F400192

General Info

Members Datasets Scaffolds Average Seq Length
309 209 618 296

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10100722|Ga0105242_101007222
Length 337
Sequence MALSTETEVTGGVSGGPTHVVPTGAALGATVKGVDLKDLEEVAFARIMQAWRDHLVLLFRDQTLSDHELIAFSRRLGDLDWAPIQETGRRFVEGLPEIYIVSNVKVNGEPIGSLGDGEAVWHTDMSYLDLPPKASMLYSLEIPSSGGNTCFCSMYAIYDALPGELKERIAGLKIKHDGTYNSGGYVRQGVTPTDDPRTSPGAVHPLVCTHPDTGKRMLYLGRRRNAYITGLDPADSEALLNELWSYAVLPQFAWEHVWRVGDLVLWDNRCTMHRREDGPAYHLPDVPDPLCGSGQHLDGRPAHQSGPRLEQYPTWPSVFGVRLSVRAVPADRWLFRR

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 4.53
Rhizosphere 91.59
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10100722 3300009176 Bacteria 2447
2 JGI24746J21847_1011066 3300001977 Bacteria 1329
3 JGI25404J52841_10012866 3300003659 Bacteria 1815
4 Ga0065715_10007010 3300005293 Bacteria 4773
5 Ga0070658_10407002 3300005327 Bacteria 1169
6 Ga0070676_10035645 3300005328 Bacteria 2862
7 Ga0070676_10108622 3300005328 Bacteria 1724
8 Ga0070676_10232449 3300005328 Bacteria 1223
9 Ga0070690_100007644 3300005330 Bacteria 6193
10 Ga0070670_100011979 3300005331 Bacteria 7418
11 Ga0070666_10044289 3300005335 Bacteria 2980
12 Ga0068868_100058735 3300005338 Bacteria 3041
13 Ga0070689_100127281 3300005340 Bacteria 2039
14 Ga0070691_10015235 3300005341 Bacteria 3532
15 Ga0070668_100126103 3300005347 Bacteria 2051
16 Ga0070669_100018370 3300005353 Bacteria 4997
17 Ga0070669_100022785 3300005353 Bacteria 4479
18 Ga0070671_100066237 3300005355 Bacteria 3010
19 Ga0070674_100000362 3300005356 Bacteria 22689
20 Ga0070674_100090880 3300005356 Bacteria 2203
21 Ga0070688_100028813 3300005365 Bacteria 3319
22 Ga0070659_100267251 3300005366 Bacteria 1420
23 Ga0070667_100322607 3300005367 Bacteria 1394
24 Ga0070709_10218142 3300005434 Bacteria 1359
25 Ga0070713_100001356 3300005436 Bacteria 15660
26 Ga0070713_100009048 3300005436 Bacteria 7102
27 Ga0070713_100153303 3300005436 Bacteria 2052
28 Ga0070713_100169487 3300005436 Bacteria 1955
29 Ga0070713_100219133 3300005436 Bacteria 1726
30 Ga0070700_100004922 3300005441 Bacteria 7022
31 Ga0070694_100064596 3300005444 Bacteria 2505
32 Ga0070678_100210218 3300005456 Bacteria 1612
33 Ga0068867_100010155 3300005459 Bacteria 6640
34 Ga0070685_10067264 3300005466 Bacteria 2113
35 Ga0070679_100035036 3300005530 Bacteria 4978
36 Ga0070684_100027298 3300005535 Bacteria 4816
37 Ga0070672_100032292 3300005543 Bacteria 3949
38 Ga0070696_100042580 3300005546 Bacteria 3139
39 Ga0070665_100412432 3300005548 Bacteria 1359
40 Ga0070665_100501866 3300005548 Bacteria 1224
41 Ga0070704_100030303 3300005549 Bacteria 3623
42 Ga0068855_100488686 3300005563 Bacteria 1339
43 Ga0070664_100000189 3300005564 Bacteria 43405
44 Ga0070664_100134179 3300005564 Bacteria 2176
45 Ga0068854_100010060 3300005578 Bacteria 6125
46 Ga0068854_100018302 3300005578 Bacteria 4701
47 Ga0068856_100146295 3300005614 Unclassified 2371
48 Ga0070702_100056858 3300005615 Bacteria 2261
49 Ga0068859_100020410 3300005617 Bacteria 6650
50 Ga0068861_100011888 3300005719 Bacteria 6062
