F400149

General Info

Members Datasets Scaffolds Average Seq Length
309 173 618 105

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100644461|Ga0075430_1006444612
Length 120
Sequence MARSRRPSAQTAAVVLALAEAPTAWRYGYELCQQLDLRAGSMYPILMRLADRGLLETAWENDAPAGRPPRHLYRLTGPGLALAAELAELAGSADPAGAAPTGSGTPPPDRAKLRPRWEGA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
133 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
134 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
135 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.32
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0
Rhizoplane 0.97
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 17.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100644461 3300006846 Bacteria 874
2 Ga0070683_100024048 3300005329 Bacteria 5453
3 Ga0070683_100182119 3300005329 Bacteria 1994
4 Ga0070683_100215327 3300005329 Bacteria 1825
5 Ga0070670_102005146 3300005331 Bacteria 533
6 Ga0068869_100001794 3300005334 Bacteria 12873
7 Ga0068869_101222461 3300005334 Bacteria 661
8 Ga0070680_100302730 3300005336 Bacteria 1356
9 Ga0068868_100007178 3300005338 Bacteria 7916
10 Ga0068868_100669152 3300005338 Bacteria 926
11 Ga0070660_100050903 3300005339 Bacteria 3188
12 Ga0070691_10298672 3300005341 Bacteria 879
13 Ga0070661_100058073 3300005344 Bacteria 2835
14 Ga0070661_100168140 3300005344 Bacteria 1664
15 Ga0070692_10010350 3300005345 Bacteria 4240
16 Ga0070692_10030308 3300005345 Bacteria 2704
17 Ga0070692_10051002 3300005345 Bacteria 2151
18 Ga0070668_101977552 3300005347 Bacteria 537
19 Ga0070669_100070771 3300005353 Bacteria 2579
20 Ga0070669_101055798 3300005353 Bacteria 698
21 Ga0070675_100000711 3300005354 Bacteria 23135
22 Ga0070675_102197513 3300005354 Unclassified 508
23 Ga0070671_100980142 3300005355 Bacteria 740
24 Ga0070674_100320636 3300005356 Bacteria 1242
25 Ga0070674_101723399 3300005356 Unclassified 567
26 Ga0070659_100028542 3300005366 Bacteria 4311
27 Ga0070659_100044550 3300005366 Bacteria 3474
28 Ga0070659_100457068 3300005366 Bacteria 1084
29 Ga0070667_100195064 3300005367 Unclassified 1795
30 Ga0070667_100471757 3300005367 Bacteria 1148
31 Ga0070714_100608007 3300005435 Bacteria 1050
32 Ga0070713_100196674 3300005436 Bacteria 1819
33 Ga0070701_10630029 3300005438 Bacteria 714
34 Ga0070700_100021991 3300005441 Bacteria 3713
35 Ga0070700_100367801 3300005441 Bacteria 1071
36 Ga0070694_100489121 3300005444 Bacteria 977
37 Ga0070663_100006798 3300005455 Bacteria 6912
38 Ga0070663_101336875 3300005455 Bacteria 633
39 Ga0070662_100008213 3300005457 Bacteria 6798
40 Ga0070662_100447129 3300005457 Unclassified 1072
41 Ga0068867_101960495 3300005459 Bacteria 553
42 Ga0070685_10854459 3300005466 Bacteria 674
43 Ga0070685_10982856 3300005466 Bacteria 632
44 Ga0070698_100824042 3300005471 Unclassified 872
45 Ga0070679_100084014 3300005530 Bacteria 3172
46 Ga0070684_100006471 3300005535 Bacteria 9069
47 Ga0070684_100016157 3300005535 Bacteria 6098
48 Ga0070684_100574346 3300005535 Bacteria 1047
49 Ga0070672_100265180 3300005543 Bacteria 1449
