F400193

General Info

Members Datasets Scaffolds Average Seq Length
309 153 618 199

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10101016|Ga0105242_101010162
Length 212
Sequence MTPAIAGGKMDTPKQAGSFEETSLIQQPDWVLPDRGRVGVLCLIVTEFALFSIFVVAYIFYIGKSLTGPTPSQVLELPIWATICLLSSSITVAIAERALKANQIQRFKLWTGATILLGLEFLRNTAVEWRHLIHDFHLTITTNLFGTTFYSLVGLHASHVVIGLSLLLLTFILGLRGSMQGQSRRFELLSWYWHFVDGVWVAVFTVVYVIGR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 1.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.94
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 21.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10101016 3300009176 Bacteria 2444
2 Ga0058863_11864711 3300004799 Bacteria 1831
3 Ga0058861_11628810 3300004800 Unclassified 1230
4 Ga0058862_12518384 3300004803 Bacteria 1738
5 Ga0065704_10024809 3300005289 Bacteria 1146
6 Ga0065715_10219349 3300005293 Unclassified 1279
7 Ga0065707_10023214 3300005295 Bacteria 1951
8 Ga0065707_10052972 3300005295 Bacteria 912
9 Ga0065707_10230150 3300005295 Unclassified 1192
10 Ga0065707_10300151 3300005295 Bacteria 1006
11 Ga0065707_10399394 3300005295 Unclassified 854
12 Ga0065707_10495953 3300005295 Bacteria 761
13 Ga0070683_100081929 3300005329 Bacteria 3021
14 Ga0070690_100226156 3300005330 Unclassified 1313
15 Ga0070682_100059042 3300005337 Unclassified 2421
16 Ga0070689_100677530 3300005340 Unclassified 899
17 Ga0070692_10068555 3300005345 Bacteria 1885
18 Ga0070668_100071383 3300005347 Bacteria 2705
19 Ga0070659_100640444 3300005366 Unclassified 916
20 Ga0070709_10608289 3300005434 Bacteria 842
21 Ga0070714_101349536 3300005435 Bacteria 696
22 Ga0070711_100000001 3300005439 Bacteria 370591
23 Ga0070700_100194801 3300005441 Bacteria 1419
24 Ga0070694_100004411 3300005444 Bacteria 8462
25 Ga0070694_100061860 3300005444 Bacteria 2556
26 Ga0070708_100054428 3300005445 Bacteria 3553
27 Ga0070678_100253711 3300005456 Unclassified 1476
28 Ga0070681_10167203 3300005458 Unclassified 2122
29 Ga0070681_10551863 3300005458 Unclassified 1066
30 Ga0070706_100000180 3300005467 Bacteria 80488
31 Ga0070706_100000252 3300005467 Bacteria 65194
32 Ga0070706_100311867 3300005467 Bacteria 1467
33 Ga0070706_101174587 3300005467 Bacteria 705
34 Ga0070707_100037318 3300005468 Bacteria 4637
35 Ga0070707_100159306 3300005468 Bacteria 2199
36 Ga0070707_100230873 3300005468 Bacteria 1801
37 Ga0070707_100384161 3300005468 Bacteria 1364
38 Ga0070698_100042263 3300005471 Bacteria 4675
39 Ga0070698_100060318 3300005471 Bacteria 3828
40 Ga0070698_100148314 3300005471 Bacteria 2294
41 Ga0070698_100270199 3300005471 Bacteria 1632
42 Ga0070698_100321132 3300005471 Unclassified 1479
43 Ga0070699_100051163 3300005518 Bacteria 3576
44 Ga0070699_100300202 3300005518 Bacteria 1441
45 Ga0070699_100394938 3300005518 Bacteria 1250
46 Ga0070699_100420467 3300005518 Unclassified 1210
47 Ga0070679_100060404 3300005530 Unclassified 3777
48 Ga0070697_100002278 3300005536 Bacteria 14728
49 Ga0070697_100068950 3300005536 Bacteria 2896
50 Ga0070697_100089806 3300005536 Bacteria 2539
51 Ga0070697_100201351 3300005536 Bacteria 1693