51 Ga0068870_10077900 3300005840 Unclassified 1825
52 Ga0068863_100021764 3300005841 Bacteria 6117
53 Ga0068858_100036822 3300005842 Bacteria 4536
54 Ga0068860_100019048 3300005843 Bacteria 6664
55 Ga0081455_10003524 3300005937 Bacteria 17968
56 Ga0081455_10030453 3300005937 Bacteria 4900
57 Ga0081540_1005263 3300005983 Bacteria 9684
58 Ga0081540_1007601 3300005983 Bacteria 7696
59 Ga0081540_1039162 3300005983 Bacteria 2488
60 Ga0081540_1048527 3300005983 Bacteria 2126
61 Ga0070717_10020297 3300006028 Bacteria 5223
62 Ga0070716_100064608 3300006173 Bacteria 2129
63 Ga0097621_100227758 3300006237 Bacteria 1627
64 Ga0075428_100010733 3300006844 Bacteria 10182
65 Ga0075430_100021270 3300006846 Archaea 5516
66 Ga0075430_100137351 3300006846 Unclassified 2036
67 Ga0075431_100027355 3300006847 Bacteria 5850
68 Ga0075431_100108103 3300006847 Unclassified 2870
69 Ga0075431_100215398 3300006847 Unclassified 1960
70 Ga0075431_100383996 3300006847 Archaea 1408
71 Ga0075433_10003029 3300006852 Bacteria 12909
72 Ga0075429_100021915 3300006880 Bacteria 5538
73 Ga0075429_100024215 3300006880 Bacteria 5266
74 Ga0075429_100030358 3300006880 Unclassified 4695
75 Ga0075429_100051528 3300006880 Bacteria 3581
76 Ga0097620_100020413 3300006931 Bacteria 6650
77 Ga0099794_10024053 3300007265 Unclassified 2792
78 Ga0099795_10135156 3300007788 Unclassified 998
79 Ga0105240_10004221 3300009093 Bacteria 21968
80 Ga0105240_10239913 3300009093 Bacteria 2102
81 Ga0111539_10003332 3300009094 Bacteria 21215
82 Ga0111539_10046868 3300009094 Bacteria 5169
83 Ga0111539_10048044 3300009094 Bacteria 5097
84 Ga0105245_10014215 3300009098 Bacteria 6937
85 Ga0105245_10075835 3300009098 Bacteria 3062
86 Ga0105245_10186042 3300009098 Bacteria 1987
87 Ga0105245_10640851 3300009098 Bacteria 1092
88 Ga0114129_10074692 3300009147 Bacteria 4722
89 Ga0114129_10155562 3300009147 Bacteria 3127
90 Ga0105241_10045508 3300009174 Bacteria 3330
91 Ga0105241_10102660 3300009174 Bacteria 2276
92 Ga0105241_10110337 3300009174 Bacteria 2201
93 Ga0105242_10014813 3300009176 Bacteria 6039
94 Ga0105248_10248468 3300009177 Bacteria 2002
95 Ga0105248_10277916 3300009177 Bacteria 1885
96 Ga0105237_10001227 3300009545 Bacteria 34155
97 Ga0105238_10024619 3300009551 Bacteria 6135
98 Ga0105249_10000467 3300009553 Bacteria 37604
99 Ga0105249_10476369 3300009553 Bacteria 1290
100 Ga0105239_10002770 3300010375 Bacteria 21983
101 Ga0157371_10194868 3300013102 Unclassified 1451
102 Ga0157369_10030646 3300013105 Bacteria 5931
103 Ga0157374_10071794 3300013296 Bacteria 3265
104 Ga0157374_10125521 3300013296 Bacteria 2480
105 Ga0157374_10466379 3300013296 Bacteria 1265
106 Ga0157378_10189164 3300013297 Bacteria 1941
107 Ga0157378_10191529 3300013297 Bacteria 1929
108 Ga0163162_10124595 3300013306 Bacteria 2682
109 Ga0157375_10281136 3300013308 Bacteria 1827
110 Ga0157375_10348556 3300013308 Bacteria 1647
111 Ga0163163_10201268 3300014325 Bacteria 2040
112 Ga0163163_10389175 3300014325 Bacteria 1452
113 Ga0157380_10545878 3300014326 Bacteria 1136
