga0070680_100306222 3300005336 Bacteria 1347
8 Ga0070691_10090945 3300005341 Bacteria 1504
9 Ga0070687_100020634 3300005343 Bacteria 3085
10 Ga0070687_100171224 3300005343 Bacteria 1293
11 Ga0070692_10605422 3300005345 Bacteria 725
12 Ga0070669_100146829 3300005353 Bacteria 1823
13 Ga0070673_100114194 3300005364 Bacteria 2243
14 Ga0070659_100313614 3300005366 Bacteria 1310
15 Ga0070703_10002651 3300005406 Bacteria 5144
16 Ga0070703_10008941 3300005406 Bacteria 2823
17 Ga0070714_101118290 3300005435 Bacteria 768
18 Ga0070701_10114475 3300005438 Bacteria 1511
19 Ga0070700_100036435 3300005441 Bacteria 2984
20 Ga0070694_100116051 3300005444 Bacteria 1914
21 Ga0070694_100397157 3300005444 Bacteria 1079
22 Ga0070708_100012002 3300005445 Bacteria 7061
23 Ga0070708_100044032 3300005445 Bacteria 3923
24 Ga0070708_100479900 3300005445 Bacteria 1173
25 Ga0070663_100302997 3300005455 Bacteria 1280
26 Ga0070681_10015129 3300005458 Bacteria 7674
27 Ga0068867_100073965 3300005459 Bacteria 2553
28 Ga0070706_100081701 3300005467 Bacteria 2993
29 Ga0070706_100214597 3300005467 Bacteria 1796
30 Ga0070706_100232769 3300005467 Bacteria 1720
31 Ga0070706_101020217 3300005467 Bacteria 763
32 Ga0070707_100054789 3300005468 Bacteria 3824
33 Ga0070707_100256168 3300005468 Bacteria 1703
34 Ga0070707_100784456 3300005468 Unclassified 916
35 Ga0070698_100000371 3300005471 Bacteria 46732
36 Ga0070698_100001315 3300005471 Bacteria 27659
37 Ga0070698_100009080 3300005471 Bacteria 10685
38 Ga0070698_100017718 3300005471 Bacteria 7502
39 Ga0070698_100162017 3300005471 Bacteria 2180
40 Ga0070698_100222976 3300005471 Bacteria 1819
41 Ga0070698_100250867 3300005471 Bacteria 1702
42 Ga0070699_100048755 3300005518 Bacteria 3666
43 Ga0070699_100058119 3300005518 Bacteria 3350
44 Ga0070699_100176473 3300005518 Bacteria 1895
45 Ga0070699_100212268 3300005518 Bacteria 1723
46 Ga0070679_100321948 3300005530 Bacteria 1495
47 Ga0070697_100016490 3300005536 Bacteria 5811
48 Ga0070697_100100155 3300005536 Bacteria 2406
49 Ga0070697_100186921 3300005536 Archaea 1757
50 Ga0070697_100396617 3300005536 Bacteria 1197
51 Ga0070697_100517947 3300005536 Bacteria 1044
52 Ga0070695_100137054 3300005545 Bacteria 1693
53 Ga0070695_100160711 3300005545 Bacteria 1576
54 Ga0070695_100632774 3300005545 Unclassified 843
55 Ga0070695_100735893 3300005545 Bacteria 785
56 Ga0070695_100813279 3300005545 Bacteria 749
57 Ga0070696_100011308 3300005546 Bacteria 5977
58 Ga0070696_100090040 3300005546 Bacteria 2182
59 Ga0070696_100360913 3300005546 Bacteria 1127
60 Ga0070704_101030126 3300005549 Bacteria 745
61 Ga0070664_100415855 3300005564 Bacteria 1231
62 Ga0068857_100228461 3300005577 Bacteria 1701
63 Ga0068854_100095657 3300005578 Bacteria 2218
64 Ga0068856_100489266 3300005614 Bacteria 1251
65 Ga0068852_100066914 3300005616 Bacteria 3140
66 Ga0068859_100002901 3300005617 Bacteria 17414
67 Ga0068861_100012367 3300005719 Bacteria 5952
68 Ga0068861_100619607 3300005719 Bacteria 996
69 Ga0068870_10036792 3300005840 Bacteria 2519
70 Ga0068858_100025194 3300005842 Bacteria 5535
71 Ga0081539_10025984 3300005985 Bacteria 3751