52 Ga0070697_100230015 3300005536 Bacteria 1581
53 Ga0070697_100260904 3300005536 Bacteria 1483
54 Ga0070697_100345406 3300005536 Bacteria 1285
55 Ga0070697_100881380 3300005536 Bacteria 793
56 Ga0070697_101042012 3300005536 Unclassified 728
57 Ga0068853_100030059 3300005539 Bacteria 4586
58 Ga0070686_100248414 3300005544 Bacteria 1298
59 Ga0070695_100205259 3300005545 Bacteria 1411
60 Ga0070695_100284760 3300005545 Unclassified 1216
61 Ga0070695_100413429 3300005545 Bacteria 1025
62 Ga0070696_100077795 3300005546 Bacteria 2344
63 Ga0070696_100284867 3300005546 Bacteria 1261
64 Ga0070693_100016974 3300005547 Bacteria 3776
65 Ga0070693_100039655 3300005547 Bacteria 2639
66 Ga0070665_100522726 3300005548 Unclassified 1198
67 Ga0070704_100262021 3300005549 Unclassified 1424
68 Ga0068855_100006423 3300005563 Bacteria 14313
69 Ga0068856_100015867 3300005614 Bacteria 7284
70 Ga0068856_100282018 3300005614 Bacteria 1678
71 Ga0070702_100290422 3300005615 Unclassified 1127
72 Ga0068859_100369652 3300005617 Bacteria 1529
73 Ga0068859_100436773 3300005617 Bacteria 1405
74 Ga0068864_100194974 3300005618 Bacteria 1858
75 Ga0068866_10430422 3300005718 Bacteria 858
76 Ga0068861_100289178 3300005719 Bacteria 1414
77 Ga0068863_100054952 3300005841 Bacteria 3772
78 Ga0068863_100140040 3300005841 Bacteria 2312
79 Ga0068860_100086309 3300005843 Bacteria 2986
80 Ga0081455_10017318 3300005937 Bacteria 6915
81 Ga0081455_10029685 3300005937 Bacteria 4982
82 Ga0081455_10295585 3300005937 Bacteria 1164
83 Ga0081455_10295867 3300005937 Bacteria 1163
84 Ga0081538_10009182 3300005981 Bacteria 8288
85 Ga0081539_10211339 3300005985 Unclassified 889
86 Ga0070715_10021547 3300006163 Bacteria 2501
87 Ga0070716_100018516 3300006173 Bacteria 3630
88 Ga0070716_100287777 3300006173 Bacteria 1137
89 Ga0097621_100271897 3300006237 Bacteria 1489
90 Ga0075428_100283439 3300006844 Bacteria 1782
91 Ga0075428_100718881 3300006844 Unclassified 1064
92 Ga0075431_100056883 3300006847 Bacteria 4034
93 Ga0075431_100228253 3300006847 Bacteria 1897
94 Ga0075433_10055418 3300006852 Bacteria 3461
95 Ga0075433_10138280 3300006852 Bacteria 2165
96 Ga0075433_10249650 3300006852 Bacteria 1574
97 Ga0075433_10289302 3300006852 Bacteria 1451
98 Ga0075433_10456036 3300006852 Bacteria 1127
99 Ga0075433_10497818 3300006852 Bacteria 1073
100 Ga0075433_10526958 3300006852 Bacteria 1039
101 Ga0075433_10680205 3300006852 Bacteria 902
102 Ga0075433_11142116 3300006852 Unclassified 677
103 Ga0075434_100076296 3300006871 Unclassified 3346
104 Ga0075434_100100689 3300006871 Bacteria 2895
105 Ga0075434_100284410 3300006871 Bacteria 1673
106 Ga0075434_100653717 3300006871 Bacteria 1069
107 Ga0075434_100809848 3300006871 Bacteria 953
108 Ga0075429_100315417 3300006880 Bacteria 1368
109 Ga0075436_100002889 3300006914 Bacteria 11773
110 Ga0075436_100596404 3300006914 Unclassified 813
111 Ga0075436_100677199 3300006914 Bacteria 763
112 Ga0097620_100369636 3300006931 Bacteria 1529
113 Ga0097620_100436873 3300006931 Bacteria 1405
114 Ga0075435_100147770 3300007076 Bacteria 1975
115 Ga0075435_100266436 3300007076 Bacteria 1460