114 Ga0157377_10003174 3300014745 Bacteria 7411
115 Ga0157379_10063750 3300014968 Bacteria 3294
116 Ga0157379_10114169 3300014968 Bacteria 2428
117 Ga0157379_10496035 3300014968 Bacteria 1131
118 Ga0163161_10175109 3300017792 Bacteria 1642
119 Ga0213875_10004418 3300021388 Bacteria 7720
120 Ga0207697_10001688 3300025315 Bacteria 11901
121 Ga0207688_10009769 3300025901 Bacteria 5223
122 Ga0207680_10026643 3300025903 Bacteria 3207
123 Ga0207647_10025707 3300025904 Bacteria 3863
124 Ga0207685_10083599 3300025905 Bacteria 1327
125 Ga0207699_10046140 3300025906 Bacteria 2547
126 Ga0207645_10003006 3300025907 Bacteria 13026
127 Ga0207645_10004949 3300025907 Bacteria 9767
128 Ga0207643_10003269 3300025908 Bacteria 8752
129 Ga0207643_10003840 3300025908 Bacteria 8082
130 Ga0207654_10124725 3300025911 Bacteria 1622
131 Ga0207707_10017644 3300025912 Bacteria 6226
132 Ga0207695_10000516 3300025913 Bacteria 81914
133 Ga0207695_10133443 3300025913 Bacteria 2438
134 Ga0207671_10001369 3300025914 Bacteria 28369
135 Ga0207693_10080614 3300025915 Bacteria 2548
136 Ga0207693_10315527 3300025915 Unclassified 1224
137 Ga0207662_10332727 3300025918 Bacteria 1016
138 Ga0207652_10031460 3300025921 Bacteria 4457
139 Ga0207652_10250112 3300025921 Bacteria 1598
140 Ga0207681_10033499 3300025923 Bacteria 3368
141 Ga0207681_10090617 3300025923 Bacteria 2183
142 Ga0207681_10299178 3300025923 Bacteria 1272
143 Ga0207650_10070340 3300025925 Bacteria 2630
144 Ga0207650_10144002 3300025925 Unclassified 1876
145 Ga0207650_10177760 3300025925 Bacteria 1695
146 Ga0207659_10025382 3300025926 Bacteria 3981
147 Ga0207687_10147611 3300025927 Bacteria 1791
148 Ga0207700_10045623 3300025928 Unclassified 3235
149 Ga0207700_10102519 3300025928 Unclassified 2286
150 Ga0207644_10126401 3300025931 Bacteria 1952
151 Ga0207706_10080791 3300025933 Bacteria 2858
152 Ga0207686_10128387 3300025934 Bacteria 1736
153 Ga0207686_10386886 3300025934 Bacteria 1062
154 Ga0207709_10066039 3300025935 Bacteria 2277
155 Ga0207670_10112616 3300025936 Bacteria 1964
156 Ga0207669_10024711 3300025937 Bacteria 3234
157 Ga0207704_10057063 3300025938 Bacteria 2396
158 Ga0207665_10033113 3300025939 Bacteria 3424
159 Ga0207665_10100374 3300025939 Bacteria 2020
160 Ga0207665_10169445 3300025939 Bacteria 1576
161 Ga0207691_10016147 3300025940 Bacteria 7093
162 Ga0207691_10044447 3300025940 Bacteria 4089
163 Ga0207691_10268947 3300025940 Bacteria 1468
164 Ga0207711_10034821 3300025941 Bacteria 4265
165 Ga0207689_10055063 3300025942 Unclassified 3274
166 Ga0207689_10298482 3300025942 Bacteria 1335
167 Ga0207679_10545105 3300025945 Bacteria 1040
168 Ga0207667_10637498 3300025949 Bacteria 1072
169 Ga0207712_10020006 3300025961 Bacteria 4379
170 Ga0207668_10063611 3300025972 Bacteria 2604
171 Ga0207640_10009061 3300025981 Bacteria 5555
172 Ga0207640_10018001 3300025981 Bacteria 4144
173 Ga0207640_10131176 3300025981 Bacteria 1812
174 Ga0207658_10090074 3300025986 Bacteria 2376
175 Ga0207677_10078449 3300026023 Bacteria 2358
