F400080

General Info

Members Datasets Scaffolds Average Seq Length
309 210 616 80

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100401814|Ga0070714_1004018141
Length 86
Sequence MRLPKVATGQRLPHKALLSTIRLLALVSGDPTAPPDIMRTVLYRPEFFGRPYSDLAHALLRGPSDWSVGERELFATFVSHLNACRF

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
123 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 2.91
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 25.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100401814 3300005435 Unclassified 1295
2 JGI24749J21850_1015893 3300002076 Bacteria 1056
3 JGI24749J21850_1022754 3300002076 Unclassified 889
4 Ga0065715_10181079 3300005293 Bacteria 1476
5 Ga0065707_10402630 3300005295 Unclassified 851
6 Ga0070690_100006943 3300005330 Bacteria 6444
7 Ga0070690_100164981 3300005330 Bacteria 1521
8 Ga0068869_100964240 3300005334 Bacteria 741
9 Ga0068869_101331280 3300005334 Unclassified 634
10 Ga0068868_101763681 3300005338 Bacteria 584
11 Ga0070689_100856234 3300005340 Unclassified 802
12 Ga0070687_100092876 3300005343 Bacteria 1673
13 Ga0070669_100286621 3300005353 Unclassified 1321
14 Ga0070669_100687652 3300005353 Bacteria 863
15 Ga0070675_100000083 3300005354 Bacteria 55614
16 Ga0070675_101904754 3300005354 Unclassified 548
17 Ga0070671_101373721 3300005355 Bacteria 624
18 Ga0070673_100494185 3300005364 Bacteria 1106
19 Ga0070659_100809649 3300005366 Bacteria 815
20 Ga0070667_100046641 3300005367 Bacteria 3646
21 Ga0070703_10024837 3300005406 Unclassified 1773
22 Ga0070703_10404270 3300005406 Unclassified 595
23 Ga0070709_10238143 3300005434 Unclassified 1306
24 Ga0070714_100049389 3300005435 Unclassified 3581
25 Ga0070714_100992349 3300005435 Unclassified 817
26 Ga0070713_100006634 3300005436 Bacteria 8047
27 Ga0070710_10838797 3300005437 Bacteria 659
28 Ga0070710_10840047 3300005437 Unclassified 659
29 Ga0070701_11372662 3300005438 Bacteria 507
30 Ga0070711_100405306 3300005439 Unclassified 1108
31 Ga0070711_100943598 3300005439 Unclassified 738
32 Ga0070711_101976905 3300005439 Bacteria 513
33 Ga0070705_100060799 3300005440 Bacteria 2242
34 Ga0070705_100475227 3300005440 Bacteria 943
35 Ga0070705_100712697 3300005440 Bacteria 789
36 Ga0070694_100160001 3300005444 Bacteria 1651
37 Ga0070708_100059406 3300005445 Bacteria 3409
38 Ga0070708_100309438 3300005445 Bacteria 1488
39 Ga0070708_100680734 3300005445 Unclassified 968
40 Ga0070662_100228106 3300005457 Bacteria 1489
41 Ga0070662_100485400 3300005457 Bacteria 1029
42 Ga0070681_10067520 3300005458 Bacteria 3543
43 Ga0068867_100438313 3300005459 Unclassified 1110
44 Ga0070706_100011191 3300005467 Bacteria 8330
45 Ga0070706_100013573 3300005467 Bacteria 7532
46 Ga0070706_100040039 3300005467 Bacteria 4326
47 Ga0070706_100146350 3300005467 Bacteria 2206
48 Ga0070707_100006880 3300005468 Bacteria 10530
