F400066

General Info

Members Datasets Scaffolds Average Seq Length
309 196 618 256

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100005778|Ga0070673_1000057789
Length 287
Sequence MRRVDLGRCFTGDILDGSLNLKVTVLGSGTSHGVPAIGCDCAVCRSTDPRDRRTRPSILIEMRSNGPQPPFATAVRSILVDTSTDLRAQALANHVRRIDAILFTHGHADHVLGIDETRRFNEMQQTPIGCYANADTVAGLRRMFSYIFAPAAQWGGGIPQLRLFSIAGAFTMGGAEIVPIPLFHGELPVFGFRVGPFAYLTDCNRIPDESWPLLTNGGGIRVLLLDALRELVHPTHFNISQALEVVSRIKPERAFLTHICHDLQHAATCARLPAGVELAYDGLVLEI

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
171 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
196 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 3.88
Rhizosphere 95.15
Stem 0
Stem Tuber 0
Unclassified 7.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100005778 3300005364 Bacteria 7965
2 Ga0065714_10093097 3300005288 Bacteria 1857
3 Ga0065714_10141472 3300005288 Bacteria 1168
4 Ga0065704_10003110 3300005289 Bacteria 5868
5 Ga0065712_10069296 3300005290 Bacteria 7579
6 Ga0065712_10090609 3300005290 Bacteria 2392
7 Ga0065712_10260195 3300005290 Bacteria 931
8 Ga0065707_10001746 3300005295 Bacteria 9735
9 Ga0065707_10005806 3300005295 Bacteria 2865
10 Ga0065707_10110016 3300005295 Bacteria 2447
11 Ga0065707_10204437 3300005295 Bacteria 1292
12 Ga0070690_100073024 3300005330 Bacteria 2232
13 Ga0070670_100003569 3300005331 Bacteria 12941
14 Ga0070677_10112011 3300005333 Unclassified 1220
15 Ga0068869_100094137 3300005334 Bacteria 2258
16 Ga0070666_10115289 3300005335 Unclassified 1861
17 Ga0070687_100021751 3300005343 Bacteria 3021
18 Ga0070673_100004711 3300005364 Bacteria 8657
19 Ga0070673_100090933 3300005364 Bacteria 2494
20 Ga0070703_10073404 3300005406 Bacteria 1148
21 Ga0070713_100014490 3300005436 Bacteria 5859
22 Ga0070700_100156878 3300005441 Bacteria 1563
23 Ga0070694_100025394 3300005444 Bacteria 3833
24 Ga0070708_100274452 3300005445 Bacteria 1586
25 Ga0070678_100281474 3300005456 Unclassified 1407
26 Ga0070662_100038362 3300005457 Bacteria 3403
27 Ga0070685_10391688 3300005466 Unclassified 960
28 Ga0070706_100590181 3300005467 Unclassified 1033
29 Ga0070706_100728835 3300005467 Bacteria 919
30 Ga0070698_100046315 3300005471 Bacteria 4447
31 Ga0070699_100102067 3300005518 Bacteria 2515
32 Ga0070684_100070792 3300005535 Bacteria 3070
33 Ga0068853_100004708 3300005539 Bacteria 10591
34 Ga0070695_100000900 3300005545 Bacteria 16056
35 Ga0070696_100181023 3300005546 Bacteria 1564
36 Ga0070665_100126358 3300005548 Bacteria 2560
37 Ga0070704_100308397 3300005549 Bacteria 1322
38 Ga0070664_100110576 3300005564 Bacteria 2398
39 Ga0068859_100072582 3300005617 Bacteria 3478
40 Ga0068859_100161187 3300005617 Bacteria 2322
41 Ga0068859_100515704 3300005617 Bacteria 1290
42 Ga0068859_100873820 3300005617 Bacteria 985
43 Ga0068863_100072150 3300005841 Bacteria 3267
44 Ga0068858_100336288 3300005842 Bacteria 1445
45 Ga0070717_10198752 3300006028 Bacteria 1755
46 Ga0075367_10226282 3300006178 Bacteria 1171
47 Ga0097621_100366168 3300006237 Bacteria 1285