176 Ga0207677_10203191 3300026023 Bacteria 1576
177 Ga0207703_10020375 3300026035 Bacteria 5186
178 Ga0207639_10063544 3300026041 Bacteria 2859
179 Ga0207678_10171551 3300026067 Bacteria 1852
180 Ga0207708_10006566 3300026075 Bacteria 8607
181 Ga0207641_10007963 3300026088 Bacteria 8781
182 Ga0207648_10020698 3300026089 Bacteria 5921
183 Ga0207648_10563567 3300026089 Bacteria 1047
184 Ga0207674_10113756 3300026116 Bacteria 2679
185 Ga0207674_10114423 3300026116 Bacteria 2670
186 Ga0207674_10119662 3300026116 Bacteria 2602
187 Ga0207675_100003899 3300026118 Bacteria 14505
188 Ga0207675_100286536 3300026118 Bacteria 1601
189 Ga0207683_10026347 3300026121 Bacteria 5018
190 Ga0207683_10154764 3300026121 Bacteria 2070
191 Ga0209588_1016221 3300027671 Unclassified 2297
192 Ga0207428_10000698 3300027907 Bacteria 39012
193 Ga0207428_10019839 3300027907 Bacteria 5726
194 Ga0207428_10040589 3300027907 Bacteria 3773
195 Ga0268265_10167414 3300028380 Bacteria 1874
196 Ga0268265_10192725 3300028380 Bacteria 1762
197 Ga0268264_10083491 3300028381 Bacteria 2737
198 Ga0265338_10142767 3300028800 Bacteria 1873
199 Ga0265760_10097636 3300031090 Bacteria 926
200 Ga0265328_10026954 3300031239 Bacteria 2157
201 Ga0265339_10191299 3300031249 Bacteria 1014
202 Ga0373923_0048511 3300035111 Bacteria 1773
203 Ga0373945_0026425 3300035116 Bacteria 2022
204 Ga0373954_0021620 3300035118 Bacteria 2914
205 Ga0373943_0005806 3300035170 Bacteria 5545
206 Ga0373943_0119393 3300035170 Bacteria 1400
207 Ga0373946_0027692 3300035171 Bacteria 2244
208 Ga0373935_0040645 3300035692 Bacteria 2919
209 Ga0373927_0041888 3300035695 Bacteria 2969
210 Ga0373937_0029119 3300036401 Bacteria 5001
211 Ga0373925_0155871 3300037068 Bacteria 1796
212 Ga0373925_0186520 3300037068 Bacteria 1644
213 Ga0436364_0361985 3300037853 Bacteria 1976
214 Ga0436364_1399163 3300037853 Bacteria 35053
215 Ga0436364_1543365 3300037853 Unclassified 2969
216 Ga0395901_0232744 3300038443 Bacteria 1923
217 Ga0436360_0269915 3300039438 Bacteria 2161
218 Ga0495617_051612 3300046452 Bacteria 1367
219 Ga0495592_0086552 3300046454 Bacteria 2256
220 Ga0495592_0102738 3300046454 Bacteria 2035
221 Ga0495629_0055757 3300046459 Bacteria 2764
222 Ga0495638_0090622 3300046460 Bacteria 1843
223 Ga0495641_0036851 3300046461 Bacteria 2296
224 Ga0495651_0000153 3300046462 Bacteria 50701
225 Ga0495653_0249330 3300046463 Bacteria 1179
226 Ga0495580_0028954 3300046472 Bacteria 4023
227 Ga0495580_0211157 3300046472 Bacteria 1336
228 Ga0495639_0136906 3300046475 Bacteria 1175
229 Ga0495662_0025303 3300046476 Bacteria 2866
230 Ga0495664_0067774 3300046477 Bacteria 2129
231 Ga0495608_0003267 3300046511 Bacteria 11580
232 Ga0495608_0068616 3300046511 Bacteria 2318
233 Ga0495608_0149514 3300046511 Bacteria 1489
234 Ga0495618_0146788 3300046514 Bacteria 1508
235 Ga0495630_0005667 3300046517 Bacteria 8827
236 Ga0495630_0134798 3300046517 Bacteria 1876
237 Ga0495644_0077842 3300046523 Bacteria 1249
238 Ga0495663_0032791 3300046525 Bacteria 1548
239 Ga0495652_0015402 3300046529 Bacteria 6848