72 Ga0075365_10115792 3300006038 Bacteria 1845
73 Ga0070715_10444786 3300006163 Bacteria 730
74 Ga0075433_10017158 3300006852 Bacteria 5990
75 Ga0075433_10080514 3300006852 Bacteria 2871
76 Ga0075433_10181355 3300006852 Bacteria 1874
77 Ga0075434_100095454 3300006871 Bacteria 2979
78 Ga0075434_100576981 3300006871 Bacteria 1144
79 Ga0075436_100020709 3300006914 Bacteria 4512
80 Ga0075436_100138911 3300006914 Bacteria 1707
81 Ga0097620_100002901 3300006931 Bacteria 17414
82 Ga0075435_100019475 3300007076 Bacteria 5185
83 Ga0075435_100076330 3300007076 Bacteria 2746
84 Ga0075435_100234797 3300007076 Bacteria 1558
85 Ga0105240_10000060 3300009093 Bacteria 219839
86 Ga0105240_10208296 3300009093 Bacteria 2286
87 Ga0111539_10747017 3300009094 Bacteria 1139
88 Ga0111539_10844201 3300009094 Unclassified 1066
89 Ga0111539_10847692 3300009094 Bacteria 1063
90 Ga0111539_11426430 3300009094 Bacteria 803
91 Ga0105245_10044657 3300009098 Bacteria 3956
92 Ga0105245_11168980 3300009098 Bacteria 817
93 Ga0114129_10012804 3300009147 Bacteria 11938
94 Ga0114129_10026019 3300009147 Bacteria 8286
95 Ga0114129_10040782 3300009147 Bacteria 6544
96 Ga0114129_10096604 3300009147 Bacteria 4090
97 Ga0114129_10169883 3300009147 Bacteria 2973
98 Ga0114129_10172765 3300009147 Bacteria 2945
99 Ga0114129_10207864 3300009147 Bacteria 2648
100 Ga0114129_10664928 3300009147 Bacteria 1343
101 Ga0114129_10763134 3300009147 Bacteria 1237
102 Ga0114129_11270380 3300009147 Bacteria 914
103 Ga0105243_10006413 3300009148 Bacteria 9090
104 Ga0105243_10150352 3300009148 Bacteria 1997
105 Ga0105243_10418769 3300009148 Bacteria 1249
106 Ga0105248_10164498 3300009177 Bacteria 2501
107 Ga0105238_10008874 3300009551 Bacteria 10060
108 Ga0105249_10430167 3300009553 Bacteria 1355
109 Ga0105246_10062040 3300011119 Bacteria 2602
110 Ga0163163_10017554 3300014325 Bacteria 6678
111 Ga0197907_10525281 3300020069 Bacteria 883
112 Ga0207653_10000648 3300025885 Bacteria 11948
113 Ga0207653_10117155 3300025885 Bacteria 956
114 Ga0207647_10219268 3300025904 Bacteria 1097
115 Ga0207699_10049504 3300025906 Bacteria 2474
116 Ga0207684_10009445 3300025910 Bacteria 8613
117 Ga0207684_10015972 3300025910 Bacteria 6452
118 Ga0207684_10020795 3300025910 Bacteria 5607
119 Ga0207684_10526398 3300025910 Bacteria 1012
120 Ga0207684_10637950 3300025910 Bacteria 908
121 Ga0207707_10058783 3300025912 Bacteria 3345
122 Ga0207695_10000025 3300025913 Bacteria 627211
123 Ga0207660_10006366 3300025917 Bacteria 7650
124 Ga0207660_10122534 3300025917 Bacteria 1970
125 Ga0207662_10094879 3300025918 Bacteria 1841
126 Ga0207662_10531132 3300025918 Bacteria 813
127 Ga0207649_10073458 3300025920 Bacteria 2191
128 Ga0207652_10165862 3300025921 Bacteria 1981
129 Ga0207652_10306278 3300025921 Bacteria 1434
130 Ga0207652_10595506 3300025921 Bacteria 992
131 Ga0207646_10000036 3300025922 Bacteria 197163
132 Ga0207646_10001864 3300025922 Bacteria 25425
133 Ga0207646_10004652 3300025922 Bacteria 14812
134 Ga0207646_10261507 3300025922 Bacteria 1564
135 Ga0207646_10752484 3300025922 Unclassified 870
136 Ga0207694_10006281 3300025924 Bacteria 9073