116 Ga0075435_100477544 3300007076 Unclassified 1076
117 Ga0075435_100479997 3300007076 Bacteria 1074
118 Ga0075435_100501428 3300007076 Bacteria 1049
119 Ga0075435_100945486 3300007076 Unclassified 752
120 Ga0105240_10679604 3300009093 Bacteria 1126
121 Ga0111539_10343772 3300009094 Bacteria 1737
122 Ga0111539_10447729 3300009094 Bacteria 1504
123 Ga0111539_10476837 3300009094 Bacteria 1453
124 Ga0111539_10772593 3300009094 Bacteria 1118
125 Ga0105247_10313286 3300009101 Bacteria 1092
126 Ga0114129_10363510 3300009147 Bacteria 1914
127 Ga0114129_10484318 3300009147 Bacteria 1618
128 Ga0114129_10525237 3300009147 Bacteria 1543
129 Ga0114129_10569540 3300009147 Bacteria 1471
130 Ga0114129_10638308 3300009147 Bacteria 1376
131 Ga0114129_10888712 3300009147 Unclassified 1130
132 Ga0114129_10901104 3300009147 Bacteria 1120
133 Ga0105241_10041450 3300009174 Bacteria 3478
134 Ga0105242_10456462 3300009176 Unclassified 1206
135 Ga0105242_10939412 3300009176 Unclassified 868
136 Ga0105248_10082812 3300009177 Bacteria 3609
137 Ga0105248_10103442 3300009177 Bacteria 3210
138 Ga0105248_10476587 3300009177 Unclassified 1407
139 Ga0105249_10036651 3300009553 Bacteria 4450
140 Ga0105249_11073201 3300009553 Unclassified 875
141 Ga0105239_10164532 3300010375 Bacteria 2480
142 Ga0105246_10223081 3300011119 Bacteria 1479
143 Ga0157371_10317972 3300013102 Unclassified 1129
144 Ga0157370_10023244 3300013104 Bacteria 6156
145 Ga0157370_10329187 3300013104 Unclassified 1409
146 Ga0157374_10006565 3300013296 Bacteria 9877
147 Ga0157374_10280550 3300013296 Bacteria 1645
148 Ga0157378_10037617 3300013297 Bacteria 4288
149 Ga0157378_10268322 3300013297 Bacteria 1640
150 Ga0163162_10002276 3300013306 Bacteria 18015
151 Ga0163162_10019560 3300013306 Bacteria 6646
152 Ga0163162_10166211 3300013306 Bacteria 2330
153 Ga0163162_11148380 3300013306 Bacteria 881
154 Ga0163162_11719876 3300013306 Bacteria 716
155 Ga0163163_10000571 3300014325 Bacteria 32407
156 Ga0157379_10069049 3300014968 Bacteria 3160
157 Ga0157376_10306532 3300014969 Bacteria 1505
158 Ga0157376_11636907 3300014969 Bacteria 678
159 Ga0206349_1918847 3300020075 Bacteria 1139
160 Ga0213874_10049751 3300021377 Bacteria 1282
161 Ga0213876_10000089 3300021384 Bacteria 104386
162 Ga0213876_10002057 3300021384 Bacteria 11922
163 Ga0213876_10020446 3300021384 Bacteria 3498
164 Ga0213876_10204295 3300021384 Unclassified 1050
165 Ga0213876_10340906 3300021384 Bacteria 797
166 Ga0213875_10000008 3300021388 Bacteria 533344
167 Ga0213875_10059822 3300021388 Bacteria 1783
168 Ga0213875_10072472 3300021388 Bacteria 1608
169 Ga0213875_10092024 3300021388 Unclassified 1415
170 Ga0224712_10060835 3300022467 Unclassified 1504
171 Ga0207653_10000120 3300025885 Bacteria 55535
172 Ga0207653_10001073 3300025885 Bacteria 8977
173 Ga0207647_10041576 3300025904 Bacteria 2889
174 Ga0207647_10245787 3300025904 Bacteria 1027
175 Ga0207684_10000295 3300025910 Bacteria 71704
176 Ga0207684_10000388 3300025910 Bacteria 59094
177 Ga0207684_10326737 3300025910 Bacteria 1322
178 Ga0207654_10034355 3300025911 Bacteria 2816