240 Ga0495652_0349192 3300046529 Bacteria 1060
241 Ga0495640_0031785 3300046533 Bacteria 3766
242 Ga0495645_0158916 3300046543 Bacteria 1564
243 Ga0495633_0192265 3300046558 Bacteria 938
244 Ga0495656_0040126 3300046615 Bacteria 1949
245 Ga0495656_0079837 3300046615 Bacteria 1474
246 Ga0495634_0025544 3300046642 Bacteria 4131
247 Ga0495611_0099371 3300046648 Bacteria 1350
248 Ga0495635_0132643 3300046663 Bacteria 1698
249 Ga0495635_0225722 3300046663 Bacteria 1266
250 Ga0495657_0051256 3300046675 Bacteria 2771
251 Ga0495624_0016773 3300046690 Bacteria 4929
252 Ga0495670_0126734 3300046691 Bacteria 1329
253 Ga0495671_0072635 3300046692 Bacteria 1689
254 Ga0495604_0012453 3300047317 Bacteria 6764
255 Ga0495674_0047352 3300047319 Bacteria 3813
256 Ga0495674_0111063 3300047319 Bacteria 2324
257 Ga0495674_0140293 3300047319 Bacteria 2032
258 Ga0495674_0180548 3300047319 Bacteria 1758
259 Ga0495676_0159193 3300047321 Bacteria 1599
260 Ga0495680_0000715 3300047322 Bacteria 37324
261 Ga0495680_0030183 3300047322 Unclassified 4429
262 Ga0495675_0008215 3300047444 Bacteria 6458
263 Ga0495675_0149461 3300047444 Bacteria 1443
264 Ga0495677_0052732 3300047445 Bacteria 1499
265 Ga0495684_0000691 3300047471 Bacteria 27167
266 Ga0495684_0295237 3300047471 Bacteria 1165
267 Ga0495593_0020350 3300047673 Bacteria 3717
268 Ga0495614_0014596 3300048089 Bacteria 3435
269 Ga0496101_0310286 3300048904 Bacteria 1236
270 Ga0496103_0267605 3300048906 Bacteria 1099
271 Ga0496104_0061315 3300048907 Bacteria 3565
272 Ga0496105_0057607 3300048908 Bacteria 3207
273 Ga0496106_0198907 3300048909 Bacteria 1594
274 Ga0496106_0349882 3300048909 Bacteria 1187
275 Ga0496107_0323562 3300048910 Bacteria 1147
276 Ga0496108_0493747 3300048911 Bacteria 1069
277 Ga0496109_0034982 3300048912 Bacteria 4528
278 Ga0496109_0518924 3300048912 Bacteria 1124
279 Ga0496110_0144721 3300048913 Bacteria 2149
280 Ga0496112_0293915 3300048915 Bacteria 1570
281 Ga0496114_0196350 3300048917 Bacteria 1766
282 Ga0496115_0020018 3300048918 Bacteria 5155
283 Ga0496118_0008390 3300048921 Bacteria 10687
284 Ga0496119_0069752 3300048922 Bacteria 2065
285 Ga0496121_0000949 3300048924 Bacteria 52413
286 Ga0496121_0019955 3300048924 Bacteria 6668
287 Ga0496121_0048930 3300048924 Bacteria 3591
288 Ga0496126_0022918 3300048929 Bacteria 6063
289 nmdc:mga05p37_128506_c1 3300050507 Unclassified 3111
290 nmdc:mga05p37_151197_c1 3300050507 Bacteria 2839
291 nmdc:mga05p37_485051_c1 3300050507 Bacteria 1422
292 nmdc:mga05p37_92473_c1 3300050507 Bacteria 3727
293 nmdc:mga09592_27495_c1 3300050508 Unclassified 4720
294 nmdc:mga09592_39335_c1 3300050508 Bacteria 3972
295 nmdc:mga0qj67_16218_c1 3300050509 Bacteria 5646
296 nmdc:mga0qj67_38353_c1 3300050509 Unclassified 3759
297 nmdc:mga0qj67_87049_c1 3300050509 Unclassified 2507
298 nmdc:mga06r32_18213_c1 3300050510 Bacteria 6426
299 nmdc:mga06r32_36471_c1 3300050510 Bacteria 4646
300 nmdc:mga06r32_445136_c1 3300050510 Bacteria 1275
301 nmdc:mga08y16_24093_c1 3300050511 Bacteria 6428