137 Ga0207664_11019971 3300025929 Bacteria 741
138 Ga0207690_10122865 3300025932 Bacteria 1888
139 Ga0207690_10297722 3300025932 Bacteria 1261
140 Ga0207706_10124825 3300025933 Bacteria 2264
141 Ga0207709_10117476 3300025935 Bacteria 1790
142 Ga0207669_10068854 3300025937 Bacteria 2212
143 Ga0207691_10039621 3300025940 Bacteria 4359
144 Ga0207689_10043273 3300025942 Bacteria 3723
145 Ga0207689_10116966 3300025942 Bacteria 2192
146 Ga0207712_10375634 3300025961 Bacteria 1188
147 Ga0207640_10027446 3300025981 Bacteria 3469
148 Ga0207678_10006974 3300026067 Bacteria 10028
149 Ga0207708_10117830 3300026075 Bacteria 2067
150 Ga0207702_10090274 3300026078 Bacteria 2681
151 Ga0207702_10095565 3300026078 Bacteria 2611
152 Ga0207648_10001945 3300026089 Bacteria 22597
153 Ga0207675_100120277 3300026118 Bacteria 2484
154 Ga0207675_100314895 3300026118 Unclassified 1527
155 Ga0207675_100367170 3300026118 Bacteria 1413
156 Ga0209999_1050273 3300027543 Bacteria 787
157 Ga0209974_10012168 3300027876 Bacteria 2880
158 Ga0268264_10213522 3300028381 Bacteria 1772
159 Ga0265319_1003275 3300028563 Bacteria 8518
160 Ga0265334_10013886 3300028573 Bacteria 3364
161 Ga0265318_10025217 3300028577 Bacteria 2350
162 Ga0265338_10019178 3300028800 Bacteria 7279
163 Ga0265338_10095781 3300028800 Bacteria 2437
164 Ga0265338_10131577 3300028800 Bacteria 1974
165 Ga0265332_10054402 3300031238 Bacteria 1717
166 Ga0265320_10021469 3300031240 Bacteria 3471
167 Ga0265320_10194544 3300031240 Bacteria 906
168 Ga0265325_10045696 3300031241 Bacteria 2274
169 Ga0265339_10072316 3300031249 Bacteria 1835
170 Ga0265316_10066130 3300031344 Bacteria 2799
171 Ga0265316_10179271 3300031344 Bacteria 1578
172 Ga0265313_10053456 3300031595 Bacteria 1922
173 Ga0265314_10096272 3300031711 Bacteria 1915
174 Ga0307416_100452107 3300032002 Bacteria 1337
175 Ga0307415_100025215 3300032126 Bacteria 3727
176 Ga0307510_10118151 3300033180 Bacteria 2365
177 Ga0373944_0065603 3300035089 Bacteria 1173
178 Ga0373932_0206015 3300035112 Bacteria 701
179 Ga0373941_0123850 3300035115 Bacteria 924
180 Ga0373943_0002632 3300035170 Bacteria 8164
181 Ga0373946_0160533 3300035171 Bacteria 1055
182 Ga0373942_0079784 3300035207 Bacteria 970
183 Ga0373961_0050835 3300035241 Bacteria 1229
184 Ga0373935_0294159 3300035692 Bacteria 1146
185 Ga0373947_0191653 3300035725 Bacteria 1334
186 Ga0373947_0230123 3300035725 Bacteria 1221
187 Ga0395900_0131916 3300037418 Bacteria 2560
188 Ga0395905_1005982 3300037471 Unclassified 737
189 Ga0395901_0046650 3300038443 Bacteria 4502
190 Ga0439466_0112241 3300041411 Unclassified 845
191 Ga0439465_0079883 3300041413 Bacteria 1108
192 Ga0450900_016023 3300042136 Bacteria 1012
193 Ga0439446_0029826 3300042156 Bacteria 1575
194 Ga0453683_0158360 3300044673 Bacteria 1432
195 Ga0453684_0223411 3300044712 Bacteria 2180
196 Ga0451576_0084124 3300045051 Bacteria 3309
197 Ga0451576_1301650 3300045051 Bacteria 758
198 Ga0495628_0177395 3300046516 Bacteria 1613
199 Ga0495630_0192213 3300046517 Unclassified 1557
200 Ga0495652_0058538 3300046529 Bacteria 3262
201 Ga0495640_0071316 3300046533 Bacteria 2331