48 Ga0068871_100330036 3300006358 Bacteria 1345
49 Ga0075428_100000215 3300006844 Bacteria 55598
50 Ga0075428_100084248 3300006844 Bacteria 3469
51 Ga0075430_100139682 3300006846 Bacteria 2017
52 Ga0075430_100321628 3300006846 Bacteria 1279
53 Ga0075431_100002961 3300006847 Bacteria 16438
54 Ga0075431_100010300 3300006847 Bacteria 9393
55 Ga0075431_100030805 3300006847 Bacteria 5525
56 Ga0075431_100064638 3300006847 Bacteria 3778
57 Ga0075434_100002852 3300006871 Bacteria 15324
58 Ga0075434_100069636 3300006871 Bacteria 3507
59 Ga0075434_100121619 3300006871 Bacteria 2626
60 Ga0075434_100179580 3300006871 Bacteria 2136
61 Ga0075434_100240522 3300006871 Bacteria 1830
62 Ga0075434_100378373 3300006871 Bacteria 1437
63 Ga0075429_100120481 3300006880 Bacteria 2293
64 Ga0075436_100011854 3300006914 Bacteria 5981
65 Ga0097620_100072588 3300006931 Bacteria 3478
66 Ga0097620_100161178 3300006931 Bacteria 2322
67 Ga0097620_100515703 3300006931 Bacteria 1290
68 Ga0097620_100873824 3300006931 Bacteria 985
69 Ga0075435_100005177 3300007076 Bacteria 9070
70 Ga0075435_100050715 3300007076 Bacteria 3340
71 Ga0105240_10001489 3300009093 Bacteria 39873
72 Ga0111539_10004620 3300009094 Bacteria 17972
73 Ga0111539_10012335 3300009094 Bacteria 10709
74 Ga0111539_10357564 3300009094 Bacteria 1699
75 Ga0111539_10512935 3300009094 Bacteria 1397
76 Ga0111539_10589583 3300009094 Bacteria 1294
77 Ga0111539_10628479 3300009094 Bacteria 1250
78 Ga0111539_10641196 3300009094 Bacteria 1237
79 Ga0105247_10008802 3300009101 Bacteria 6153
80 Ga0114129_10011667 3300009147 Bacteria 12506
81 Ga0114129_10053517 3300009147 Bacteria 5661
82 Ga0114129_10132950 3300009147 Bacteria 3416
83 Ga0114129_10179985 3300009147 Bacteria 2877
84 Ga0114129_10202400 3300009147 Bacteria 2688
85 Ga0114129_10566503 3300009147 Bacteria 1475
86 Ga0105242_10508990 3300009176 Bacteria 1146
87 Ga0105242_10945615 3300009176 Unclassified 865
88 Ga0105248_10059022 3300009177 Bacteria 4309
89 Ga0105238_10000058 3300009551 Bacteria 130734
90 Ga0105246_10198617 3300011119 Bacteria 1557
91 Ga0157378_10094774 3300013297 Bacteria 2718
92 Ga0163163_10017338 3300014325 Bacteria 6715
93 Ga0163163_10393872 3300014325 Bacteria 1443
94 Ga0157380_10021467 3300014326 Bacteria 4843
95 Ga0157377_10485353 3300014745 Bacteria 860
96 Ga0157379_10312670 3300014968 Bacteria 1433
97 Ga0157376_10189807 3300014969 Bacteria 1884
98 Ga0207688_10096766 3300025901 Bacteria 1700
99 Ga0207680_10225884 3300025903 Unclassified 1285
100 Ga0207680_10247417 3300025903 Unclassified 1230
101 Ga0207707_10434360 3300025912 Bacteria 1124
102 Ga0207695_10032038 3300025913 Bacteria 5757
103 Ga0207660_10069021 3300025917 Bacteria 2565
104 Ga0207662_10024088 3300025918 Bacteria 3502
105 Ga0207694_10001529 3300025924 Bacteria 19705
106 Ga0207650_10039000 3300025925 Bacteria 3472
107 Ga0207700_10076826 3300025928 Bacteria 2592
108 Ga0207706_10124253 3300025933 Bacteria 2270
109 Ga0207686_10044168 3300025934 Bacteria 2735
110 Ga0207670_10184794 3300025936 Bacteria 1573