302 nmdc:mga08y16_26592_c1 3300050511 Bacteria 6100
303 nmdc:mga0n895_27797_c1 3300050512 Bacteria 5376
304 nmdc:mga0rr50_149064_c1 3300050513 Bacteria 1888
305 nmdc:mga0a205_525444_c1 3300050515 Bacteria 1040
306 nmdc:mga0a205_6587_c1 3300050515 Bacteria 10505
307 Ga0495612_0025242 3300053078 Bacteria 2386
308 Ga0500595_006158 3300053119 Bacteria 5132
309 Ga0500637_0093692 3300053178 Bacteria 1740
310 Ga0105242_10100722
311 JGI24746J21847_1011066
312 JGI25404J52841_10012866
313 Ga0065715_10007010
314 Ga0070658_10407002
315 Ga0070676_10035645
316 Ga0070676_10108622
317 Ga0070676_10232449
318 Ga0070690_100007644
319 Ga0070670_100011979
320 Ga0070666_10044289
321 Ga0068868_100058735
322 Ga0070689_100127281
323 Ga0070691_10015235
324 Ga0070668_100126103
325 Ga0070669_100018370
326 Ga0070669_100022785
327 Ga0070671_100066237
328 Ga0070674_100000362
329 Ga0070674_100090880
330 Ga0070688_100028813
331 Ga0070659_100267251
332 Ga0070667_100322607
333 Ga0070709_10218142
334 Ga0070713_100001356
335 Ga0070713_100009048
336 Ga0070713_100153303
337 Ga0070713_100169487
338 Ga0070713_100219133
339 Ga0070700_100004922
340 Ga0070694_100064596
341 Ga0070678_100210218
342 Ga0068867_100010155
343 Ga0070685_10067264
344 Ga0070679_100035036
345 Ga0070684_100027298
346 Ga0070672_100032292
347 Ga0070696_100042580
348 Ga0070665_100412432
349 Ga0070665_100501866
350 Ga0070704_100030303
351 Ga0068855_100488686
352 Ga0070664_100000189
353 Ga0070664_100134179
354 Ga0068854_100010060
355 Ga0068854_100018302
356 Ga0068856_100146295
357 Ga0070702_100056858
358 Ga0068859_100020410
359 Ga0068861_100011888
360 Ga0068870_10077900
361 Ga0068863_100021764
362 Ga0068858_100036822
363 Ga0068860_100019048
364 Ga0081455_10003524
365 Ga0081455_10030453
366 Ga0081540_1005263
367 Ga0081540_1007601
368 Ga0081540_1039162
369 Ga0081540_1048527
370 Ga0070717_10020297
371 Ga0070716_100064608
372 Ga0097621_100227758
373 Ga0075428_100010733
374 Ga0075430_100021270
375 Ga0075430_100137351
376 Ga0075431_100027355
377 Ga0075431_100108103
378 Ga0075431_100215398
379 Ga0075431_100383996
380 Ga0075433_10003029
381 Ga0075429_100021915
382 Ga0075429_100024215
383 Ga0075429_100030358
384 Ga0075429_100051528
385 Ga0097620_100020413
386 Ga0099794_10024053
387 Ga0099795_10135156
388 Ga0105240_10004221
389 Ga0105240_10239913
390 Ga0111539_10003332
391 Ga0111539_10046868
392 Ga0111539_10048044
393 Ga0105245_10014215
394 Ga0105245_10075835
395 Ga0105245_10186042
396 Ga0105245_10640851
397 Ga0114129_10074692
398 Ga0114129_10155562
399 Ga0105241_10045508
400 Ga0105241_10102660
401 Ga0105241_10110337
402 Ga0105242_10014813
403 Ga0105248_10248468
404 Ga0105248_10277916
405 Ga0105237_10001227
406 Ga0105238_10024619
407 Ga0105249_10000467
408 Ga0105249_10476369
409 Ga0105239_10002770
410 Ga0157371_10194868
411 Ga0157369_10030646
412 Ga0157374_10071794
413 Ga0157374_10125521
414 Ga0157374_10466379
415 Ga0157378_10189164
416 Ga0157378_10191529
417 Ga0163162_10124595
418 Ga0157375_10281136
419 Ga0157375_10348556
420 Ga0163163_10201268
421 Ga0163163_10389175
422 Ga0157380_10545878