202 Ga0495645_0081599 3300046543 Unclassified 2320
203 Ga0495657_0150706 3300046675 Unclassified 1444
204 Ga0495670_0136086 3300046691 Bacteria 1283
205 Ga0495600_0327491 3300046809 Unclassified 962
206 Ga0495674_0110977 3300047319 Bacteria 2325
207 Ga0495680_0095368 3300047322 Bacteria 2224
208 Ga0495675_0498368 3300047444 Unclassified 700
209 Ga0495686_0002495 3300047472 Bacteria 17288
210 Ga0496100_0029817 3300048903 Bacteria 3378
211 Ga0496101_0010691 3300048904 Bacteria 6065
212 Ga0496102_0110965 3300048905 Bacteria 2557
213 Ga0496102_0525933 3300048905 Bacteria 1105
214 Ga0496102_0764809 3300048905 Bacteria 889
215 Ga0496104_0243714 3300048907 Bacteria 1710
216 Ga0496105_0095868 3300048908 Bacteria 2450
217 Ga0496106_0139666 3300048909 Bacteria 1905
218 Ga0496106_0356687 3300048909 Bacteria 1175
219 Ga0496107_0031482 3300048910 Bacteria 3786
220 Ga0496108_0045753 3300048911 Bacteria 3655
221 Ga0496108_0057061 3300048911 Bacteria 3281
222 Ga0496108_0322958 3300048911 Bacteria 1346
223 Ga0496108_0514863 3300048911 Bacteria 1045
224 Ga0496109_0008247 3300048912 Bacteria 8846
225 Ga0496109_0437086 3300048912 Bacteria 1236
226 Ga0496110_0012842 3300048913 Bacteria 6900
227 Ga0496111_0116075 3300048914 Bacteria 1974
228 Ga0496111_0141520 3300048914 Bacteria 1782
229 Ga0496112_0625460 3300048915 Bacteria 1007
230 Ga0496112_0837145 3300048915 Unclassified 844
231 Ga0496113_0065568 3300048916 Bacteria 2749
232 Ga0496114_0001064 3300048917 Bacteria 20639
233 Ga0501031_0121242 3300049568 Bacteria 1708
234 Ga0501031_0466557 3300049568 Bacteria 815
235 Ga0501032_0127571 3300049569 Bacteria 1680
236 Ga0501036_0334832 3300049572 Bacteria 1264
237 Ga0501039_0533432 3300049575 Bacteria 921
238 Ga0501039_0631629 3300049575 Unclassified 839
239 Ga0501040_0061046 3300049576 Bacteria 2592
240 Ga0501040_0091071 3300049576 Bacteria 2120
241 Ga0501042_0191164 3300049578 Bacteria 1476
242 Ga0501042_0325404 3300049578 Archaea 1111
243 Ga0501046_0092658 3300049580 Bacteria 2323
244 Ga0501048_0618720 3300049582 Bacteria 777
245 Ga0501067_0017268 3300049583 Bacteria 3988
246 Ga0501068_0064946 3300049584 Bacteria 2221
247 Ga0501069_0051668 3300049585 Bacteria 2288
248 Ga0501071_0178881 3300049587 Archaea 1589
249 Ga0501071_0638861 3300049587 Bacteria 819
250 Ga0501072_0118937 3300049588 Bacteria 2105
251 Ga0501072_0372510 3300049588 Bacteria 1133
252 Ga0501073_0174500 3300049589 Bacteria 1488
253 Ga0501074_0125476 3300049590 Bacteria 1836
254 Ga0501074_0270962 3300049590 Bacteria 1207
255 Ga0501075_0005634 3300049591 Bacteria 8565
256 Ga0501075_0078680 3300049591 Bacteria 2496
257 Ga0501075_0096229 3300049591 Bacteria 2247
258 Ga0501075_0159810 3300049591 Bacteria 1719
259 Ga0501075_0286240 3300049591 Bacteria 1255
260 Ga0501076_0083500 3300049592 Bacteria 2565
261 Ga0501076_0144552 3300049592 Bacteria 1933
262 Ga0501076_0298194 3300049592 Bacteria 1321
263 Ga0501076_0551152 3300049592 Bacteria 951
264 Ga0501077_0026203 3300049593 Bacteria 3700
265 Ga0501077_0376802 3300049593 Bacteria 906
266 Ga0501079_0027824 3300049741 Bacteria 4337
267 Ga0501079_0120987 3300049741 Bacteria 2036