111 Ga0207689_10045168 3300025942 Unclassified 3644
112 Ga0207661_10148473 3300025944 Unclassified 2025
113 Ga0207679_10229885 3300025945 Bacteria 1565
114 Ga0207651_10018263 3300025960 Bacteria 4168
115 Ga0207651_10075760 3300025960 Bacteria 2402
116 Ga0207651_10550156 3300025960 Unclassified 1003
117 Ga0207639_10035300 3300026041 Bacteria 3699
118 Ga0207708_10048776 3300026075 Bacteria 3224
119 Ga0207708_10083356 3300026075 Bacteria 2457
120 Ga0207648_10087452 3300026089 Unclassified 2720
121 Ga0207676_10274181 3300026095 Bacteria 1529
122 Ga0207676_10644758 3300026095 Bacteria 1021
123 Ga0207683_10096405 3300026121 Bacteria 2637
124 Ga0207683_10578083 3300026121 Bacteria 1039
125 Ga0209974_10015523 3300027876 Bacteria 2528
126 Ga0207428_10059884 3300027907 Bacteria 3017
127 Ga0207428_10082514 3300027907 Bacteria 2508
128 Ga0207428_10085133 3300027907 Bacteria 2463
129 Ga0207428_10217209 3300027907 Bacteria 1434
130 Ga0268266_10084259 3300028379 Bacteria 2776
131 Ga0268264_10239026 3300028381 Bacteria 1681
132 Ga0268264_10256816 3300028381 Bacteria 1626
133 Ga0265337_1001609 3300028556 Bacteria 11005
134 Ga0265334_10034174 3300028573 Bacteria 2019
135 Ga0265338_10011599 3300028800 Bacteria 10158
136 Ga0307408_100053132 3300031548 Bacteria 2924
137 Ga0307413_10005928 3300031824 Bacteria 5523
138 Ga0307413_10024554 3300031824 Bacteria 3288
139 Ga0307413_10361294 3300031824 Bacteria 1124
140 Ga0307410_10016169 3300031852 Bacteria 4443
141 Ga0307410_10033356 3300031852 Bacteria 3323
142 Ga0307406_10052981 3300031901 Bacteria 2583
143 Ga0307407_10291071 3300031903 Bacteria 1135
144 Ga0307412_10025302 3300031911 Bacteria 3675
145 Ga0307412_10203422 3300031911 Bacteria 1505
146 Ga0307409_100030182 3300031995 Bacteria 3891
147 Ga0307409_100073831 3300031995 Bacteria 2722
148 Ga0307409_100290204 3300031995 Bacteria 1517
149 Ga0307409_100495717 3300031995 Bacteria 1188
150 Ga0307416_100002140 3300032002 Bacteria 11173
151 Ga0307416_100019822 3300032002 Bacteria 4779
152 Ga0307414_10502320 3300032004 Bacteria 1073
153 Ga0307411_10099648 3300032005 Bacteria 2051
154 Ga0307415_100045082 3300032126 Bacteria 2954
155 Ga0307415_100046323 3300032126 Bacteria 2920
156 Ga0373934_0236313 3300035086 Bacteria 754
157 Ga0373939_0031827 3300035114 Bacteria 1528
158 Ga0373941_0040483 3300035115 Bacteria 1437
159 Ga0373956_0081948 3300035119 Bacteria 1481
160 Ga0373955_0149266 3300035172 Bacteria 1375
161 Ga0373924_0183967 3300035410 Bacteria 920
162 Ga0373935_0302454 3300035692 Bacteria 1131
163 Ga0373933_0036832 3300035724 Bacteria 2866
164 Ga0373937_0014581 3300036401 Bacteria 6943
165 Ga0373937_0015464 3300036401 Bacteria 6748
166 Ga0373937_0015960 3300036401 Bacteria 6660
167 Ga0373937_0165627 3300036401 Bacteria 2073
168 Ga0373937_0206063 3300036401 Bacteria 1849
169 Ga0373925_0453706 3300037068 Unclassified 1050
170 Ga0373925_0555786 3300037068 Bacteria 944
171 Ga0451853_0735178 3300041512 Bacteria 1505
172 Ga0453683_0100182 3300044673 Bacteria 1819
173 Ga0466963_0027695 3300044694 Bacteria 3632