49 Ga0070707_100436491 3300005468 Bacteria 1270
50 Ga0070698_100032370 3300005471 Bacteria 5417
51 Ga0070698_100105931 3300005471 Bacteria 2781
52 Ga0070698_101571134 3300005471 Unclassified 610
53 Ga0070699_100877354 3300005518 Unclassified 821
54 Ga0070699_101172048 3300005518 Bacteria 705
55 Ga0070697_100401033 3300005536 Unclassified 1190
56 Ga0070672_100524645 3300005543 Unclassified 1026
57 Ga0070686_100002474 3300005544 Bacteria 10174
58 Ga0070686_100086517 3300005544 Bacteria 2087
59 Ga0070686_100915795 3300005544 Unclassified 714
60 Ga0070695_100301654 3300005545 Bacteria 1184
61 Ga0070695_100335133 3300005545 Bacteria 1129
62 Ga0070696_100542988 3300005546 Unclassified 930
63 Ga0070696_100735200 3300005546 Bacteria 807
64 Ga0070693_100171127 3300005547 Bacteria 1391
65 Ga0068854_100192720 3300005578 Unclassified 1598
66 Ga0068854_100327627 3300005578 Bacteria 1247
67 Ga0068854_100472947 3300005578 Bacteria 1051
68 Ga0068852_100487220 3300005616 Bacteria 1226
69 Ga0068861_100390475 3300005719 Bacteria 1232
70 Ga0068870_10085291 3300005840 Bacteria 1755
71 Ga0068858_100789869 3300005842 Unclassified 926
72 Ga0068860_100517237 3300005843 Bacteria 1193
73 Ga0068860_101858603 3300005843 Unclassified 624
74 Ga0070717_10150844 3300006028 Bacteria 2011
75 Ga0070717_10345235 3300006028 Unclassified 1330
76 Ga0070715_10647361 3300006163 Unclassified 625
77 Ga0070716_100694209 3300006173 Unclassified 777
78 Ga0070712_100264930 3300006175 Unclassified 1378
79 Ga0070712_100961205 3300006175 Bacteria 738
80 Ga0097621_102059290 3300006237 Unclassified 545
81 Ga0075428_100225886 3300006844 Bacteria 2021
82 Ga0075428_101504151 3300006844 Unclassified 705
83 Ga0075431_100038047 3300006847 Unclassified 4954
84 Ga0075431_100389085 3300006847 Bacteria 1397
85 Ga0075434_100097850 3300006871 Bacteria 2939
86 Ga0075434_100485173 3300006871 Bacteria 1257
87 Ga0075434_100826703 3300006871 Unclassified 942
88 Ga0075434_100878857 3300006871 Bacteria 911
89 Ga0075434_101936588 3300006871 Bacteria 595
90 Ga0075429_100287390 3300006880 Unclassified 1440
91 Ga0075429_100306244 3300006880 Bacteria 1391
92 Ga0075429_100672376 3300006880 Bacteria 907
93 Ga0075436_100230001 3300006914 Bacteria 1317
94 Ga0075435_100002161 3300007076 Bacteria 12966
95 Ga0099794_10781746 3300007265 Unclassified 510
96 Ga0105240_10353712 3300009093 Bacteria 1666
97 Ga0105240_10824991 3300009093 Bacteria 1003
98 Ga0105240_12679774 3300009093 Bacteria 515
99 Ga0111539_10022875 3300009094 Bacteria 7675
100 Ga0105245_10582464 3300009098 Viruses 1144
101 Ga0105245_10784962 3300009098 Bacteria 990
102 Ga0105247_11733893 3300009101 Unclassified 517
103 Ga0114129_10023117 3300009147 Bacteria 8817
104 Ga0114129_10055037 3300009147 Bacteria 5576
105 Ga0114129_10072934 3300009147 Bacteria 4784
106 Ga0114129_10210122 3300009147 Bacteria 2631