268 Ga0501079_0122973 3300049741 Bacteria 2018
269 Ga0501079_0323001 3300049741 Bacteria 1208
270 Ga0501079_0412904 3300049741 Bacteria 1059
271 Ga0501080_0254507 3300049742 Bacteria 1601
272 Ga0501080_0474352 3300049742 Bacteria 1120
273 Ga0501081_0060595 3300049743 Bacteria 2622
274 Ga0501081_0204924 3300049743 Bacteria 1431
275 Ga0501035_0558283 3300049822 Bacteria 937
276 Ga0501045_0061394 3300049824 Bacteria 2757
277 Ga0501045_0216931 3300049824 Bacteria 1425
278 Ga0501045_0467218 3300049824 Bacteria 937
279 nmdc:mga05p37_2002_c1 3300050507 Bacteria 23774
280 nmdc:mga05p37_332418_c1 3300050507 Bacteria 1794
281 nmdc:mga05p37_377512_c1 3300050507 Bacteria 1662
282 nmdc:mga05p37_38363_c1 3300050507 Bacteria 5876
283 nmdc:mga05p37_433335_c1 3300050507 Bacteria 1527
284 nmdc:mga05p37_551000_c1 3300050507 Bacteria 1313
285 nmdc:mga05p37_796536_c1 3300050507 Bacteria 1035
286 nmdc:mga05p37_98339_c1 3300050507 Bacteria 3604
287 nmdc:mga08y16_139588_c1 3300050511 Bacteria 2519
288 nmdc:mga08y16_257264_c1 3300050511 Bacteria 1803
289 nmdc:mga0n895_117261_c1 3300050512 Bacteria 2682
290 nmdc:mga0rr50_103436_c1 3300050513 Bacteria 2241
291 nmdc:mga0rr50_222777_c1 3300050513 Bacteria 1558
292 nmdc:mga0rr50_6654_c1 3300050513 Bacteria 7065
293 nmdc:mga0rr50_71054_c1 3300050513 Bacteria 2655
294 nmdc:mga0rr50_83353_c1 3300050513 Bacteria 2472
295 nmdc:mga08x19_100234_c1 3300050514 Bacteria 1921
296 nmdc:mga08x19_112514_c1 3300050514 Bacteria 1817
297 nmdc:mga0a205_179916_c1 3300050515 Bacteria 2009
298 nmdc:mga0a205_359926_c1 3300050515 Bacteria 1322
299 nmdc:mga0a205_366640_c1 3300050515 Bacteria 1307
300 nmdc:mga0a205_59235_c1 3300050515 Bacteria 3699
301 nmdc:mga0a205_9482_c1 3300050515 Bacteria 8905
302 Ga0495601_0029638 3300053077 Bacteria 3395
303 Ga0495595_0004608 3300053084 Bacteria 5544
304 Ga0495619_0024082 3300053085 Bacteria 3903
305 Ga0501084_0090753 3300054114 Bacteria 2565
306 Ga0501082_0356041 3300060353 Bacteria 1276
307 Ga0530510_0000449 3300061734 Bacteria 26656
308 Ga0530510_0220100 3300061734 Bacteria 1411
309 Ga0530510_0258849 3300061734 Bacteria 1297
310 Ga0207690_10669959
311 Ga0065715_10090636
312 Ga0065707_10199362
313 Ga0070690_100085023
314 Ga0070670_100331526
315 Ga0070680_100040609
316 Ga0070680_100306222
317 Ga0070691_10090945
318 Ga0070687_100020634
319 Ga0070687_100171224
320 Ga0070692_10605422
321 Ga0070669_100146829
322 Ga0070673_100114194
323 Ga0070659_100313614
324 Ga0070703_10002651
325 Ga0070703_10008941
326 Ga0070714_101118290
327 Ga0070701_10114475
328 Ga0070700_100036435
329 Ga0070694_100116051
330 Ga0070694_100397157
331 Ga0070708_100012002
332 Ga0070708_100044032
333 Ga0070708_100479900
334 Ga0070663_100302997
335 Ga0070681_10015129
336 Ga0068867_100073965
337 Ga0070706_100081701
338 Ga0070706_100214597
339 Ga0070706_100232769
340 Ga0070706_101020217
341 Ga0070707_100054789
342 Ga0070707_100256168
343 Ga0070707_100784456
344 Ga0070698_100000371
345 Ga0070698_100001315
346 Ga0070698_100009080
347 Ga0070698_100017718
348 Ga0070698_100162017
349 Ga0070698_100222976
350 Ga0070698_100250867
351 Ga0070699_100048755