174 Ga0451576_0056435 3300045051 Bacteria 4107
175 Ga0451576_0107275 3300045051 Unclassified 2906
176 Ga0451576_0451555 3300045051 Unclassified 1349
177 Ga0466967_0216277 3300045976 Bacteria 1819
178 Ga0495603_0304897 3300046455 Bacteria 915
179 Ga0495629_0000126 3300046459 Bacteria 66833
180 Ga0495629_0038359 3300046459 Bacteria 3375
181 Ga0495629_0105208 3300046459 Bacteria 1968
182 Ga0495582_0109616 3300046473 Bacteria 1550
183 Ga0495639_0013350 3300046475 Bacteria 3546
184 Ga0495662_0192211 3300046476 Bacteria 1006
185 Ga0495594_0020179 3300046499 Bacteria 3549
186 Ga0495628_0428785 3300046516 Bacteria 963
187 Ga0495630_0451225 3300046517 Bacteria 985
188 Ga0495643_0001268 3300046522 Bacteria 24192
189 Ga0495586_0141940 3300046535 Bacteria 1348
190 Ga0495587_0155346 3300046536 Bacteria 1303
191 Ga0495598_0035989 3300046537 Bacteria 1420
192 Ga0495645_0009401 3300046543 Bacteria 6833
193 Ga0495634_0073732 3300046642 Bacteria 2244
194 Ga0495635_0012911 3300046663 Bacteria 5849
195 Ga0495635_0046832 3300046663 Bacteria 2983
196 Ga0495659_0019149 3300046664 Bacteria 2289
197 Ga0495599_0288301 3300046678 Bacteria 993
198 Ga0495658_0000010 3300046683 Bacteria 108086
199 Ga0495613_0019017 3300046689 Bacteria 5118
200 Ga0495670_0031387 3300046691 Bacteria 2640
201 Ga0495600_0322457 3300046809 Bacteria 971
202 Ga0495581_0005681 3300047315 Bacteria 7234
203 Ga0495674_0167320 3300047319 Bacteria 1836
204 Ga0495680_0000703 3300047322 Bacteria 37506
205 Ga0495680_0235776 3300047322 Bacteria 1301
206 Ga0495675_0337166 3300047444 Bacteria 889
207 Ga0495684_0044688 3300047471 Bacteria 3391
208 Ga0495615_0034577 3300048090 Bacteria 1231
209 Ga0496100_0738060 3300048903 Bacteria 770
210 Ga0496104_0050497 3300048907 Bacteria 3924
211 Ga0496104_0443599 3300048907 Bacteria 1210
212 Ga0496104_0449768 3300048907 Bacteria 1200
213 Ga0496105_0602966 3300048908 Bacteria 852
214 Ga0496108_0725262 3300048911 Bacteria 861
215 Ga0496109_0813738 3300048912 Unclassified 872
216 Ga0496112_0015529 3300048915 Bacteria 7111
217 Ga0496113_0025491 3300048916 Bacteria 4215
218 Ga0496113_0251022 3300048916 Bacteria 1412
219 Ga0496114_0019109 3300048917 Bacteria 5552
220 Ga0496115_0050348 3300048918 Bacteria 3337
221 Ga0501298_010088 3300049521 Bacteria 1618
222 Ga0501033_0489295 3300049570 Unclassified 852
223 Ga0501034_0056598 3300049571 Unclassified 3945
224 Ga0501034_0627098 3300049571 Unclassified 979
225 Ga0501036_0071161 3300049572 Bacteria 2941
226 Ga0501038_0089370 3300049574 Bacteria 2584
227 Ga0501039_0034290 3300049575 Bacteria 3917
228 Ga0501039_0283936 3300049575 Bacteria 1301
229 Ga0501039_0332054 3300049575 Bacteria 1195
230 Ga0501040_0049333 3300049576 Bacteria 2878
231 Ga0501040_0165754 3300049576 Bacteria 1563
232 Ga0501041_0037305 3300049577 Bacteria 2945
233 Ga0501041_0090543 3300049577 Bacteria 1888
234 Ga0501042_0003910 3300049578 Bacteria 9429
235 Ga0501042_0020330 3300049578 Bacteria 4620
236 Ga0501042_0139866 3300049578 Bacteria 1745