50 Ga0070672_101580463 3300005543 Bacteria 588
51 Ga0070693_100476083 3300005547 Unclassified 881
52 Ga0068855_100866284 3300005563 Bacteria 956
53 Ga0070664_100000504 3300005564 Bacteria 29608
54 Ga0070664_100744639 3300005564 Bacteria 914
55 Ga0068857_100096286 3300005577 Bacteria 2652
56 Ga0068856_100960395 3300005614 Bacteria 873
57 Ga0068856_101086025 3300005614 Bacteria 818
58 Ga0070702_101276548 3300005615 Bacteria 595
59 Ga0068852_100219345 3300005616 Bacteria 1808
60 Ga0068852_100995962 3300005616 Bacteria 857
61 Ga0068859_101843401 3300005617 Bacteria 668
62 Ga0068864_100319871 3300005618 Unclassified 1457
63 Ga0068864_100358171 3300005618 Bacteria 1378
64 Ga0068861_100108454 3300005719 Bacteria 2221
65 Ga0068863_100724503 3300005841 Unclassified 989
66 Ga0068863_102110347 3300005841 Bacteria 574
67 Ga0068858_100248838 3300005842 Bacteria 1688
68 Ga0068858_100962834 3300005842 Bacteria 836
69 Ga0068860_100097093 3300005843 Bacteria 2809
70 Ga0068862_100371117 3300005844 Unclassified 1332
71 Ga0068862_102131774 3300005844 Bacteria 572
72 Ga0081455_10354048 3300005937 Bacteria 1035
73 Ga0081538_10005314 3300005981 Bacteria 11598
74 Ga0081538_10007037 3300005981 Bacteria 9782
75 Ga0081538_10017385 3300005981 Bacteria 5461
76 Ga0081538_10024217 3300005981 Bacteria 4330
77 Ga0081538_10026591 3300005981 Bacteria 4042
78 Ga0081539_10000212 3300005985 Bacteria 136183
79 Ga0081539_10056784 3300005985 Bacteria 2170
80 Ga0081539_10474665 3300005985 Bacteria 518
81 Ga0075432_10266609 3300006058 Bacteria 700
82 Ga0075428_100373390 3300006844 Bacteria 1529
83 Ga0075428_102219156 3300006844 Bacteria 566
84 Ga0075428_102446449 3300006844 Unclassified 535
85 Ga0075430_100271741 3300006846 Unclassified 1403
86 Ga0075430_100275000 3300006846 Unclassified 1394
87 Ga0075430_100570107 3300006846 Bacteria 934
88 Ga0075430_101515989 3300006846 Unclassified 551
89 Ga0075431_100303144 3300006847 Bacteria 1614
90 Ga0075431_100567594 3300006847 Bacteria 1121
91 Ga0075431_101833495 3300006847 Unclassified 562
92 Ga0075433_10378948 3300006852 Bacteria 1249
93 Ga0075434_100066173 3300006871 Bacteria 3599
94 Ga0075429_100098637 3300006880 Bacteria 2549
95 Ga0075429_100111200 3300006880 Bacteria 2394
96 Ga0075429_100179026 3300006880 Bacteria 1858
97 Ga0075429_100343356 3300006880 Bacteria 1307
98 Ga0075429_100360730 3300006880 Unclassified 1272
99 Ga0075429_100440361 3300006880 Unclassified 1142
100 Ga0075429_100605137 3300006880 Unclassified 960
101 Ga0075429_100740209 3300006880 Unclassified 861
102 Ga0075429_101545802 3300006880 Bacteria 577
103 Ga0097620_101843216 3300006931 Bacteria 668
104 Ga0075435_100504548 3300007076 Bacteria 1046
105 Ga0111539_10006719 3300009094 Bacteria 14814
106 Ga0111539_10089648 3300009094 Bacteria 3614
107 Ga0105245_10732042 3300009098 Bacteria 1024
108 Ga0105245_11403888 3300009098 Unclassified 748
109 Ga0114129_10002806 3300009147 Bacteria 24303
110 Ga0114129_10004335 3300009147 Bacteria 20059
111 Ga0114129_10017220 3300009147 Bacteria 10293
112 Ga0114129_10056771 3300009147 Bacteria 5482