423 Ga0157377_10003174
424 Ga0157379_10063750
425 Ga0157379_10114169
426 Ga0157379_10496035
427 Ga0163161_10175109
428 Ga0213875_10004418
429 Ga0207697_10001688
430 Ga0207688_10009769
431 Ga0207680_10026643
432 Ga0207647_10025707
433 Ga0207685_10083599
434 Ga0207699_10046140
435 Ga0207645_10003006
436 Ga0207645_10004949
437 Ga0207643_10003269
438 Ga0207643_10003840
439 Ga0207654_10124725
440 Ga0207707_10017644
441 Ga0207695_10000516
442 Ga0207695_10133443
443 Ga0207671_10001369
444 Ga0207693_10080614
445 Ga0207693_10315527
446 Ga0207662_10332727
447 Ga0207652_10031460
448 Ga0207652_10250112
449 Ga0207681_10033499
450 Ga0207681_10090617
451 Ga0207681_10299178
452 Ga0207650_10070340
453 Ga0207650_10144002
454 Ga0207650_10177760
455 Ga0207659_10025382
456 Ga0207687_10147611
457 Ga0207700_10045623
458 Ga0207700_10102519
459 Ga0207644_10126401
460 Ga0207706_10080791
461 Ga0207686_10128387
462 Ga0207686_10386886
463 Ga0207709_10066039
464 Ga0207670_10112616
465 Ga0207669_10024711
466 Ga0207704_10057063
467 Ga0207665_10033113
468 Ga0207665_10100374
469 Ga0207665_10169445
470 Ga0207691_10016147
471 Ga0207691_10044447
472 Ga0207691_10268947
473 Ga0207711_10034821
474 Ga0207689_10055063
475 Ga0207689_10298482
476 Ga0207679_10545105
477 Ga0207667_10637498
478 Ga0207712_10020006
479 Ga0207668_10063611
480 Ga0207640_10009061
481 Ga0207640_10018001
482 Ga0207640_10131176
483 Ga0207658_10090074
484 Ga0207677_10078449
485 Ga0207677_10203191
486 Ga0207703_10020375
487 Ga0207639_10063544
488 Ga0207678_10171551
489 Ga0207708_10006566
490 Ga0207641_10007963
491 Ga0207648_10020698
492 Ga0207648_10563567
493 Ga0207674_10113756
494 Ga0207674_10114423
495 Ga0207674_10119662
496 Ga0207675_100003899
497 Ga0207675_100286536
498 Ga0207683_10026347
499 Ga0207683_10154764
500 Ga0209588_1016221
501 Ga0207428_10000698
502 Ga0207428_10019839
503 Ga0207428_10040589
504 Ga0268265_10167414
505 Ga0268265_10192725
506 Ga0268264_10083491
507 Ga0265338_10142767
508 Ga0265760_10097636
509 Ga0265328_10026954
510 Ga0265339_10191299
511 Ga0373923_0048511
512 Ga0373945_0026425
513 Ga0373954_0021620
514 Ga0373943_0005806
515 Ga0373943_0119393
516 Ga0373946_0027692
517 Ga0373935_0040645
518 Ga0373927_0041888
519 Ga0373937_0029119
520 Ga0373925_0155871
521 Ga0373925_0186520
522 Ga0436364_0361985
523 Ga0436364_1399163
524 Ga0436364_1543365
525 Ga0395901_0232744
526 Ga0436360_0269915
527 Ga0495617_051612
528 Ga0495592_0086552
529 Ga0495592_0102738
530 Ga0495629_0055757
531 Ga0495638_0090622
532 Ga0495641_0036851
533 Ga0495651_0000153
534 Ga0495653_0249330
535 Ga0495580_0028954
536 Ga0495580_0211157
537 Ga0495639_0136906
538 Ga0495662_0025303
539 Ga0495664_0067774
540 Ga0495608_0003267
541 Ga0495608_0068616
542 Ga0495608_0149514
543 Ga0495618_0146788
544 Ga0495630_0005667
545 Ga0495630_0134798
546 Ga0495644_0077842
547 Ga0495663_0032791
548 Ga0495652_0015402
549 Ga0495652_0349192
550 Ga0495640_0031785
551 Ga0495645_0158916
552 Ga0495633_0192265
553 Ga0495656_0040126
554 Ga0495656_0079837
555 Ga0495634_0025544