179 Ga0207654_10721323 3300025911 Unclassified 717
180 Ga0207707_10014927 3300025912 Bacteria 6764
181 Ga0207695_10899534 3300025913 Bacteria 765
182 Ga0207693_10110840 3300025915 Bacteria 2152
183 Ga0207663_10000001 3300025916 Bacteria 591990
184 Ga0207663_10557149 3300025916 Bacteria 897
185 Ga0207657_10530285 3300025919 Unclassified 921
186 Ga0207652_10049016 3300025921 Unclassified 3613
187 Ga0207646_10001637 3300025922 Bacteria 27358
188 Ga0207646_10003115 3300025922 Bacteria 19043
189 Ga0207646_10075076 3300025922 Unclassified 3020
190 Ga0207646_10216556 3300025922 Bacteria 1730
191 Ga0207686_10112437 3300025934 Bacteria 1839
192 Ga0207686_10144422 3300025934 Bacteria 1649
193 Ga0207686_10212138 3300025934 Bacteria 1393
194 Ga0207686_10434622 3300025934 Bacteria 1007
195 Ga0207709_10197018 3300025935 Bacteria 1436
196 Ga0207665_10024259 3300025939 Bacteria 3998
197 Ga0207665_10069160 3300025939 Bacteria 2407
198 Ga0207711_10069921 3300025941 Bacteria 3044
199 Ga0207711_10072500 3300025941 Bacteria 2992
200 Ga0207711_10357041 3300025941 Bacteria 1354
201 Ga0207689_10008695 3300025942 Bacteria 8835
202 Ga0207661_10286121 3300025944 Bacteria 1474
203 Ga0207661_10828498 3300025944 Bacteria 852
204 Ga0207667_10197867 3300025949 Bacteria 2062
205 Ga0207712_10026812 3300025961 Unclassified 3843
206 Ga0207712_10553627 3300025961 Bacteria 990
207 Ga0207668_10466480 3300025972 Unclassified 1081
208 Ga0207668_10555643 3300025972 Bacteria 995
209 Ga0207640_10086689 3300025981 Bacteria 2156
210 Ga0207703_10334853 3300026035 Bacteria 1389
211 Ga0207703_10566829 3300026035 Bacteria 1072
212 Ga0207639_10283558 3300026041 Unclassified 1458
213 Ga0207708_10036184 3300026075 Bacteria 3758
214 Ga0207702_10012313 3300026078 Bacteria 7119
215 Ga0207702_10166229 3300026078 Bacteria 2019
216 Ga0207641_10123283 3300026088 Bacteria 2316
217 Ga0207641_10151325 3300026088 Bacteria 2102
218 Ga0207648_10023081 3300026089 Bacteria 5580
219 Ga0207674_10078100 3300026116 Bacteria 3315
220 Ga0207675_100080688 3300026118 Bacteria 3050
221 Ga0207683_10237896 3300026121 Bacteria 1661
222 Ga0268266_10104632 3300028379 Unclassified 2499
223 Ga0268264_10066463 3300028381 Bacteria 3041
224 Ga0268264_10298413 3300028381 Bacteria 1516
225 Ga0307513_10453704 3300031456 Bacteria 1006
226 Ga0373945_0096664 3300035116 Unclassified 1151
227 Ga0373946_0202076 3300035171 Bacteria 952
228 Ga0373942_0127683 3300035207 Unclassified 800
229 Ga0373931_0119495 3300035691 Bacteria 1505
230 Ga0373935_0219774 3300035692 Bacteria 1319
231 Ga0373927_0038546 3300035695 Bacteria 3103
232 Ga0373927_0458295 3300035695 Bacteria 842
233 Ga0373937_0737411 3300036401 Bacteria 932
234 Ga0373925_0084657 3300037068 Unclassified 2416
235 Ga0395899_0228543 3300037312 Bacteria 1286
236 Ga0395900_0092241 3300037418 Bacteria 3112
237 Ga0395900_0659890 3300037418 Unclassified 982
238 Ga0395900_1033391 3300037418 Unclassified 741
239 Ga0395898_0378105 3300037466 Bacteria 1351
240 Ga0395898_0474877 3300037466 Bacteria 1190
241 Ga0395905_0513264 3300037471 Bacteria 1099
242 Ga0436364_0884113 3300037853 Bacteria 1752