352 Ga0070699_100058119
353 Ga0070699_100176473
354 Ga0070699_100212268
355 Ga0070679_100321948
356 Ga0070697_100016490
357 Ga0070697_100100155
358 Ga0070697_100186921
359 Ga0070697_100396617
360 Ga0070697_100517947
361 Ga0070695_100137054
362 Ga0070695_100160711
363 Ga0070695_100632774
364 Ga0070695_100735893
365 Ga0070695_100813279
366 Ga0070696_100011308
367 Ga0070696_100090040
368 Ga0070696_100360913
369 Ga0070704_101030126
370 Ga0070664_100415855
371 Ga0068857_100228461
372 Ga0068854_100095657
373 Ga0068856_100489266
374 Ga0068852_100066914
375 Ga0068859_100002901
376 Ga0068861_100012367
377 Ga0068861_100619607
378 Ga0068870_10036792
379 Ga0068858_100025194
380 Ga0081539_10025984
381 Ga0075365_10115792
382 Ga0070715_10444786
383 Ga0075433_10017158
384 Ga0075433_10080514
385 Ga0075433_10181355
386 Ga0075434_100095454
387 Ga0075434_100576981
388 Ga0075436_100020709
389 Ga0075436_100138911
390 Ga0097620_100002901
391 Ga0075435_100019475
392 Ga0075435_100076330
393 Ga0075435_100234797
394 Ga0105240_10000060
395 Ga0105240_10208296
396 Ga0111539_10747017
397 Ga0111539_10844201
398 Ga0111539_10847692
399 Ga0111539_11426430
400 Ga0105245_10044657
401 Ga0105245_11168980
402 Ga0114129_10012804
403 Ga0114129_10026019
404 Ga0114129_10040782
405 Ga0114129_10096604
406 Ga0114129_10169883
407 Ga0114129_10172765
408 Ga0114129_10207864
409 Ga0114129_10664928
410 Ga0114129_10763134
411 Ga0114129_11270380
412 Ga0105243_10006413
413 Ga0105243_10150352
414 Ga0105243_10418769
415 Ga0105248_10164498
416 Ga0105238_10008874
417 Ga0105249_10430167
418 Ga0105246_10062040
419 Ga0163163_10017554
420 Ga0197907_10525281
421 Ga0207653_10000648
422 Ga0207653_10117155
423 Ga0207647_10219268
424 Ga0207699_10049504
425 Ga0207684_10009445
426 Ga0207684_10015972
427 Ga0207684_10020795
428 Ga0207684_10526398
429 Ga0207684_10637950
430 Ga0207707_10058783
431 Ga0207695_10000025
432 Ga0207660_10006366
433 Ga0207660_10122534
434 Ga0207662_10094879
435 Ga0207662_10531132
436 Ga0207649_10073458
437 Ga0207652_10165862
438 Ga0207652_10306278
439 Ga0207652_10595506
440 Ga0207646_10000036
441 Ga0207646_10001864
442 Ga0207646_10004652
443 Ga0207646_10261507
444 Ga0207646_10752484
445 Ga0207694_10006281
446 Ga0207664_11019971
447 Ga0207690_10122865
448 Ga0207690_10297722
449 Ga0207706_10124825
450 Ga0207709_10117476
451 Ga0207669_10068854
452 Ga0207691_10039621
453 Ga0207689_10043273
454 Ga0207689_10116966
455 Ga0207712_10375634
456 Ga0207640_10027446
457 Ga0207678_10006974
458 Ga0207708_10117830
459 Ga0207702_10090274
460 Ga0207702_10095565
461 Ga0207648_10001945
462 Ga0207675_100120277
463 Ga0207675_100314895
464 Ga0207675_100367170
465 Ga0209999_1050273
466 Ga0209974_10012168
467 Ga0268264_10213522
468 Ga0265319_1003275
469 Ga0265334_10013886
470 Ga0265318_10025217
471 Ga0265338_10019178
472 Ga0265338_10095781
473 Ga0265338_10131577
474 Ga0265332_10054402
475 Ga0265320_10021469
476 Ga0265320_10194544
477 Ga0265325_10045696
478 Ga0265339_10072316
479 Ga0265316_10066130
480 Ga0265316_10179271
481 Ga0265313_10053456
482 Ga0265314_10096272
483 Ga0307416_100452107
484 Ga0307415_100025215
485 Ga0307510_10118151