113 Ga0114129_10412873 3300009147 Bacteria 1777
114 Ga0114129_10483662 3300009147 Bacteria 1619
115 Ga0114129_10489546 3300009147 Bacteria 1608
116 Ga0114129_10567804 3300009147 Bacteria 1473
117 Ga0114129_11029929 3300009147 Unclassified 1035
118 Ga0114129_11106804 3300009147 Unclassified 991
119 Ga0105243_10191415 3300009148 Bacteria 1787
120 Ga0105243_11576115 3300009148 Bacteria 683
121 Ga0105241_10318664 3300009174 Bacteria 1340
122 Ga0105248_12600428 3300009177 Unclassified 577
123 Ga0105248_12825761 3300009177 Bacteria 554
124 Ga0105238_11759140 3300009551 Unclassified 651
125 Ga0105249_10371180 3300009553 Bacteria 1454
126 Ga0105239_10173595 3300010375 Bacteria 2411
127 Ga0157369_10119914 3300013105 Bacteria 2791
128 Ga0163163_10441486 3300014325 Bacteria 1361
129 Ga0163163_10473845 3300014325 Bacteria 1313
130 Ga0163163_11747953 3300014325 Unclassified 682
131 Ga0157380_11396908 3300014326 Bacteria 750
132 Ga0157377_10023433 3300014745 Bacteria 3271
133 Ga0157377_10382460 3300014745 Bacteria 953
134 Ga0157379_10248043 3300014968 Bacteria 1616
135 Ga0206353_10520731 3300020082 Bacteria 2902
136 Ga0207688_10116740 3300025901 Unclassified 1554
137 Ga0207688_11054564 3300025901 Bacteria 513
138 Ga0207645_10218891 3300025907 Bacteria 1255
139 Ga0207705_10009594 3300025909 Bacteria 7039
140 Ga0207705_10547299 3300025909 Bacteria 900
141 Ga0207654_10329442 3300025911 Bacteria 1046
142 Ga0207707_10106764 3300025912 Bacteria 2447
143 Ga0207657_10109353 3300025919 Bacteria 2285
144 Ga0207657_10634332 3300025919 Bacteria 832
145 Ga0207649_10059606 3300025920 Bacteria 2396
146 Ga0207649_10882891 3300025920 Bacteria 700
147 Ga0207652_10190762 3300025921 Bacteria 1843
148 Ga0207652_11164986 3300025921 Bacteria 672
149 Ga0207659_10000627 3300025926 Bacteria 20962
150 Ga0207687_10060139 3300025927 Bacteria 2679
151 Ga0207687_11119441 3300025927 Unclassified 676
152 Ga0207664_10539159 3300025929 Bacteria 1046
153 Ga0207644_11075729 3300025931 Bacteria 676
154 Ga0207690_10124343 3300025932 Bacteria 1878
155 Ga0207690_11144855 3300025932 Bacteria 649
156 Ga0207690_11670856 3300025932 Bacteria 532
157 Ga0207706_10083274 3300025933 Bacteria 2812
158 Ga0207709_10133147 3300025935 Bacteria 1697
159 Ga0207669_10710470 3300025937 Bacteria 827
160 Ga0207669_11541675 3300025937 Unclassified 567
161 Ga0207691_10414925 3300025940 Bacteria 1147
162 Ga0207691_10737820 3300025940 Bacteria 829
163 Ga0207711_11555963 3300025941 Bacteria 604
164 Ga0207689_10003745 3300025942 Bacteria 13865
165 Ga0207689_11108542 3300025942 Bacteria 667
166 Ga0207661_10017736 3300025944 Bacteria 5274
167 Ga0207661_10078969 3300025944 Bacteria 2711
168 Ga0207661_10316468 3300025944 Unclassified 1402
169 Ga0207679_10009165 3300025945 Bacteria 6329
170 Ga0207679_11144178 3300025945 Bacteria 714
171 Ga0207667_10528268 3300025949 Bacteria 1195
172 Ga0207712_11867831 3300025961 Bacteria 538
173 Ga0207668_10331487 3300025972 Unclassified 1266
174 Ga0207658_10859238 3300025986 Bacteria 825
175 Ga0207658_11374481 3300025986 Unclassified 646
176 Ga0207677_10009624 3300026023 Bacteria 5442