107 Ga0114129_10223674 3300009147 Bacteria 2538
108 Ga0105243_11531357 3300009148 Unclassified 691
109 Ga0105241_10868974 3300009174 Bacteria 835
110 Ga0105242_11377738 3300009176 Bacteria 732
111 Ga0105242_12402269 3300009176 Unclassified 574
112 Ga0105248_10429784 3300009177 Bacteria 1487
113 Ga0105248_10549838 3300009177 Unclassified 1302
114 Ga0163162_12464198 3300013306 Bacteria 598
115 Ga0157380_12162581 3300014326 Unclassified 620
116 Ga0157379_10988135 3300014968 Bacteria 802
117 Ga0157379_12514722 3300014968 Unclassified 515
118 Ga0207653_10101183 3300025885 Bacteria 1019
119 Ga0207653_10297118 3300025885 Bacteria 625
120 Ga0207692_10858473 3300025898 Bacteria 596
121 Ga0207692_11089112 3300025898 Bacteria 529
122 Ga0207680_10091902 3300025903 Bacteria 1932
123 Ga0207699_10123560 3300025906 Unclassified 1677
124 Ga0207643_10094415 3300025908 Bacteria 1747
125 Ga0207705_10015582 3300025909 Bacteria 5457
126 Ga0207684_10003316 3300025910 Bacteria 15808
127 Ga0207684_10026656 3300025910 Bacteria 4927
128 Ga0207684_10034405 3300025910 Bacteria 4306
129 Ga0207684_11302485 3300025910 Bacteria 598
130 Ga0207695_10596814 3300025913 Bacteria 985
131 Ga0207695_11137432 3300025913 Bacteria 661
132 Ga0207693_10027652 3300025915 Bacteria 4483
133 Ga0207693_10579544 3300025915 Bacteria 874
134 Ga0207663_10194814 3300025916 Unclassified 1458
135 Ga0207663_10741592 3300025916 Unclassified 780
136 Ga0207662_10042622 3300025918 Bacteria 2676
137 Ga0207646_10007828 3300025922 Bacteria 10797
138 Ga0207646_10814894 3300025922 Bacteria 831
139 Ga0207646_11126873 3300025922 Unclassified 690
140 Ga0207646_11291059 3300025922 Bacteria 638
141 Ga0207681_10666744 3300025923 Bacteria 863
142 Ga0207687_11407781 3300025927 Bacteria 599
143 Ga0207700_10302281 3300025928 Unclassified 1382
144 Ga0207664_10293690 3300025929 Bacteria 1429
145 Ga0207664_11219437 3300025929 Bacteria 671
146 Ga0207664_11438708 3300025929 Bacteria 610
147 Ga0207644_10296394 3300025931 Bacteria 1302
148 Ga0207690_10650520 3300025932 Bacteria 864
149 Ga0207706_10887188 3300025933 Bacteria 754
150 Ga0207709_10702482 3300025935 Unclassified 809
151 Ga0207665_11285785 3300025939 Unclassified 583
152 Ga0207711_10297609 3300025941 Bacteria 1488
153 Ga0207711_10936087 3300025941 Bacteria 805
154 Ga0207667_11690351 3300025949 Bacteria 600
155 Ga0207651_10530541 3300025960 Bacteria 1021
156 Ga0207640_10223608 3300025981 Bacteria 1443
157 Ga0207640_10424911 3300025981 Unclassified 1088
158 Ga0207658_10352204 3300025986 Bacteria 1282
159 Ga0207703_10150057 3300026035 Bacteria 2032
160 Ga0207708_11019709 3300026075 Unclassified 720
161 Ga0207675_100359000 3300026118 Bacteria 1429
162 Ga0207675_100420493 3300026118 Unclassified 1320
163 Ga0207698_11951904 3300026142 Bacteria 601
164 Ga0207428_10044922 3300027907 Bacteria 3562
