F400033

General Info

Members Datasets Scaffolds Average Seq Length
309 156 618 230

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100285206|Ga0070670_1002852062
Length 228
Sequence MRPALILFVDDEKAIQRTLVPLLRSRGYTVTTAETGRDALAAIDAERPDLVVLDLGLPDMDGTVVCEQIRARSDVPILILSARLTEPDKIAALDRGADDYITKPFSPEELLARVRAALRRALGQEQAVRGQLTAGSIAIDLERRDVMVAGREVHLTPKEFDLLSLLAARAGQVVTHRAILRAIWGPHSVDQPEHLRVLVGQLRKKIEDDPARPTRLLTEPWVGYRLVD

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 0.32
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100285206 3300005331 Bacteria 1442
2 Ga0065715_10197153 3300005293 Bacteria 1381
3 Ga0065715_10281839 3300005293 Bacteria 1084
4 Ga0065707_10114772 3300005295 Bacteria 2287
5 Ga0065707_10152795 3300005295 Bacteria 1640
6 Ga0070676_10130218 3300005328 Bacteria 1590
7 Ga0070690_100027859 3300005330 Bacteria 3496
8 Ga0070670_100226123 3300005331 Bacteria 1628
9 Ga0070670_100632809 3300005331 Bacteria 959
10 Ga0068869_100097511 3300005334 Bacteria 2220
11 Ga0070680_100191979 3300005336 Bacteria 1721
12 Ga0070689_100062867 3300005340 Bacteria 2889
13 Ga0070687_100011421 3300005343 Bacteria 3885
14 Ga0070692_10005243 3300005345 Bacteria 5500
15 Ga0070669_100001431 3300005353 Bacteria 17262
16 Ga0070675_100016722 3300005354 Bacteria 5824
17 Ga0070675_100020368 3300005354 Bacteria 5294
18 Ga0070675_100022370 3300005354 Bacteria 5052
19 Ga0070675_100104887 3300005354 Bacteria 2385
20 Ga0070675_100149543 3300005354 Bacteria 2001
21 Ga0070675_100745756 3300005354 Bacteria 893
22 Ga0070671_100128003 3300005355 Bacteria 2138
23 Ga0070671_100172061 3300005355 Bacteria 1832
24 Ga0070674_100002233 3300005356 Bacteria 10659
25 Ga0070674_100264823 3300005356 Bacteria 1356
26 Ga0070688_100041091 3300005365 Bacteria 2837
27 Ga0070688_100060777 3300005365 Bacteria 2387
28 Ga0070688_100148692 3300005365 Bacteria 1599
29 Ga0070667_100228756 3300005367 Bacteria 1657
30 Ga0070713_100954256 3300005436 Bacteria 826
31 Ga0070701_10009798 3300005438 Bacteria 4211
32 Ga0070701_10021389 3300005438 Bacteria 3086
33 Ga0070705_100001734 3300005440 Bacteria 11344
34 Ga0070705_100307571 3300005440 Bacteria 1139
35 Ga0070700_100040443 3300005441 Bacteria 2854
36 Ga0070694_100000891 3300005444 Bacteria 16870
37 Ga0070694_100073719 3300005444 Bacteria 2358
38 Ga0070694_100125084 3300005444 Bacteria 1850
39 Ga0070708_100626746 3300005445 Bacteria 1014
40 Ga0070678_100073768 3300005456 Bacteria 2562
41 Ga0070662_100033099 3300005457 Bacteria 3638
42 Ga0068867_100000739 3300005459 Bacteria 21921
43 Ga0068867_100148486 3300005459 Bacteria 1839
44 Ga0068867_100742597 3300005459 Bacteria 870
45 Ga0070706_100432553 3300005467 Bacteria 1225
46 Ga0070706_100626796 3300005467 Bacteria 999
47 Ga0070707_100204658 3300005468 Bacteria 1924
48 Ga0070698_100006428 3300005471 Bacteria 12742
49 Ga0070698_100010289 3300005471 Bacteria 9990
50 Ga0070698_100074933 3300005471 Bacteria 3389
51 Ga0070699_100003974 3300005518 Bacteria 13074
52 Ga0070699_100009544 3300005518 Bacteria 8410
53 Ga0070699_100192497 3300005518 Bacteria 1812
54 Ga0070684_100100333 3300005535 Bacteria 2585
55 Ga0070672_100006410 3300005543 Bacteria 7909
56 Ga0070672_100046878 3300005543 Bacteria 3351
57 Ga0070672_100320157 3300005543 Bacteria 1318
58 Ga0070695_100016446 3300005545 Bacteria 4477
59 Ga0070695_100158857 3300005545 Bacteria 1585
60 Ga0070695_100164787 3300005545 Bacteria 1559
61 Ga0070696_100000400 3300005546 Bacteria 26895
62 Ga0070696_100447630 3300005546 Bacteria 1018
63 Ga0070693_100098313 3300005547 Bacteria 1778
64 Ga0070704_100002527 3300005549 Bacteria 10296
65 Ga0070704_100013602 3300005549 Bacteria 5057
66 Ga0070704_100118774 3300005549 Bacteria 2026
67 Ga0070664_100015290 3300005564 Bacteria 6274
68 Ga0068857_100004987 3300005577 Bacteria 11274
69 Ga0068857_100030064 3300005577 Bacteria 4793