243 Ga0436364_1286320 3300037853 Bacteria 4309
244 Ga0436364_1349581 3300037853 Bacteria 3310
245 Ga0436364_1510142 3300037853 Bacteria 4945
246 Ga0395901_0596489 3300038443 Bacteria 1114
247 Ga0395901_1121330 3300038443 Unclassified 756
248 Ga0436365_0163832 3300039437 Unclassified 741
249 Ga0436365_1154095 3300039437 Bacteria 1448
250 Ga0436365_1308485 3300039437 Bacteria 7494
251 Ga0436365_1334083 3300039437 Bacteria 11922
252 Ga0436365_1737637 3300039437 Unclassified 1690
253 Ga0436365_1738066 3300039437 Bacteria 103785
254 Ga0436363_1685371 3300039450 Bacteria 4118
255 Ga0436362_0601279 3300039453 Unclassified 1587
256 Ga0439464_0198825 3300042439 Unclassified 639
257 Ga0451576_1454016 3300045051 Bacteria 713
258 Ga0451576_1559555 3300045051 Unclassified 685
259 Ga0495580_0414013 3300046472 Bacteria 907
260 Ga0496102_0695680 3300048905 Unclassified 940
261 Ga0496106_0385747 3300048909 Unclassified 1126
262 Ga0496109_0000210 3300048912 Bacteria 57283
263 Ga0496110_0428033 3300048913 Bacteria 1207
264 Ga0496114_0120830 3300048917 Bacteria 2253
265 Ga0496115_0086108 3300048918 Bacteria 2564
266 Ga0501041_0411136 3300049577 Unclassified 858
267 Ga0501041_0452000 3300049577 Unclassified 816
268 Ga0501077_0012226 3300049593 Bacteria 5375
269 Ga0501045_0605220 3300049824 Bacteria 811
270 nmdc:mga06z11_185560_c1 3300050494 Unclassified 1201
271 nmdc:mga05p37_148245_c1 3300050507 Bacteria 2872
272 nmdc:mga05p37_181854_c1 3300050507 Bacteria 2557
273 nmdc:mga05p37_28995_c1 3300050507 Bacteria 6754
274 nmdc:mga05p37_530387_c1 3300050507 Unclassified 1345
275 nmdc:mga05p37_570855_c1 3300050507 Unclassified 1283
276 nmdc:mga05p37_943089_c1 3300050507 Unclassified 925
277 nmdc:mga05p37_967745_c1 3300050507 Bacteria 909
278 nmdc:mga09592_810261_c1 3300050508 Bacteria 792
279 nmdc:mga06r32_228008_c1 3300050510 Bacteria 1851
280 nmdc:mga06r32_523940_c1 3300050510 Unclassified 1161
281 nmdc:mga06r32_701603_c1 3300050510 Bacteria 978
282 nmdc:mga08y16_294447_c1 3300050511 Bacteria 1673
283 nmdc:mga08y16_420187_c1 3300050511 Bacteria 1366
284 nmdc:mga08y16_78406_c1 3300050511 Bacteria 3444
285 nmdc:mga0n895_14862_c1 3300050512 Bacteria 7085
286 nmdc:mga0n895_165963_c1 3300050512 Bacteria 2240
287 nmdc:mga0n895_268723_c1 3300050512 Bacteria 1730
288 nmdc:mga0n895_287574_c1 3300050512 Bacteria 1667
289 nmdc:mga0n895_404085_c1 3300050512 Bacteria 1381
290 nmdc:mga0n895_567193_c1 3300050512 Unclassified 1140
291 nmdc:mga0rr50_175121_c1 3300050513 Bacteria 1751
292 nmdc:mga0rr50_181155_c1 3300050513 Bacteria 1722
293 nmdc:mga0rr50_497149_c1 3300050513 Bacteria 1037
294 nmdc:mga0rr50_640041_c1 3300050513 Bacteria 907
295 nmdc:mga08x19_283594_c1 3300050514 Bacteria 1148
296 nmdc:mga08x19_98910_c1 3300050514 Bacteria 1933
297 nmdc:mga0a205_211265_c1 3300050515 Unclassified 1829
298 nmdc:mga0a205_335222_c1 3300050515 Bacteria 1382
299 nmdc:mga0a205_55074_c1 3300050515 Bacteria 3841
300 nmdc:mga0a205_5644_c1 3300050515 Bacteria 11272
301 nmdc:mga0a205_565924_c1 3300050515 Unclassified 991
302 nmdc:mga0a205_582496_c1 3300050515 Bacteria 973