237 Ga0501042_0252757 3300049578 Bacteria 1272
238 Ga0501043_0066168 3300049579 Bacteria 2838
239 Ga0501043_0371954 3300049579 Bacteria 1083
240 Ga0501046_0049165 3300049580 Bacteria 3337
241 Ga0501047_0133188 3300049581 Unclassified 2366
242 Ga0501048_0071447 3300049582 Bacteria 2450
243 Ga0501048_0244849 3300049582 Bacteria 1272
244 Ga0501068_0092022 3300049584 Bacteria 1872
245 Ga0501071_0123016 3300049587 Bacteria 1924
246 Ga0501072_0100706 3300049588 Bacteria 2296
247 Ga0501073_0000652 3300049589 Bacteria 24366
248 Ga0501073_0217038 3300049589 Bacteria 1322
249 Ga0501074_0024614 3300049590 Bacteria 4375
250 Ga0501074_0197407 3300049590 Bacteria 1434
251 Ga0501075_0059160 3300049591 Bacteria 2886
252 Ga0501076_0024187 3300049592 Bacteria 4692
253 Ga0501077_0161156 3300049593 Bacteria 1424
254 Ga0501249_008333 3300049679 Bacteria 2152
255 Ga0501225_0045138 3300049705 Bacteria 1220
256 Ga0501079_0087830 3300049741 Bacteria 2407
257 Ga0501080_0202277 3300049742 Bacteria 1823
258 Ga0501081_0214162 3300049743 Bacteria 1400
259 Ga0501083_0146557 3300049744 Unclassified 1546
260 Ga0501035_0061034 3300049822 Bacteria 3356
261 Ga0501044_0033652 3300049823 Bacteria 5384
262 Ga0501045_0073558 3300049824 Bacteria 2517
263 Ga0501045_0079175 3300049824 Bacteria 2423
264 nmdc:mga05p37_1238_c1 3300050507 Bacteria 29628
265 nmdc:mga05p37_142360_c1 3300050507 Bacteria 2937
266 nmdc:mga05p37_315468_c1 3300050507 Bacteria 1852
267 nmdc:mga05p37_331284_c1 3300050507 Bacteria 1798
268 nmdc:mga05p37_419907_c1 3300050507 Bacteria 1557
269 nmdc:mga05p37_606334_c1 3300050507 Bacteria 1235
270 nmdc:mga05p37_650073_c1 3300050507 Bacteria 1181
271 nmdc:mga09592_107765_c1 3300050508 Bacteria 2390
272 nmdc:mga09592_11653_c1 3300050508 Bacteria 6525
273 nmdc:mga09592_589193_c1 3300050508 Bacteria 953
274 nmdc:mga09592_652235_c1 3300050508 Bacteria 898
275 nmdc:mga0qj67_164728_c1 3300050509 Bacteria 1799
276 nmdc:mga0qj67_48550_c1 3300050509 Bacteria 3353
277 nmdc:mga0qj67_58547_c1 3300050509 Bacteria 3055
278 nmdc:mga06r32_13640_c1 3300050510 Bacteria 7368
279 nmdc:mga06r32_179126_c1 3300050510 Bacteria 2105
280 nmdc:mga06r32_31373_c1 3300050510 Bacteria 4990
281 nmdc:mga08y16_101901_c1 3300050511 Unclassified 2989
282 nmdc:mga08y16_2475_c1 3300050511 Bacteria 18965
283 nmdc:mga08y16_364271_c1 3300050511 Bacteria 1484
284 nmdc:mga08y16_700413_c1 3300050511 Bacteria 1013
285 nmdc:mga0n895_100404_c1 3300050512 Bacteria 2902
286 nmdc:mga0n895_111394_c1 3300050512 Bacteria 2753
287 nmdc:mga0n895_40501_c1 3300050512 Bacteria 4525
288 nmdc:mga0n895_442396_c1 3300050512 Bacteria 1313
289 nmdc:mga0n895_79438_c1 3300050512 Bacteria 3267
290 nmdc:mga0rr50_621532_c1 3300050513 Unclassified 921
291 nmdc:mga0a205_41790_c1 3300050515 Bacteria 4416
292 nmdc:mga0a205_489817_c1 3300050515 Bacteria 1087
293 Ga0495601_0023277 3300053077 Bacteria 3806
294 Ga0495601_0073967 3300053077 Bacteria 2180
295 Ga0495601_0151236 3300053077 Bacteria 1515
296 Ga0495619_0063335 3300053085 Bacteria 2463