165 Ga0268265_11927226 3300028380 Bacteria 598
166 Ga0268264_10529172 3300028381 Bacteria 1153
167 Ga0268264_10708787 3300028381 Bacteria 1000
168 Ga0268264_12144652 3300028381 Unclassified 567
169 Ga0307513_10999828 3300031456 Bacteria 546
170 Ga0307409_101801693 3300031995 Bacteria 641
171 Ga0307416_101000869 3300032002 Bacteria 939
172 Ga0307416_101137752 3300032002 Bacteria 886
173 Ga0373930_0002978 3300034816 Bacteria 2666
174 Ga0373950_0006889 3300034818 Bacteria 1748
175 Ga0373959_0001845 3300034820 Bacteria 3378
176 Ga0373938_0004972 3300034957 Bacteria 2242
177 Ga0373926_0005678 3300035083 Bacteria 4118
178 Ga0373929_0000150 3300035085 Bacteria 12080
179 Ga0373940_0000915 3300035088 Bacteria 4984
180 Ga0373944_0021149 3300035089 Bacteria 1881
181 Ga0373949_0001954 3300035090 Bacteria 5544
182 Ga0373951_0001412 3300035091 Bacteria 6316
183 Ga0373952_0000685 3300035092 Bacteria 6013
184 Ga0373932_0002593 3300035112 Bacteria 4508
185 Ga0373939_0000957 3300035114 Bacteria 7199
186 Ga0373941_0000768 3300035115 Bacteria 6566
187 Ga0373945_0014695 3300035116 Unclassified 2627
188 Ga0373960_0000671 3300035121 Bacteria 7056
189 Ga0373943_0002557 3300035170 Bacteria 8272
190 Ga0373946_0010548 3300035171 Unclassified 3422
191 Ga0373942_0005861 3300035207 Bacteria 2843
192 Ga0373961_0001385 3300035241 Bacteria 7247
193 Ga0373962_0006856 3300035242 Bacteria 2773
194 Ga0373931_0001502 3300035691 Bacteria 10037
195 Ga0373935_0544618 3300035692 Bacteria 845
196 Ga0373927_0013489 3300035695 Bacteria 5430
197 Ga0373947_0001194 3300035725 Bacteria 15977
198 Ga0373937_1134138 3300036401 Bacteria 730
199 Ga0373925_0003617 3300037068 Bacteria 11910
200 Ga0373925_0814161 3300037068 Bacteria 770
201 Ga0395899_0220870 3300037312 Bacteria 1313
202 Ga0395898_0925120 3300037466 Bacteria 810
203 Ga0395898_1562302 3300037466 Unclassified 585
204 Ga0436364_1141981 3300037853 Unclassified 754
205 Ga0395901_0144375 3300038443 Bacteria 2502
206 Ga0395901_0756739 3300038443 Bacteria 964
207 Ga0436362_0256227 3300039453 Unclassified 675
208 Ga0439453_0026073 3300041408 Bacteria 1082
209 Ga0439461_0063659 3300041410 Bacteria 842
210 Ga0451807_2451476 3300041486 Bacteria 1237
211 Ga0439451_090837 3300042009 Bacteria 615
212 Ga0453684_2212153 3300044712 Unclassified 549
213 Ga0466971_0223027 3300044719 Bacteria 894
214 Ga0466959_0543336 3300045049 Bacteria 784
215 Ga0451576_0023758 3300045051 Bacteria 6633
216 Ga0451576_0167447 3300045051 Bacteria 2293
217 Ga0451576_0672748 3300045051 Unclassified 1088
218 Ga0495592_0053143 3300046454 Unclassified 3005
219 Ga0495603_0001269 3300046455 Bacteria 14699
220 Ga0495629_0003102 3300046459 Bacteria 12601
221 Ga0495653_0332440 3300046463 Bacteria 982
222 Ga0495580_0003053 3300046472 Bacteria 14337
223 Ga0495582_0000359 3300046473 Bacteria 24917