303 nmdc:mga0a205_617689_c1 3300050515 Bacteria 936
304 nmdc:mga0a205_66816_c1 3300050515 Bacteria 3474
305 nmdc:mga0a205_67019_c1 3300050515 Bacteria 3468
306 nmdc:mga0a205_85691_c1 3300050515 Bacteria 3042
307 Ga0500555_086395 3300053103 Bacteria 810
308 Ga0530510_0192052 3300061734 Bacteria 1516
309 Ga0530510_0218131 3300061734 Bacteria 1418
310 Ga0105242_10101016
311 Ga0058863_11864711
312 Ga0058861_11628810
313 Ga0058862_12518384
314 Ga0065704_10024809
315 Ga0065715_10219349
316 Ga0065707_10023214
317 Ga0065707_10052972
318 Ga0065707_10230150
319 Ga0065707_10300151
320 Ga0065707_10399394
321 Ga0065707_10495953
322 Ga0070683_100081929
323 Ga0070690_100226156
324 Ga0070682_100059042
325 Ga0070689_100677530
326 Ga0070692_10068555
327 Ga0070668_100071383
328 Ga0070659_100640444
329 Ga0070709_10608289
330 Ga0070714_101349536
331 Ga0070711_100000001
332 Ga0070700_100194801
333 Ga0070694_100004411
334 Ga0070694_100061860
335 Ga0070708_100054428
336 Ga0070678_100253711
337 Ga0070681_10167203
338 Ga0070681_10551863
339 Ga0070706_100000180
340 Ga0070706_100000252
341 Ga0070706_100311867
342 Ga0070706_101174587
343 Ga0070707_100037318
344 Ga0070707_100159306
345 Ga0070707_100230873
346 Ga0070707_100384161
347 Ga0070698_100042263
348 Ga0070698_100060318
349 Ga0070698_100148314
350 Ga0070698_100270199
351 Ga0070698_100321132
352 Ga0070699_100051163
353 Ga0070699_100300202
354 Ga0070699_100394938
355 Ga0070699_100420467
356 Ga0070679_100060404
357 Ga0070697_100002278
358 Ga0070697_100068950
359 Ga0070697_100089806
360 Ga0070697_100201351
361 Ga0070697_100230015
362 Ga0070697_100260904
363 Ga0070697_100345406
364 Ga0070697_100881380
365 Ga0070697_101042012
366 Ga0068853_100030059
367 Ga0070686_100248414
368 Ga0070695_100205259
369 Ga0070695_100284760
370 Ga0070695_100413429
371 Ga0070696_100077795
372 Ga0070696_100284867
373 Ga0070693_100016974
374 Ga0070693_100039655
375 Ga0070665_100522726
376 Ga0070704_100262021
377 Ga0068855_100006423
378 Ga0068856_100015867
379 Ga0068856_100282018
380 Ga0070702_100290422
381 Ga0068859_100369652
382 Ga0068859_100436773
383 Ga0068864_100194974
384 Ga0068866_10430422
385 Ga0068861_100289178
386 Ga0068863_100054952
387 Ga0068863_100140040
388 Ga0068860_100086309
389 Ga0081455_10017318
390 Ga0081455_10029685
391 Ga0081455_10295585
392 Ga0081455_10295867
393 Ga0081538_10009182
394 Ga0081539_10211339
395 Ga0070715_10021547
396 Ga0070716_100018516
397 Ga0070716_100287777
398 Ga0097621_100271897
399 Ga0075428_100283439
400 Ga0075428_100718881
401 Ga0075431_100056883
402 Ga0075431_100228253
403 Ga0075433_10055418
404 Ga0075433_10138280
405 Ga0075433_10249650
406 Ga0075433_10289302
407 Ga0075433_10456036
408 Ga0075433_10497818
409 Ga0075433_10526958
410 Ga0075433_10680205
411 Ga0075433_11142116
412 Ga0075434_100076296
413 Ga0075434_100100689
414 Ga0075434_100284410
415 Ga0075434_100653717
416 Ga0075434_100809848
417 Ga0075429_100315417
418 Ga0075436_100002889
419 Ga0075436_100596404
420 Ga0075436_100677199
421 Ga0097620_100369636
422 Ga0097620_100436873
423 Ga0075435_100147770
424 Ga0075435_100266436
425 Ga0075435_100477544