556 Ga0495611_0099371
557 Ga0495635_0132643
558 Ga0495635_0225722
559 Ga0495657_0051256
560 Ga0495624_0016773
561 Ga0495670_0126734
562 Ga0495671_0072635
563 Ga0495604_0012453
564 Ga0495674_0047352
565 Ga0495674_0111063
566 Ga0495674_0140293
567 Ga0495674_0180548
568 Ga0495676_0159193
569 Ga0495680_0000715
570 Ga0495680_0030183
571 Ga0495675_0008215
572 Ga0495675_0149461
573 Ga0495677_0052732
574 Ga0495684_0000691
575 Ga0495684_0295237
576 Ga0495593_0020350
577 Ga0495614_0014596
578 Ga0496101_0310286
579 Ga0496103_0267605
580 Ga0496104_0061315
581 Ga0496105_0057607
582 Ga0496106_0198907
583 Ga0496106_0349882
584 Ga0496107_0323562
585 Ga0496108_0493747
586 Ga0496109_0034982
587 Ga0496109_0518924
588 Ga0496110_0144721
589 Ga0496112_0293915
590 Ga0496114_0196350
591 Ga0496115_0020018
592 Ga0496118_0008390
593 Ga0496119_0069752
594 Ga0496121_0000949
595 Ga0496121_0019955
596 Ga0496121_0048930
597 Ga0496126_0022918
598 nmdc:mga05p37_128506_c1
599 nmdc:mga05p37_151197_c1
600 nmdc:mga05p37_485051_c1
601 nmdc:mga05p37_92473_c1
602 nmdc:mga09592_27495_c1
603 nmdc:mga09592_39335_c1
604 nmdc:mga0qj67_16218_c1
605 nmdc:mga0qj67_38353_c1
606 nmdc:mga0qj67_87049_c1
607 nmdc:mga06r32_18213_c1
608 nmdc:mga06r32_36471_c1
609 nmdc:mga06r32_445136_c1
610 nmdc:mga08y16_24093_c1
611 nmdc:mga08y16_26592_c1
612 nmdc:mga0n895_27797_c1
613 nmdc:mga0rr50_149064_c1
614 nmdc:mga0a205_525444_c1
615 nmdc:mga0a205_6587_c1
616 Ga0495612_0025242
617 Ga0500595_006158
618 Ga0500637_0093692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

19

284

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vz5-assembly1.cif.gz_C succinate complex of atsk 0.9263 20 293
1oij-assembly4.cif.gz_D crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9235 20 293
1oij-assembly3.cif.gz_C crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9209 20 293
8evn-assembly1.cif.gz_D sulfatase from mycobacterium tuberculosis (rv3406) in complex with n-oxalylglycine (nog) 0.9185 21 293
1oih-assembly1.cif.gz_C crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase 0.9184 20 293
ID Description Score Start End Superfamily
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.9025 20 293 3.60.130.10
6d0oA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8685 20 291 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8674 20 293 3.60.130.10
4y0eD00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8515 18 293 3.60.130.10
1gqwB00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8492 20 292 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A7Y6NRB1-F1-model_v4 TauD/TfdA family dioxygenase 0.9618 20 292 GO:0000908
GO:0005737
GO:0006790
AF-A0A7C9KQP0-F1-model_v4 TauD/TfdA family dioxygenase 0.9593 20 292 GO:0000908
GO:0005737
GO:0006790
AF-A0A2E6T8F8-F1-model_v4 Taurine dioxygenase 0.9587 21 293 GO:0046872
GO:0051213
AF-A0A3N5X7N8-F1-model_v4 TauD/TfdA family dioxygenase 0.9564 20 291 GO:0000908
GO:0005737
GO:0006790
AF-A0A2E6X617-F1-model_v4 TauD/TfdA-like domain-containing protein 0.954 20 291 GO:0046872
GO:0051213

Map