297 Ga0495619_0067784 3300053085 Bacteria 2383
298 Ga0495619_0128424 3300053085 Bacteria 1741
299 Ga0495619_0253666 3300053085 Bacteria 1219
300 Ga0501084_0088531 3300054114 Bacteria 2599
301 Ga0501084_0267990 3300054114 Bacteria 1442
302 Ga0501084_0538217 3300054114 Bacteria 987
303 Ga0590071_000013 3300059421 Bacteria 45701
304 Ga0590074_001313 3300059423 Bacteria 3957
305 Ga0590075_017600 3300059424 Unclassified 1762
306 Ga0590077_000214 3300059426 Bacteria 16646
307 Ga0501082_0167774 3300060353 Bacteria 1908
308 Ga0530510_0019788 3300061734 Bacteria 4783
309 2687235302 2684623219 Bacteria 8442773
310 Ga0070673_100005778
311 Ga0065714_10093097
312 Ga0065714_10141472
313 Ga0065704_10003110
314 Ga0065712_10069296
315 Ga0065712_10090609
316 Ga0065712_10260195
317 Ga0065707_10001746
318 Ga0065707_10005806
319 Ga0065707_10110016
320 Ga0065707_10204437
321 Ga0070690_100073024
322 Ga0070670_100003569
323 Ga0070677_10112011
324 Ga0068869_100094137
325 Ga0070666_10115289
326 Ga0070687_100021751
327 Ga0070673_100004711
328 Ga0070673_100090933
329 Ga0070703_10073404
330 Ga0070713_100014490
331 Ga0070700_100156878
332 Ga0070694_100025394
333 Ga0070708_100274452
334 Ga0070678_100281474
335 Ga0070662_100038362
336 Ga0070685_10391688
337 Ga0070706_100590181
338 Ga0070706_100728835
339 Ga0070698_100046315
340 Ga0070699_100102067
341 Ga0070684_100070792
342 Ga0068853_100004708
343 Ga0070695_100000900
344 Ga0070696_100181023
345 Ga0070665_100126358
346 Ga0070704_100308397
347 Ga0070664_100110576
348 Ga0068859_100072582
349 Ga0068859_100161187
350 Ga0068859_100515704
351 Ga0068859_100873820
352 Ga0068863_100072150
353 Ga0068858_100336288
354 Ga0070717_10198752
355 Ga0075367_10226282
356 Ga0097621_100366168
357 Ga0068871_100330036
358 Ga0075428_100000215
359 Ga0075428_100084248
360 Ga0075430_100139682
361 Ga0075430_100321628
362 Ga0075431_100002961
363 Ga0075431_100010300
364 Ga0075431_100030805
365 Ga0075431_100064638
366 Ga0075434_100002852
367 Ga0075434_100069636
368 Ga0075434_100121619
369 Ga0075434_100179580
370 Ga0075434_100240522
371 Ga0075434_100378373
372 Ga0075429_100120481
373 Ga0075436_100011854
374 Ga0097620_100072588
375 Ga0097620_100161178
376 Ga0097620_100515703
377 Ga0097620_100873824
378 Ga0075435_100005177
379 Ga0075435_100050715
380 Ga0105240_10001489
381 Ga0111539_10004620
382 Ga0111539_10012335
383 Ga0111539_10357564
384 Ga0111539_10512935
385 Ga0111539_10589583
386 Ga0111539_10628479
387 Ga0111539_10641196
388 Ga0105247_10008802
389 Ga0114129_10011667
390 Ga0114129_10053517
391 Ga0114129_10132950
392 Ga0114129_10179985
393 Ga0114129_10202400
394 Ga0114129_10566503
395 Ga0105242_10508990
396 Ga0105242_10945615
397 Ga0105248_10059022
398 Ga0105238_10000058
399 Ga0105246_10198617
400 Ga0157378_10094774
401 Ga0163163_10017338
402 Ga0163163_10393872
403 Ga0157380_10021467
404 Ga0157377_10485353
405 Ga0157379_10312670
406 Ga0157376_10189807
407 Ga0207688_10096766
408 Ga0207680_10225884
409 Ga0207680_10247417
410 Ga0207707_10434360
411 Ga0207695_10032038
412 Ga0207660_10069021