426 Ga0075435_100479997
427 Ga0075435_100501428
428 Ga0075435_100945486
429 Ga0105240_10679604
430 Ga0111539_10343772
431 Ga0111539_10447729
432 Ga0111539_10476837
433 Ga0111539_10772593
434 Ga0105247_10313286
435 Ga0114129_10363510
436 Ga0114129_10484318
437 Ga0114129_10525237
438 Ga0114129_10569540
439 Ga0114129_10638308
440 Ga0114129_10888712
441 Ga0114129_10901104
442 Ga0105241_10041450
443 Ga0105242_10456462
444 Ga0105242_10939412
445 Ga0105248_10082812
446 Ga0105248_10103442
447 Ga0105248_10476587
448 Ga0105249_10036651
449 Ga0105249_11073201
450 Ga0105239_10164532
451 Ga0105246_10223081
452 Ga0157371_10317972
453 Ga0157370_10023244
454 Ga0157370_10329187
455 Ga0157374_10006565
456 Ga0157374_10280550
457 Ga0157378_10037617
458 Ga0157378_10268322
459 Ga0163162_10002276
460 Ga0163162_10019560
461 Ga0163162_10166211
462 Ga0163162_11148380
463 Ga0163162_11719876
464 Ga0163163_10000571
465 Ga0157379_10069049
466 Ga0157376_10306532
467 Ga0157376_11636907
468 Ga0206349_1918847
469 Ga0213874_10049751
470 Ga0213876_10000089
471 Ga0213876_10002057
472 Ga0213876_10020446
473 Ga0213876_10204295
474 Ga0213876_10340906
475 Ga0213875_10000008
476 Ga0213875_10059822
477 Ga0213875_10072472
478 Ga0213875_10092024
479 Ga0224712_10060835
480 Ga0207653_10000120
481 Ga0207653_10001073
482 Ga0207647_10041576
483 Ga0207647_10245787
484 Ga0207684_10000295
485 Ga0207684_10000388
486 Ga0207684_10326737
487 Ga0207654_10034355
488 Ga0207654_10721323
489 Ga0207707_10014927
490 Ga0207695_10899534
491 Ga0207693_10110840
492 Ga0207663_10000001
493 Ga0207663_10557149
494 Ga0207657_10530285
495 Ga0207652_10049016
496 Ga0207646_10001637
497 Ga0207646_10003115
498 Ga0207646_10075076
499 Ga0207646_10216556
500 Ga0207686_10112437
501 Ga0207686_10144422
502 Ga0207686_10212138
503 Ga0207686_10434622
504 Ga0207709_10197018
505 Ga0207665_10024259
506 Ga0207665_10069160
507 Ga0207711_10069921
508 Ga0207711_10072500
509 Ga0207711_10357041
510 Ga0207689_10008695
511 Ga0207661_10286121
512 Ga0207661_10828498
513 Ga0207667_10197867
514 Ga0207712_10026812
515 Ga0207712_10553627
516 Ga0207668_10466480
517 Ga0207668_10555643
518 Ga0207640_10086689
519 Ga0207703_10334853
520 Ga0207703_10566829
521 Ga0207639_10283558
522 Ga0207708_10036184
523 Ga0207702_10012313
524 Ga0207702_10166229
525 Ga0207641_10123283
526 Ga0207641_10151325
527 Ga0207648_10023081
528 Ga0207674_10078100
529 Ga0207675_100080688
530 Ga0207683_10237896
531 Ga0268266_10104632
532 Ga0268264_10066463
533 Ga0268264_10298413
534 Ga0307513_10453704
535 Ga0373945_0096664
536 Ga0373946_0202076
537 Ga0373942_0127683
538 Ga0373931_0119495
539 Ga0373935_0219774
540 Ga0373927_0038546
541 Ga0373927_0458295
542 Ga0373937_0737411
543 Ga0373925_0084657
544 Ga0395899_0228543
545 Ga0395900_0092241
546 Ga0395900_0659890
547 Ga0395900_1033391
548 Ga0395898_0378105
549 Ga0395898_0474877
550 Ga0395905_0513264
551 Ga0436364_0884113
552 Ga0436364_1286320
553 Ga0436364_1349581
554 Ga0436364_1510142
555 Ga0395901_0596489
556 Ga0395901_1121330
557 Ga0436365_0163832
558 Ga0436365_1154095
559 Ga0436365_1308485
560 Ga0436365_1334083