224 Ga0495639_0000318 3300046475 Bacteria 23428
225 Ga0495594_0109214 3300046499 Bacteria 1559
226 Ga0495608_0951118 3300046511 Unclassified 501
227 Ga0495630_0006094 3300046517 Bacteria 8547
228 Ga0495630_0416741 3300046517 Bacteria 1029
229 Ga0495663_0025659 3300046525 Bacteria 1720
230 Ga0495642_0136965 3300046528 Unclassified 1056
231 Ga0495642_0371847 3300046528 Unclassified 629
232 Ga0495665_0001520 3300046531 Bacteria 12371
233 Ga0495640_0179705 3300046533 Bacteria 1349
234 Ga0495586_0517619 3300046535 Bacteria 689
235 Ga0495621_0091613 3300046539 Bacteria 1146
236 Ga0495622_0234656 3300046557 Bacteria 810
237 Ga0495635_0053901 3300046663 Bacteria 2770
238 Ga0495588_0014101 3300046674 Bacteria 3820
239 Ga0495657_0435506 3300046675 Bacteria 769
240 Ga0495658_0001340 3300046683 Bacteria 12931
241 Ga0495669_0080693 3300046684 Bacteria 1493
242 Ga0495613_0007086 3300046689 Bacteria 8348
243 Ga0495581_0001480 3300047315 Bacteria 13074
244 Ga0495581_0815592 3300047315 Unclassified 535
245 Ga0495674_0104981 3300047319 Bacteria 2402
246 Ga0495677_0060058 3300047445 Bacteria 1409
247 Ga0495593_0000462 3300047673 Bacteria 22828
248 Ga0495614_0000385 3300048089 Bacteria 17880
249 Ga0496102_0211526 3300048905 Bacteria 1828
250 Ga0496105_0431228 3300048908 Unclassified 1043
251 Ga0496106_0261424 3300048909 Bacteria 1385
252 Ga0496106_0502896 3300048909 Bacteria 973
253 Ga0496107_0116762 3300048910 Bacteria 1965
254 Ga0496109_0751321 3300048912 Bacteria 913
255 Ga0496112_1329027 3300048915 Unclassified 634
256 Ga0496114_0000067 3300048917 Bacteria 76074
257 Ga0501031_0578351 3300049568 Bacteria 723
258 Ga0501032_0492212 3300049569 Bacteria 784
259 Ga0501034_0426787 3300049571 Bacteria 1246
260 Ga0501036_0526530 3300049572 Bacteria 983
261 Ga0501040_0097394 3300049576 Bacteria 2049
262 Ga0501040_0722941 3300049576 Bacteria 720
263 Ga0501041_0058653 3300049577 Bacteria 2355
264 Ga0501041_0092284 3300049577 Bacteria 1870
265 Ga0501042_0118369 3300049578 Bacteria 1907
266 Ga0501042_0709705 3300049578 Bacteria 731
267 Ga0501042_0790082 3300049578 Bacteria 691
268 Ga0501048_0549689 3300049582 Bacteria 828
269 Ga0501068_0284491 3300049584 Bacteria 1057
270 Ga0501068_0582687 3300049584 Bacteria 728
271 Ga0501070_0762125 3300049586 Bacteria 762
272 Ga0501071_0003392 3300049587 Bacteria 9953
273 Ga0501072_0058901 3300049588 Unclassified 3028
274 Ga0501073_0519134 3300049589 Bacteria 823
275 Ga0501075_0252073 3300049591 Bacteria 1345
276 Ga0501075_0274248 3300049591 Bacteria 1285
277 Ga0501076_0066866 3300049592 Bacteria 2869
278 Ga0501076_0169521 3300049592 Bacteria 1779
279 Ga0501077_0197006 3300049593 Bacteria 1280
280 Ga0501077_0362703 3300049593 Bacteria 925
281 Ga0501079_0040723 3300049741 Unclassified 3585
282 Ga0501079_0120897 3300049741 Bacteria 2037
283 Ga0501080_0190288 3300049742 Bacteria 1886