413 Ga0207662_10024088
414 Ga0207694_10001529
415 Ga0207650_10039000
416 Ga0207700_10076826
417 Ga0207706_10124253
418 Ga0207686_10044168
419 Ga0207670_10184794
420 Ga0207689_10045168
421 Ga0207661_10148473
422 Ga0207679_10229885
423 Ga0207651_10018263
424 Ga0207651_10075760
425 Ga0207651_10550156
426 Ga0207639_10035300
427 Ga0207708_10048776
428 Ga0207708_10083356
429 Ga0207648_10087452
430 Ga0207676_10274181
431 Ga0207676_10644758
432 Ga0207683_10096405
433 Ga0207683_10578083
434 Ga0209974_10015523
435 Ga0207428_10059884
436 Ga0207428_10082514
437 Ga0207428_10085133
438 Ga0207428_10217209
439 Ga0268266_10084259
440 Ga0268264_10239026
441 Ga0268264_10256816
442 Ga0265337_1001609
443 Ga0265334_10034174
444 Ga0265338_10011599
445 Ga0307408_100053132
446 Ga0307413_10005928
447 Ga0307413_10024554
448 Ga0307413_10361294
449 Ga0307410_10016169
450 Ga0307410_10033356
451 Ga0307406_10052981
452 Ga0307407_10291071
453 Ga0307412_10025302
454 Ga0307412_10203422
455 Ga0307409_100030182
456 Ga0307409_100073831
457 Ga0307409_100290204
458 Ga0307409_100495717
459 Ga0307416_100002140
460 Ga0307416_100019822
461 Ga0307414_10502320
462 Ga0307411_10099648
463 Ga0307415_100045082
464 Ga0307415_100046323
465 Ga0373934_0236313
466 Ga0373939_0031827
467 Ga0373941_0040483
468 Ga0373956_0081948
469 Ga0373955_0149266
470 Ga0373924_0183967
471 Ga0373935_0302454
472 Ga0373933_0036832
473 Ga0373937_0014581
474 Ga0373937_0015464
475 Ga0373937_0015960
476 Ga0373937_0165627
477 Ga0373937_0206063
478 Ga0373925_0453706
479 Ga0373925_0555786
480 Ga0451853_0735178
481 Ga0453683_0100182
482 Ga0466963_0027695
483 Ga0451576_0056435
484 Ga0451576_0107275
485 Ga0451576_0451555
486 Ga0466967_0216277
487 Ga0495603_0304897
488 Ga0495629_0000126
489 Ga0495629_0038359
490 Ga0495629_0105208
491 Ga0495582_0109616
492 Ga0495639_0013350
493 Ga0495662_0192211
494 Ga0495594_0020179
495 Ga0495628_0428785
496 Ga0495630_0451225
497 Ga0495643_0001268
498 Ga0495586_0141940
499 Ga0495587_0155346
500 Ga0495598_0035989
501 Ga0495645_0009401
502 Ga0495634_0073732
503 Ga0495635_0012911
504 Ga0495635_0046832
505 Ga0495659_0019149
506 Ga0495599_0288301
507 Ga0495658_0000010
508 Ga0495613_0019017
509 Ga0495670_0031387
510 Ga0495600_0322457
511 Ga0495581_0005681
512 Ga0495674_0167320
513 Ga0495680_0000703
514 Ga0495680_0235776
515 Ga0495675_0337166
516 Ga0495684_0044688
517 Ga0495615_0034577
518 Ga0496100_0738060
519 Ga0496104_0050497
520 Ga0496104_0443599
521 Ga0496104_0449768
522 Ga0496105_0602966
523 Ga0496108_0725262
524 Ga0496109_0813738
525 Ga0496112_0015529
526 Ga0496113_0025491
527 Ga0496113_0251022
528 Ga0496114_0019109
529 Ga0496115_0050348
530 Ga0501298_010088
531 Ga0501033_0489295
532 Ga0501034_0056598
533 Ga0501034_0627098
534 Ga0501036_0071161
535 Ga0501038_0089370
536 Ga0501039_0034290
537 Ga0501039_0283936
538 Ga0501039_0332054
539 Ga0501040_0049333
540 Ga0501040_0165754
541 Ga0501041_0037305
542 Ga0501041_0090543
543 Ga0501042_0003910
544 Ga0501042_0020330
545 Ga0501042_0139866
546 Ga0501042_0252757