177 Ga0207703_10104850 3300026035 Unclassified 2402
178 Ga0207703_10114959 3300026035 Bacteria 2302
179 Ga0207639_10137884 3300026041 Bacteria 2029
180 Ga0207678_10014359 3300026067 Bacteria 6964
181 Ga0207678_10658666 3300026067 Bacteria 920
182 Ga0207678_10962642 3300026067 Bacteria 755
183 Ga0207708_10002359 3300026075 Bacteria 13870
184 Ga0207708_10559172 3300026075 Bacteria 965
185 Ga0207702_10818503 3300026078 Bacteria 921
186 Ga0207641_10125793 3300026088 Bacteria 2295
187 Ga0207648_11669290 3300026089 Bacteria 598
188 Ga0207676_10134417 3300026095 Bacteria 2108
189 Ga0207676_10255756 3300026095 Unclassified 1579
190 Ga0207674_10031130 3300026116 Bacteria 5606
191 Ga0207675_100035915 3300026118 Bacteria 4622
192 Ga0207675_102571595 3300026118 Bacteria 519
193 Ga0207683_10176573 3300026121 Bacteria 1936
194 Ga0207683_10374666 3300026121 Bacteria 1308
195 Ga0207683_10811464 3300026121 Bacteria 868
196 Ga0207698_10923556 3300026142 Bacteria 881
197 Ga0207428_10040156 3300027907 Bacteria 3798
198 Ga0207428_10180081 3300027907 Bacteria 1597
199 Ga0268265_10119558 3300028380 Unclassified 2168
200 Ga0268265_10513844 3300028380 Unclassified 1131
201 Ga0268265_12097709 3300028380 Bacteria 572
202 Ga0307513_10517197 3300031456 Bacteria 909
203 Ga0307509_10117703 3300031507 Bacteria 2643
204 Ga0307408_100012922 3300031548 Bacteria 5536
205 Ga0307514_10369319 3300031649 Bacteria 752
206 Ga0307405_10014454 3300031731 Bacteria 4245
207 Ga0307405_10027811 3300031731 Bacteria 3285
208 Ga0307405_10061363 3300031731 Bacteria 2376
209 Ga0307413_10035436 3300031824 Bacteria 2862
210 Ga0307413_10085429 3300031824 Bacteria 2037
211 Ga0307410_10027481 3300031852 Bacteria 3597
212 Ga0307410_10143680 3300031852 Bacteria 1768
213 Ga0307406_10008684 3300031901 Bacteria 5677
214 Ga0307407_10010245 3300031903 Bacteria 4411
215 Ga0307407_10771333 3300031903 Bacteria 729
216 Ga0307412_10109296 3300031911 Bacteria 1971
217 Ga0307412_10894157 3300031911 Bacteria 778
218 Ga0307409_100003145 3300031995 Bacteria 8870
219 Ga0307409_100016425 3300031995 Bacteria 4897
220 Ga0307409_100018044 3300031995 Bacteria 4726
221 Ga0307409_100260901 3300031995 Bacteria 1590
222 Ga0307416_100000276 3300032002 Bacteria 27133
223 Ga0307416_100003326 3300032002 Bacteria 9406
224 Ga0307416_100034789 3300032002 Bacteria 3838
225 Ga0307416_101040419 3300032002 Bacteria 922
226 Ga0307416_101738912 3300032002 Unclassified 728
227 Ga0307414_10159924 3300032004 Bacteria 1788
228 Ga0307414_11124135 3300032004 Unclassified 726
229 Ga0307411_10030565 3300032005 Bacteria 3303
230 Ga0307411_10307931 3300032005 Bacteria 1273
231 Ga0307411_10397571 3300032005 Bacteria 1138
232 Ga0307415_100000158 3300032126 Bacteria 29731
233 Ga0307415_100001904 3300032126 Bacteria 10252
234 Ga0307415_100044353 3300032126 Bacteria 2972
235 Ga0395900_0090986 3300037418 Unclassified 3135
236 Ga0395905_0076705 3300037471 Bacteria 3132
237 Ga0395901_0003711 3300038443 Bacteria 15395
238 Ga0395901_0312643 3300038443 Bacteria 1627
239 Ga0451843_0408364 3300041509 Bacteria 693