284 Ga0501080_0946253 3300049742 Unclassified 749
285 nmdc:mga05p37_2253917_c1 3300050507 Bacteria 503
286 nmdc:mga05p37_3314_c1 3300050507 Bacteria 18785
287 nmdc:mga05p37_76964_c1 3300050507 Unclassified 4107
288 nmdc:mga09592_349827_c1 3300050508 Unclassified 1279
289 nmdc:mga09592_419915_c1 3300050508 Bacteria 1155
290 nmdc:mga09592_855426_c1 3300050508 Unclassified 767
291 nmdc:mga0qj67_420054_c1 3300050509 Unclassified 1078
292 nmdc:mga0qj67_984540_c1 3300050509 Bacteria 662
293 nmdc:mga08y16_885912_c1 3300050511 Bacteria 880
294 nmdc:mga0n895_229735_c1 3300050512 Bacteria 1883
295 nmdc:mga0n895_386848_c1 3300050512 Unclassified 1415
296 nmdc:mga0rr50_1586183_c1 3300050513 Bacteria 553
297 nmdc:mga0rr50_220571_c1 3300050513 Unclassified 1566
298 nmdc:mga08x19_238440_c1 3300050514 Bacteria 1253
299 Ga0495595_0652402 3300053084 Bacteria 539
300 Ga0495619_0120090 3300053085 Unclassified 1802
301 Ga0495619_0165177 3300053085 Unclassified 1530
302 Ga0500646_0063049 3300053090 Bacteria 1095
303 Ga0500568_0060186 3300053139 Bacteria 1471
304 Ga0501084_0428040 3300054114 Bacteria 1119
305 Ga0501084_1090573 3300054114 Bacteria 670
306 Ga0501082_0115855 3300060353 Bacteria 2321
307 Ga0530510_0032615 3300061734 Bacteria 3748
308 Ga0530510_0273786 3300061734 Bacteria 1260
309 Ga0070714_100401814
310 JGI24749J21850_1015893
311 JGI24749J21850_1022754
312 Ga0065715_10181079
313 Ga0065707_10402630
314 Ga0070690_100006943
315 Ga0070690_100164981
316 Ga0068869_100964240
317 Ga0068869_101331280
318 Ga0068868_101763681
319 Ga0070689_100856234
320 Ga0070687_100092876
321 Ga0070669_100286621
322 Ga0070669_100687652
323 Ga0070675_100000083
324 Ga0070675_101904754
325 Ga0070671_101373721
326 Ga0070673_100494185
327 Ga0070659_100809649
328 Ga0070667_100046641
329 Ga0070703_10024837
330 Ga0070703_10404270
331 Ga0070709_10238143
332 Ga0070714_100049389
333 Ga0070714_100992349
334 Ga0070713_100006634
335 Ga0070710_10838797
336 Ga0070710_10840047
337 Ga0070701_11372662
338 Ga0070711_100405306
339 Ga0070711_100943598
340 Ga0070711_101976905
341 Ga0070705_100060799
342 Ga0070705_100475227
343 Ga0070705_100712697
344 Ga0070694_100160001
345 Ga0070708_100059406
346 Ga0070708_100309438
347 Ga0070708_100680734
348 Ga0070662_100228106
349 Ga0070662_100485400
350 Ga0070681_10067520
351 Ga0068867_100438313
352 Ga0070706_100011191
353 Ga0070706_100013573
354 Ga0070706_100040039
355 Ga0070706_100146350
356 Ga0070707_100006880
357 Ga0070707_100436491
358 Ga0070698_100032370
359 Ga0070698_100105931
360 Ga0070698_101571134
361 Ga0070699_100877354
362 Ga0070699_101172048
363 Ga0070697_100401033
364 Ga0070672_100524645
365 Ga0070686_100002474
366 Ga0070686_100086517
367 Ga0070686_100915795
368 Ga0070695_100301654
369 Ga0070695_100335133
370 Ga0070696_100542988
371 Ga0070696_100735200
372 Ga0070693_100171127