547 Ga0501043_0066168
548 Ga0501043_0371954
549 Ga0501046_0049165
550 Ga0501047_0133188
551 Ga0501048_0071447
552 Ga0501048_0244849
553 Ga0501068_0092022
554 Ga0501071_0123016
555 Ga0501072_0100706
556 Ga0501073_0000652
557 Ga0501073_0217038
558 Ga0501074_0024614
559 Ga0501074_0197407
560 Ga0501075_0059160
561 Ga0501076_0024187
562 Ga0501077_0161156
563 Ga0501249_008333
564 Ga0501225_0045138
565 Ga0501079_0087830
566 Ga0501080_0202277
567 Ga0501081_0214162
568 Ga0501083_0146557
569 Ga0501035_0061034
570 Ga0501044_0033652
571 Ga0501045_0073558
572 Ga0501045_0079175
573 nmdc:mga05p37_1238_c1
574 nmdc:mga05p37_142360_c1
575 nmdc:mga05p37_315468_c1
576 nmdc:mga05p37_331284_c1
577 nmdc:mga05p37_419907_c1
578 nmdc:mga05p37_606334_c1
579 nmdc:mga05p37_650073_c1
580 nmdc:mga09592_107765_c1
581 nmdc:mga09592_11653_c1
582 nmdc:mga09592_589193_c1
583 nmdc:mga09592_652235_c1
584 nmdc:mga0qj67_164728_c1
585 nmdc:mga0qj67_48550_c1
586 nmdc:mga0qj67_58547_c1
587 nmdc:mga06r32_13640_c1
588 nmdc:mga06r32_179126_c1
589 nmdc:mga06r32_31373_c1
590 nmdc:mga08y16_101901_c1
591 nmdc:mga08y16_2475_c1
592 nmdc:mga08y16_364271_c1
593 nmdc:mga08y16_700413_c1
594 nmdc:mga0n895_100404_c1
595 nmdc:mga0n895_111394_c1
596 nmdc:mga0n895_40501_c1
597 nmdc:mga0n895_442396_c1
598 nmdc:mga0n895_79438_c1
599 nmdc:mga0rr50_621532_c1
600 nmdc:mga0a205_41790_c1
601 nmdc:mga0a205_489817_c1
602 Ga0495601_0023277
603 Ga0495601_0073967
604 Ga0495601_0151236
605 Ga0495619_0063335
606 Ga0495619_0067784
607 Ga0495619_0128424
608 Ga0495619_0253666
609 Ga0501084_0088531
610 Ga0501084_0267990
611 Ga0501084_0538217
612 Ga0590071_000013
613 Ga0590074_001313
614 Ga0590075_017600
615 Ga0590077_000214
616 Ga0501082_0167774
617 Ga0530510_0019788
618 2687235302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

66

120

0.91

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

76

259

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9621 1 262
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9583 1 262
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.958 5 263
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9506 5 263
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.9182 3 258
ID Description Score Start End Superfamily
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9468 5 258 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9356 3 258 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9185 3 258 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9119 5 258 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9082 3 258 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A3D4FR20-F1-model_v4 MBL fold metallo-hydrolase 1 192 256 GO:0016787
AF-A0A3M1PQR0-F1-model_v4 MBL fold metallo-hydrolase 0.9976 195 254 GO:0016787
AF-A0A356A6A8-F1-model_v4 deleted 0.9948 171 254
AF-A0A3B1BZK5-F1-model_v4 Metal-dependent hydrolases of the beta-lactamase superfamily I PhnP protein 0.9923 5 258 GO:0016787
AF-A0A349BKY7-F1-model_v4 MBL fold metallo-hydrolase 0.9912 7 120 GO:0016787

Map