561 Ga0436365_1737637
562 Ga0436365_1738066
563 Ga0436363_1685371
564 Ga0436362_0601279
565 Ga0439464_0198825
566 Ga0451576_1454016
567 Ga0451576_1559555
568 Ga0495580_0414013
569 Ga0496102_0695680
570 Ga0496106_0385747
571 Ga0496109_0000210
572 Ga0496110_0428033
573 Ga0496114_0120830
574 Ga0496115_0086108
575 Ga0501041_0411136
576 Ga0501041_0452000
577 Ga0501077_0012226
578 Ga0501045_0605220
579 nmdc:mga06z11_185560_c1
580 nmdc:mga05p37_148245_c1
581 nmdc:mga05p37_181854_c1
582 nmdc:mga05p37_28995_c1
583 nmdc:mga05p37_530387_c1
584 nmdc:mga05p37_570855_c1
585 nmdc:mga05p37_943089_c1
586 nmdc:mga05p37_967745_c1
587 nmdc:mga09592_810261_c1
588 nmdc:mga06r32_228008_c1
589 nmdc:mga06r32_523940_c1
590 nmdc:mga06r32_701603_c1
591 nmdc:mga08y16_294447_c1
592 nmdc:mga08y16_420187_c1
593 nmdc:mga08y16_78406_c1
594 nmdc:mga0n895_14862_c1
595 nmdc:mga0n895_165963_c1
596 nmdc:mga0n895_268723_c1
597 nmdc:mga0n895_287574_c1
598 nmdc:mga0n895_404085_c1
599 nmdc:mga0n895_567193_c1
600 nmdc:mga0rr50_175121_c1
601 nmdc:mga0rr50_181155_c1
602 nmdc:mga0rr50_497149_c1
603 nmdc:mga0rr50_640041_c1
604 nmdc:mga08x19_283594_c1
605 nmdc:mga08x19_98910_c1
606 nmdc:mga0a205_211265_c1
607 nmdc:mga0a205_335222_c1
608 nmdc:mga0a205_55074_c1
609 nmdc:mga0a205_5644_c1
610 nmdc:mga0a205_565924_c1
611 nmdc:mga0a205_582496_c1
612 nmdc:mga0a205_617689_c1
613 nmdc:mga0a205_66816_c1
614 nmdc:mga0a205_67019_c1
615 nmdc:mga0a205_85691_c1
616 Ga0500555_086395
617 Ga0530510_0192052
618 Ga0530510_0218131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

30

212

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k3w-assembly1.cif.gz_A nmr structure of vps4a-mit-chmp6 0.9596 67 102
6a09-assembly1.cif.gz_A salmonella typhi yfdx in the p222 space group 0.9596 67 101
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9494 65 101
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.9444 19 195
3dza-assembly1.cif.gz_C crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution 0.9408 66 101
ID Description Score Start End Superfamily
af_D4AAT5_44_122_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9704 67 106 1.20.58.80
af_Q96S38_234_311_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9653 67 106 1.20.58.80
2k3wA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9596 67 102 1.20.58.80
af_Q95Q05_3_79_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9487 64 106 1.20.58.80
af_E7FF70_1_79_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9451 64 106 1.20.58.80
ID Description Score Start End GO Terms
AF-A0A2V7HUW9-F1-model_v4 Heme-copper oxidase subunit III 0.9813 15 196 GO:0004129
GO:0005886
GO:0019646
AF-A0A3N5GNS2-F1-model_v4 Heme-copper oxidase subunit III 0.9793 24 196 GO:0004129
GO:0005886
GO:0019646
AF-A0A2V7HUW9-F1-model_v4 Heme-copper oxidase subunit III 0.976 15 196 GO:0004129
GO:0005886
GO:0019646
AF-A0A2V6ZEC3-F1-model_v4 Heme-copper oxidase subunit III 0.9723 42 196 GO:0004129
GO:0005886
GO:0019646
AF-A0A2W1B516-F1-model_v4 Cytochrome c oxidase subunit 3/cytochrome o ubiquinol oxidase subunit 3 0.9717 76 196 GO:0004129
GO:0005886
GO:0019646

Map