240 Ga0439448_0000339 3300042005 Bacteria 10471
241 Ga0439448_0015583 3300042005 Bacteria 2304
242 Ga0439450_000536 3300042008 Bacteria 4978
243 Ga0439463_014259 3300042016 Bacteria 1958
244 Ga0439463_027075 3300042016 Bacteria 1442
245 Ga0450914_022983 3300042118 Bacteria 707
246 Ga0450889_005038 3300042144 Bacteria 1310
247 Ga0439444_0000100 3300042437 Bacteria 6836
248 Ga0439464_0001092 3300042439 Bacteria 6237
249 Ga0439464_0064320 3300042439 Bacteria 1078
250 Ga0439460_0000248 3300042461 Bacteria 11035
251 Ga0450916_045482 3300042530 Bacteria 679
252 Ga0450918_078816 3300042531 Bacteria 626
253 Ga0450901_009741 3300042533 Bacteria 993
254 Ga0439440_0004214 3300042993 Bacteria 2819
255 Ga0495632_0099791 3300046519 Bacteria 1369
256 Ga0496109_1128695 3300048912 Bacteria 721
257 Ga0496112_0192113 3300048915 Bacteria 2003
258 Ga0496112_0836561 3300048915 Unclassified 844
259 Ga0501031_0116951 3300049568 Bacteria 1742
260 Ga0501039_0084892 3300049575 Bacteria 2466
261 Ga0501039_0268868 3300049575 Bacteria 1340
262 Ga0501040_0296845 3300049576 Unclassified 1155
263 Ga0501041_0025267 3300049577 Bacteria 3571
264 Ga0501042_0148971 3300049578 Bacteria 1687
265 Ga0501046_0201030 3300049580 Bacteria 1483
266 Ga0501048_0746880 3300049582 Bacteria 703
267 Ga0501068_0893734 3300049584 Unclassified 584
268 Ga0501069_0680569 3300049585 Bacteria 620
269 Ga0501071_0115214 3300049587 Bacteria 1989
270 Ga0501072_0050681 3300049588 Bacteria 3269
271 Ga0501075_0247744 3300049591 Bacteria 1358
272 Ga0501076_0054241 3300049592 Bacteria 3177
273 Ga0501045_0162294 3300049824 Bacteria 1664
274 nmdc:mga05p37_115238_c1 3300050507 Bacteria 3304
275 nmdc:mga05p37_1579204_c1 3300050507 Unclassified 648
276 nmdc:mga05p37_244438_c1 3300050507 Bacteria 2156
277 nmdc:mga05p37_2560_c1 3300050507 Bacteria 21147
278 nmdc:mga05p37_405537_c1 3300050507 Unclassified 1591
279 nmdc:mga05p37_423915_c1 3300050507 Bacteria 1548
280 nmdc:mga05p37_550657_c1 3300050507 Bacteria 1313
281 nmdc:mga05p37_564665_c1 3300050507 Bacteria 1292
282 nmdc:mga05p37_909839_c1 3300050507 Unclassified 947
283 nmdc:mga09592_1151674_c1 3300050508 Unclassified 643
284 nmdc:mga09592_122904_c1 3300050508 Bacteria 2230
285 nmdc:mga09592_230101_c1 3300050508 Unclassified 1606
286 nmdc:mga09592_237256_c1 3300050508 Unclassified 1580
287 nmdc:mga09592_283390_c1 3300050508 Bacteria 1437
288 nmdc:mga09592_315727_c1 3300050508 Unclassified 1354
289 nmdc:mga09592_341182_c1 3300050508 Unclassified 1297
290 nmdc:mga09592_888557_c1 3300050508 Unclassified 749
291 nmdc:mga0qj67_178904_c1 3300050509 Bacteria 1722
292 nmdc:mga0qj67_827744_c1 3300050509 Unclassified 732
293 nmdc:mga06r32_1231953_c1 3300050510 Unclassified 694
294 nmdc:mga06r32_1531688_c1 3300050510 Bacteria 606
295 nmdc:mga06r32_53130_c1 3300050510 Bacteria 3881
296 nmdc:mga06r32_86469_c1 3300050510 Unclassified 3058
297 nmdc:mga06r32_883426_c1 3300050510 Unclassified 851
298 nmdc:mga08y16_38651_c1 3300050511 Bacteria 5009
299 nmdc:mga08y16_49985_c1 3300050511 Bacteria 4375
300 nmdc:mga0n895_3880_c1 3300050512 Bacteria 12144