486 Ga0373944_0065603
487 Ga0373932_0206015
488 Ga0373941_0123850
489 Ga0373943_0002632
490 Ga0373946_0160533
491 Ga0373942_0079784
492 Ga0373961_0050835
493 Ga0373935_0294159
494 Ga0373947_0191653
495 Ga0373947_0230123
496 Ga0395900_0131916
497 Ga0395905_1005982
498 Ga0395901_0046650
499 Ga0439466_0112241
500 Ga0439465_0079883
501 Ga0450900_016023
502 Ga0439446_0029826
503 Ga0453683_0158360
504 Ga0453684_0223411
505 Ga0451576_0084124
506 Ga0451576_1301650
507 Ga0495628_0177395
508 Ga0495630_0192213
509 Ga0495652_0058538
510 Ga0495640_0071316
511 Ga0495645_0081599
512 Ga0495657_0150706
513 Ga0495670_0136086
514 Ga0495600_0327491
515 Ga0495674_0110977
516 Ga0495680_0095368
517 Ga0495675_0498368
518 Ga0495686_0002495
519 Ga0496100_0029817
520 Ga0496101_0010691
521 Ga0496102_0110965
522 Ga0496102_0525933
523 Ga0496102_0764809
524 Ga0496104_0243714
525 Ga0496105_0095868
526 Ga0496106_0139666
527 Ga0496106_0356687
528 Ga0496107_0031482
529 Ga0496108_0045753
530 Ga0496108_0057061
531 Ga0496108_0322958
532 Ga0496108_0514863
533 Ga0496109_0008247
534 Ga0496109_0437086
535 Ga0496110_0012842
536 Ga0496111_0116075
537 Ga0496111_0141520
538 Ga0496112_0625460
539 Ga0496112_0837145
540 Ga0496113_0065568
541 Ga0496114_0001064
542 Ga0501031_0121242
543 Ga0501031_0466557
544 Ga0501032_0127571
545 Ga0501036_0334832
546 Ga0501039_0533432
547 Ga0501039_0631629
548 Ga0501040_0061046
549 Ga0501040_0091071
550 Ga0501042_0191164
551 Ga0501042_0325404
552 Ga0501046_0092658
553 Ga0501048_0618720
554 Ga0501067_0017268
555 Ga0501068_0064946
556 Ga0501069_0051668
557 Ga0501071_0178881
558 Ga0501071_0638861
559 Ga0501072_0118937
560 Ga0501072_0372510
561 Ga0501073_0174500
562 Ga0501074_0125476
563 Ga0501074_0270962
564 Ga0501075_0005634
565 Ga0501075_0078680
566 Ga0501075_0096229
567 Ga0501075_0159810
568 Ga0501075_0286240
569 Ga0501076_0083500
570 Ga0501076_0144552
571 Ga0501076_0298194
572 Ga0501076_0551152
573 Ga0501077_0026203
574 Ga0501077_0376802
575 Ga0501079_0027824
576 Ga0501079_0120987
577 Ga0501079_0122973
578 Ga0501079_0323001
579 Ga0501079_0412904
580 Ga0501080_0254507
581 Ga0501080_0474352
582 Ga0501081_0060595
583 Ga0501081_0204924
584 Ga0501035_0558283
585 Ga0501045_0061394
586 Ga0501045_0216931
587 Ga0501045_0467218
588 nmdc:mga05p37_2002_c1
589 nmdc:mga05p37_332418_c1
590 nmdc:mga05p37_377512_c1
591 nmdc:mga05p37_38363_c1
592 nmdc:mga05p37_433335_c1
593 nmdc:mga05p37_551000_c1
594 nmdc:mga05p37_796536_c1
595 nmdc:mga05p37_98339_c1
596 nmdc:mga08y16_139588_c1
597 nmdc:mga08y16_257264_c1
598 nmdc:mga0n895_117261_c1
599 nmdc:mga0rr50_103436_c1
600 nmdc:mga0rr50_222777_c1
601 nmdc:mga0rr50_6654_c1
602 nmdc:mga0rr50_71054_c1
603 nmdc:mga0rr50_83353_c1
604 nmdc:mga08x19_100234_c1
605 nmdc:mga08x19_112514_c1
606 nmdc:mga0a205_179916_c1
607 nmdc:mga0a205_359926_c1
608 nmdc:mga0a205_366640_c1
609 nmdc:mga0a205_59235_c1
610 nmdc:mga0a205_9482_c1
611 Ga0495601_0029638
612 Ga0495595_0004608
613 Ga0495619_0024082
614 Ga0501084_0090753
615 Ga0501082_0356041
616 Ga0530510_0000449
617 Ga0530510_0220100
618 Ga0530510_0258849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01174