373 Ga0068854_100192720
374 Ga0068854_100327627
375 Ga0068854_100472947
376 Ga0068852_100487220
377 Ga0068861_100390475
378 Ga0068870_10085291
379 Ga0068858_100789869
380 Ga0068860_100517237
381 Ga0068860_101858603
382 Ga0070717_10150844
383 Ga0070717_10345235
384 Ga0070715_10647361
385 Ga0070716_100694209
386 Ga0070712_100264930
387 Ga0070712_100961205
388 Ga0097621_102059290
389 Ga0075428_100225886
390 Ga0075428_101504151
391 Ga0075431_100038047
392 Ga0075431_100389085
393 Ga0075434_100097850
394 Ga0075434_100485173
395 Ga0075434_100826703
396 Ga0075434_100878857
397 Ga0075434_101936588
398 Ga0075429_100287390
399 Ga0075429_100306244
400 Ga0075429_100672376
401 Ga0075436_100230001
402 Ga0075435_100002161
403 Ga0099794_10781746
404 Ga0105240_10353712
405 Ga0105240_10824991
406 Ga0105240_12679774
407 Ga0111539_10022875
408 Ga0105245_10582464
409 Ga0105245_10784962
410 Ga0105247_11733893
411 Ga0114129_10023117
412 Ga0114129_10055037
413 Ga0114129_10072934
414 Ga0114129_10210122
415 Ga0114129_10223674
416 Ga0105243_11531357
417 Ga0105241_10868974
418 Ga0105242_11377738
419 Ga0105242_12402269
420 Ga0105248_10429784
421 Ga0105248_10549838
422 Ga0163162_12464198
423 Ga0157380_12162581
424 Ga0157379_10988135
425 Ga0157379_12514722
426 Ga0207653_10101183
427 Ga0207653_10297118
428 Ga0207692_10858473
429 Ga0207692_11089112
430 Ga0207680_10091902
431 Ga0207699_10123560
432 Ga0207643_10094415
433 Ga0207705_10015582
434 Ga0207684_10003316
435 Ga0207684_10026656
436 Ga0207684_10034405
437 Ga0207684_11302485
438 Ga0207695_10596814
439 Ga0207695_11137432
440 Ga0207693_10027652
441 Ga0207693_10579544
442 Ga0207663_10194814
443 Ga0207663_10741592
444 Ga0207662_10042622
445 Ga0207646_10007828
446 Ga0207646_10814894
447 Ga0207646_11126873
448 Ga0207646_11291059
449 Ga0207681_10666744
450 Ga0207687_11407781
451 Ga0207700_10302281
452 Ga0207664_10293690
453 Ga0207664_11219437
454 Ga0207664_11438708
455 Ga0207644_10296394
456 Ga0207690_10650520
457 Ga0207706_10887188
458 Ga0207709_10702482
459 Ga0207665_11285785
460 Ga0207711_10297609
461 Ga0207711_10936087
462 Ga0207667_11690351
463 Ga0207651_10530541
464 Ga0207640_10223608
465 Ga0207640_10424911
466 Ga0207658_10352204
467 Ga0207703_10150057
468 Ga0207708_11019709
469 Ga0207675_100359000
470 Ga0207675_100420493
471 Ga0207698_11951904
472 Ga0207428_10044922
473 Ga0268265_11927226
474 Ga0268264_10529172
475 Ga0268264_10708787
476 Ga0268264_12144652
477 Ga0307513_10999828
478 Ga0307409_101801693
479 Ga0307416_101000869
480 Ga0307416_101137752
481 Ga0373930_0002978
482 Ga0373950_0006889
483 Ga0373959_0001845
484 Ga0373938_0004972
485 Ga0373926_0005678
486 Ga0373929_0000150
487 Ga0373940_0000915
488 Ga0373944_0021149
489 Ga0373949_0001954
490 Ga0373951_0001412
491 Ga0373952_0000685
492 Ga0373932_0002593
493 Ga0373939_0000957
494 Ga0373941_0000768