301 nmdc:mga0rr50_396531_c1 3300050513 Bacteria 1165
302 nmdc:mga0a205_4706_c1 3300050515 Bacteria 12257
303 Ga0500644_0019321 3300053088 Bacteria 2010
304 Ga0500646_0293146 3300053090 Unclassified 582
305 Ga0500583_0086767 3300053092 Bacteria 1519
306 Ga0501084_0335634 3300054114 Bacteria 1277
307 Ga0590075_014596 3300059424 Bacteria 1922
308 Ga0530510_0125991 3300061734 Bacteria 1883
309 8055073836 8055066027 Bacteria 9479577
310 Ga0075430_100644461
311 Ga0070683_100024048
312 Ga0070683_100182119
313 Ga0070683_100215327
314 Ga0070670_102005146
315 Ga0068869_100001794
316 Ga0068869_101222461
317 Ga0070680_100302730
318 Ga0068868_100007178
319 Ga0068868_100669152
320 Ga0070660_100050903
321 Ga0070691_10298672
322 Ga0070661_100058073
323 Ga0070661_100168140
324 Ga0070692_10010350
325 Ga0070692_10030308
326 Ga0070692_10051002
327 Ga0070668_101977552
328 Ga0070669_100070771
329 Ga0070669_101055798
330 Ga0070675_100000711
331 Ga0070675_102197513
332 Ga0070671_100980142
333 Ga0070674_100320636
334 Ga0070674_101723399
335 Ga0070659_100028542
336 Ga0070659_100044550
337 Ga0070659_100457068
338 Ga0070667_100195064
339 Ga0070667_100471757
340 Ga0070714_100608007
341 Ga0070713_100196674
342 Ga0070701_10630029
343 Ga0070700_100021991
344 Ga0070700_100367801
345 Ga0070694_100489121
346 Ga0070663_100006798
347 Ga0070663_101336875
348 Ga0070662_100008213
349 Ga0070662_100447129
350 Ga0068867_101960495
351 Ga0070685_10854459
352 Ga0070685_10982856
353 Ga0070698_100824042
354 Ga0070679_100084014
355 Ga0070684_100006471
356 Ga0070684_100016157
357 Ga0070684_100574346
358 Ga0070672_100265180
359 Ga0070672_101580463
360 Ga0070693_100476083
361 Ga0068855_100866284
362 Ga0070664_100000504
363 Ga0070664_100744639
364 Ga0068857_100096286
365 Ga0068856_100960395
366 Ga0068856_101086025
367 Ga0070702_101276548
368 Ga0068852_100219345
369 Ga0068852_100995962
370 Ga0068859_101843401
371 Ga0068864_100319871
372 Ga0068864_100358171
373 Ga0068861_100108454
374 Ga0068863_100724503
375 Ga0068863_102110347
376 Ga0068858_100248838
377 Ga0068858_100962834
378 Ga0068860_100097093
379 Ga0068862_100371117
380 Ga0068862_102131774
381 Ga0081455_10354048
382 Ga0081538_10005314
383 Ga0081538_10007037
384 Ga0081538_10017385
385 Ga0081538_10024217
386 Ga0081538_10026591
387 Ga0081539_10000212
388 Ga0081539_10056784
389 Ga0081539_10474665
390 Ga0075432_10266609
391 Ga0075428_100373390
392 Ga0075428_102219156
393 Ga0075428_102446449
394 Ga0075430_100271741
395 Ga0075430_100275000
396 Ga0075430_100570107
397 Ga0075430_101515989
398 Ga0075431_100303144
399 Ga0075431_100567594
400 Ga0075431_101833495
401 Ga0075433_10378948
402 Ga0075434_100066173
403 Ga0075429_100098637
404 Ga0075429_100111200
405 Ga0075429_100179026
406 Ga0075429_100343356
407 Ga0075429_100360730
408 Ga0075429_100440361
409 Ga0075429_100605137
410 Ga0075429_100740209
411 Ga0075429_101545802
412 Ga0097620_101843216
413 Ga0075435_100504548
414 Ga0111539_10006719
415 Ga0111539_10089648
416 Ga0105245_10732042
417 Ga0105245_11403888
418 Ga0114129_10002806
419 Ga0114129_10004335
420 Ga0114129_10017220