SNO

SNO glutamine amidotransferase family

19

204

0.95

PF03575

Peptidase_S51

Peptidase family S51

26

108

0.9

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

26

191

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iss-assembly1.cif.gz_D structure of the plp synthase holoenzyme from thermotoga maritima 0.959 12 198
2nv2-assembly1.cif.gz_J structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis 0.955 11 200
4wxy-assembly1.cif.gz_L plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9529 13 200
4wxy-assembly1.cif.gz_F plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9493 13 200
2nv0-assembly1.cif.gz_A structure of the glutaminase subunit pdx2 (yaae) of plp synthase from bacillus subtilis 0.9456 11 200
ID Description Score Start End Superfamily
2ywdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9454 14 201 3.40.50.880
2ywdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9309 14 201 3.40.50.880
af_P9WII7_2_198_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9287 10 199 3.40.50.880
af_Q8LAD0_1_232_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9199 13 200 3.40.50.880
2ywjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9106 13 201 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7C7QBT3-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9934 13 91 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A0T6AKK5-F1-model_v4 glutaminase (EC 3.5.1.2) 0.991 13 96 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016740
GO:0016829
GO:0042823
GO:1903600
AF-W4LCM6-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9856 11 95 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A804P535-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9854 11 87 GO:0004359
GO:0016829
GO:0042823
AF-A0A7C3Y319-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9846 11 108 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600

Map