495 Ga0373945_0014695
496 Ga0373960_0000671
497 Ga0373943_0002557
498 Ga0373946_0010548
499 Ga0373942_0005861
500 Ga0373961_0001385
501 Ga0373962_0006856
502 Ga0373931_0001502
503 Ga0373935_0544618
504 Ga0373927_0013489
505 Ga0373947_0001194
506 Ga0373937_1134138
507 Ga0373925_0003617
508 Ga0373925_0814161
509 Ga0395899_0220870
510 Ga0395898_0925120
511 Ga0395898_1562302
512 Ga0436364_1141981
513 Ga0395901_0144375
514 Ga0395901_0756739
515 Ga0436362_0256227
516 Ga0439453_0026073
517 Ga0439461_0063659
518 Ga0451807_2451476
519 Ga0439451_090837
520 Ga0453684_2212153
521 Ga0466971_0223027
522 Ga0466959_0543336
523 Ga0451576_0023758
524 Ga0451576_0167447
525 Ga0451576_0672748
526 Ga0495592_0053143
527 Ga0495603_0001269
528 Ga0495629_0003102
529 Ga0495653_0332440
530 Ga0495580_0003053
531 Ga0495582_0000359
532 Ga0495639_0000318
533 Ga0495594_0109214
534 Ga0495608_0951118
535 Ga0495630_0006094
536 Ga0495630_0416741
537 Ga0495663_0025659
538 Ga0495642_0136965
539 Ga0495642_0371847
540 Ga0495665_0001520
541 Ga0495640_0179705
542 Ga0495586_0517619
543 Ga0495621_0091613
544 Ga0495622_0234656
545 Ga0495635_0053901
546 Ga0495588_0014101
547 Ga0495657_0435506
548 Ga0495658_0001340
549 Ga0495669_0080693
550 Ga0495613_0007086
551 Ga0495581_0001480
552 Ga0495581_0815592
553 Ga0495674_0104981
554 Ga0495677_0060058
555 Ga0495593_0000462
556 Ga0495614_0000385
557 Ga0496102_0211526
558 Ga0496105_0431228
559 Ga0496106_0261424
560 Ga0496106_0502896
561 Ga0496107_0116762
562 Ga0496109_0751321
563 Ga0496112_1329027
564 Ga0496114_0000067
565 Ga0501031_0578351
566 Ga0501032_0492212
567 Ga0501034_0426787
568 Ga0501036_0526530
569 Ga0501040_0097394
570 Ga0501040_0722941
571 Ga0501041_0058653
572 Ga0501041_0092284
573 Ga0501042_0118369
574 Ga0501042_0709705
575 Ga0501042_0790082
576 Ga0501048_0549689
577 Ga0501068_0284491
578 Ga0501068_0582687
579 Ga0501070_0762125
580 Ga0501071_0003392
581 Ga0501072_0058901
582 Ga0501073_0519134
583 Ga0501075_0252073
584 Ga0501075_0274248
585 Ga0501076_0066866
586 Ga0501076_0169521
587 Ga0501077_0197006
588 Ga0501077_0362703
589 Ga0501079_0040723
590 Ga0501079_0120897
591 Ga0501080_0190288
592 Ga0501080_0946253
593 nmdc:mga05p37_2253917_c1
594 nmdc:mga05p37_3314_c1
595 nmdc:mga05p37_76964_c1
596 nmdc:mga09592_349827_c1
597 nmdc:mga09592_419915_c1
598 nmdc:mga09592_855426_c1
599 nmdc:mga0qj67_420054_c1
600 nmdc:mga0qj67_984540_c1
601 nmdc:mga08y16_885912_c1
602 nmdc:mga0n895_229735_c1
603 nmdc:mga0n895_386848_c1
604 nmdc:mga0rr50_1586183_c1
605 nmdc:mga0rr50_220571_c1
606 nmdc:mga08x19_238440_c1
607 Ga0495595_0652402
608 Ga0495619_0120090
609 Ga0495619_0165177
610 Ga0500646_0063049
611 Ga0500568_0060186
612 Ga0501084_0428040
613 Ga0501084_1090573
614 Ga0501082_0115855
615 Ga0530510_0032615
616 Ga0530510_0273786

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map