421 Ga0114129_10056771
422 Ga0114129_10412873
423 Ga0114129_10483662
424 Ga0114129_10489546
425 Ga0114129_10567804
426 Ga0114129_11029929
427 Ga0114129_11106804
428 Ga0105243_10191415
429 Ga0105243_11576115
430 Ga0105241_10318664
431 Ga0105248_12600428
432 Ga0105248_12825761
433 Ga0105238_11759140
434 Ga0105249_10371180
435 Ga0105239_10173595
436 Ga0157369_10119914
437 Ga0163163_10441486
438 Ga0163163_10473845
439 Ga0163163_11747953
440 Ga0157380_11396908
441 Ga0157377_10023433
442 Ga0157377_10382460
443 Ga0157379_10248043
444 Ga0206353_10520731
445 Ga0207688_10116740
446 Ga0207688_11054564
447 Ga0207645_10218891
448 Ga0207705_10009594
449 Ga0207705_10547299
450 Ga0207654_10329442
451 Ga0207707_10106764
452 Ga0207657_10109353
453 Ga0207657_10634332
454 Ga0207649_10059606
455 Ga0207649_10882891
456 Ga0207652_10190762
457 Ga0207652_11164986
458 Ga0207659_10000627
459 Ga0207687_10060139
460 Ga0207687_11119441
461 Ga0207664_10539159
462 Ga0207644_11075729
463 Ga0207690_10124343
464 Ga0207690_11144855
465 Ga0207690_11670856
466 Ga0207706_10083274
467 Ga0207709_10133147
468 Ga0207669_10710470
469 Ga0207669_11541675
470 Ga0207691_10414925
471 Ga0207691_10737820
472 Ga0207711_11555963
473 Ga0207689_10003745
474 Ga0207689_11108542
475 Ga0207661_10017736
476 Ga0207661_10078969
477 Ga0207661_10316468
478 Ga0207679_10009165
479 Ga0207679_11144178
480 Ga0207667_10528268
481 Ga0207712_11867831
482 Ga0207668_10331487
483 Ga0207658_10859238
484 Ga0207658_11374481
485 Ga0207677_10009624
486 Ga0207703_10104850
487 Ga0207703_10114959
488 Ga0207639_10137884
489 Ga0207678_10014359
490 Ga0207678_10658666
491 Ga0207678_10962642
492 Ga0207708_10002359
493 Ga0207708_10559172
494 Ga0207702_10818503
495 Ga0207641_10125793
496 Ga0207648_11669290
497 Ga0207676_10134417
498 Ga0207676_10255756
499 Ga0207674_10031130
500 Ga0207675_100035915
501 Ga0207675_102571595
502 Ga0207683_10176573
503 Ga0207683_10374666
504 Ga0207683_10811464
505 Ga0207698_10923556
506 Ga0207428_10040156
507 Ga0207428_10180081
508 Ga0268265_10119558
509 Ga0268265_10513844
510 Ga0268265_12097709
511 Ga0307513_10517197
512 Ga0307509_10117703
513 Ga0307408_100012922
514 Ga0307514_10369319
515 Ga0307405_10014454
516 Ga0307405_10027811
517 Ga0307405_10061363
518 Ga0307413_10035436
519 Ga0307413_10085429
520 Ga0307410_10027481
521 Ga0307410_10143680
522 Ga0307406_10008684
523 Ga0307407_10010245
524 Ga0307407_10771333
525 Ga0307412_10109296
526 Ga0307412_10894157
527 Ga0307409_100003145
528 Ga0307409_100016425
529 Ga0307409_100018044
530 Ga0307409_100260901
531 Ga0307416_100000276
532 Ga0307416_100003326
533 Ga0307416_100034789
534 Ga0307416_101040419
535 Ga0307416_101738912
536 Ga0307414_10159924
537 Ga0307414_11124135
538 Ga0307411_10030565
539 Ga0307411_10307931
540 Ga0307411_10397571
541 Ga0307415_100000158
542 Ga0307415_100001904
543 Ga0307415_100044353
544 Ga0395900_0090986
545 Ga0395905_0076705
546 Ga0395901_0003711
547 Ga0395901_0312643
548 Ga0451843_0408364
549 Ga0439448_0000339
550 Ga0439448_0015583
551 Ga0439450_000536
552 Ga0439463_014259
553 Ga0439463_027075
554 Ga0450914_022983
555 Ga0450889_005038
556 Ga0439444_0000100
557 Ga0439464_0001092
558 Ga0439464_0064320
559 Ga0439460_0000248
560 Ga0450916_045482
561 Ga0450918_078816
562 Ga0450901_009741
563 Ga0439440_0004214
564 Ga0495632_0099791
565 Ga0496109_1128695
566 Ga0496112_0192113
567 Ga0496112_0836561
568 Ga0501031_0116951
569 Ga0501039_0084892
570 Ga0501039_0268868
571 Ga0501040_0296845
572 Ga0501041_0025267
573 Ga0501042_0148971
574 Ga0501046_0201030
575 Ga0501048_0746880
576 Ga0501068_0893734
577 Ga0501069_0680569
578 Ga0501071_0115214
579 Ga0501072_0050681
580 Ga0501075_0247744
581 Ga0501076_0054241
582 Ga0501045_0162294
583 nmdc:mga05p37_115238_c1
584 nmdc:mga05p37_1579204_c1
585 nmdc:mga05p37_244438_c1
586 nmdc:mga05p37_2560_c1
587 nmdc:mga05p37_405537_c1
588 nmdc:mga05p37_423915_c1
589 nmdc:mga05p37_550657_c1
590 nmdc:mga05p37_564665_c1
591 nmdc:mga05p37_909839_c1
592 nmdc:mga09592_1151674_c1
593 nmdc:mga09592_122904_c1
594 nmdc:mga09592_230101_c1
595 nmdc:mga09592_237256_c1
596 nmdc:mga09592_283390_c1
597 nmdc:mga09592_315727_c1
598 nmdc:mga09592_341182_c1
599 nmdc:mga09592_888557_c1
600 nmdc:mga0qj67_178904_c1
601 nmdc:mga0qj67_827744_c1
602 nmdc:mga06r32_1231953_c1
603 nmdc:mga06r32_1531688_c1
604 nmdc:mga06r32_53130_c1
605 nmdc:mga06r32_86469_c1
606 nmdc:mga06r32_883426_c1
607 nmdc:mga08y16_38651_c1
608 nmdc:mga08y16_49985_c1
609 nmdc:mga0n895_3880_c1
610 nmdc:mga0rr50_396531_c1
611 nmdc:mga0a205_4706_c1
612 Ga0500644_0019321
613 Ga0500646_0293146
614 Ga0500583_0086767
615 Ga0501084_0335634
616 Ga0590075_014596
617 Ga0530510_0125991
618 8055073836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

15

88

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eco-assembly1.cif.gz_A crystal structure of mepr, a transcription regulator of the staphylococcus aureus multidrug efflux pump mepa 0.9292 9 88
3s2w-assembly1.cif.gz_A the crystal structure of a marr transcriptional regulator from methanosarcina mazei go1 0.9211 11 87
3hsr-assembly1.cif.gz_B crystal structure of staphylococcus aureus protein sarz in mixed disulfide form 0.9197 7 87
3fm5-assembly3.cif.gz_D x-ray crystal structure of transcriptional regulator (marr family) from rhodococcus sp. rha1 0.9167 7 88
4l9n-assembly1.cif.gz_A crystal structure of mepr a103v mutant from multidrug resistant s. aureus clinical isolate 0.9144 12 88
ID Description Score Start End Superfamily
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9255 10 75 1.10.10.10
af_Q58187_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9226 8 76 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9178 9 78 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9079 10 75 1.10.10.10
af_P9WMF1_6_143_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9071 7 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A523F374-F1-model_v4 deleted 0.961 4 88
AF-A0A2A4I559-F1-model_v4 PadR family transcriptional regulator 0.9568 12 92
AF-A0A175XZQ0-F1-model_v4 Transcriptional regulator 0.9552 12 92
AF-A0A8B5QKM4-F1-model_v4 deleted 0.9486 6 85
AF-A0A2M7LBX2-F1-model_v4 deleted 0.9454 5 87

Map