70 Ga0068857_100168956 3300005577 Bacteria 1987
71 Ga0070702_100234020 3300005615 Bacteria 1236
72 Ga0068859_100001058 3300005617 Bacteria 28155
73 Ga0068859_100026627 3300005617 Bacteria 5798
74 Ga0068859_100095395 3300005617 Bacteria 3027
75 Ga0068859_100533292 3300005617 Bacteria 1269
76 Ga0068859_100918793 3300005617 Unclassified 959
77 Ga0068864_100110593 3300005618 Bacteria 2447
78 Ga0068864_100143801 3300005618 Bacteria 2154
79 Ga0068864_100252153 3300005618 Bacteria 1639
80 Ga0068864_100448857 3300005618 Bacteria 1233
81 Ga0068861_100002675 3300005719 Bacteria 11670
82 Ga0068870_10005707 3300005840 Bacteria 5448
83 Ga0068870_10006043 3300005840 Bacteria 5321
84 Ga0068870_10038507 3300005840 Bacteria 2469
85 Ga0068863_100047908 3300005841 Bacteria 4053
86 Ga0068863_100299453 3300005841 Bacteria 1560
87 Ga0068858_100005452 3300005842 Bacteria 12455
88 Ga0068860_100007937 3300005843 Bacteria 10590
89 Ga0068860_100449443 3300005843 Bacteria 1281
90 Ga0068860_100567794 3300005843 Bacteria 1138
91 Ga0068862_100002358 3300005844 Bacteria 16819
92 Ga0068862_100248174 3300005844 Bacteria 1621
93 Ga0081455_10531860 3300005937 Bacteria 782
94 Ga0075368_10026625 3300006042 Bacteria 2225
95 Ga0075364_10090791 3300006051 Bacteria 2026
96 Ga0075367_10018484 3300006178 Bacteria 3847
97 Ga0097621_100160067 3300006237 Bacteria 1935
98 Ga0097621_100372171 3300006237 Bacteria 1275
99 Ga0075428_100034476 3300006844 Bacteria 5582
100 Ga0075430_100007681 3300006846 Bacteria 9109
101 Ga0075430_100088779 3300006846 Bacteria 2587
102 Ga0075431_100077253 3300006847 Bacteria 3437
103 Ga0075431_100118884 3300006847 Bacteria 2727
104 Ga0075431_100135969 3300006847 Bacteria 2534
105 Ga0075433_10022235 3300006852 Bacteria 5323
106 Ga0075433_10062241 3300006852 Bacteria 3268
107 Ga0075433_10091219 3300006852 Bacteria 2693
108 Ga0075433_10096850 3300006852 Bacteria 2611
109 Ga0075433_10106330 3300006852 Bacteria 2487
110 Ga0075434_100012939 3300006871 Bacteria 7925
111 Ga0075434_100214583 3300006871 Bacteria 1944
112 Ga0075434_100258003 3300006871 Bacteria 1762
113 Ga0075429_100190172 3300006880 Bacteria 1799
114 Ga0075429_100455320 3300006880 Bacteria 1121
115 Ga0068865_100037247 3300006881 Bacteria 3283
116 Ga0068865_100146018 3300006881 Bacteria 1789
117 Ga0097620_100001058 3300006931 Bacteria 28155
118 Ga0097620_100026627 3300006931 Bacteria 5798
119 Ga0097620_100095399 3300006931 Bacteria 3027
120 Ga0097620_100533290 3300006931 Bacteria 1269
121 Ga0097620_100918974 3300006931 Unclassified 959
122 Ga0075435_100292094 3300007076 Bacteria 1393
123 Ga0111539_10010458 3300009094 Bacteria 11679
124 Ga0111539_10023946 3300009094 Bacteria 7501
125 Ga0111539_10101534 3300009094 Bacteria 3377
126 Ga0111539_10114043 3300009094 Bacteria 3170
127 Ga0111539_10151691 3300009094 Bacteria 2712
128 Ga0111539_10377392 3300009094 Bacteria 1651
129 Ga0105245_10147149 3300009098 Bacteria 2223
130 Ga0114129_10001641 3300009147 Bacteria 30388
131 Ga0114129_10018179 3300009147 Bacteria 10009
132 Ga0114129_10042430 3300009147 Bacteria 6406
133 Ga0114129_10062321 3300009147 Bacteria 5210
134 Ga0114129_10214863 3300009147 Bacteria 2597
135 Ga0114129_10658639 3300009147 Bacteria 1350
136 Ga0105243_10197325 3300009148 Bacteria 1763
137 Ga0105242_10345687 3300009176 Bacteria 1372
138 Ga0105248_10133880 3300009177 Bacteria 2797
139 Ga0105248_10183634 3300009177 Bacteria 2357
140 Ga0105249_10036507 3300009553 Bacteria 4458
141 Ga0105249_10470525 3300009553 Bacteria 1298
142 Ga0163162_10557253 3300013306 Bacteria 1274
143 Ga0157375_10003610 3300013308 Bacteria 13422
144 Ga0163163_10000009 3300014325 Bacteria 268331
145 Ga0163163_10156791 3300014325 Bacteria 2321
146 Ga0157380_10012074 3300014326 Bacteria 6252
147 Ga0157380_10052861 3300014326 Bacteria 3218
148 Ga0157380_10061399 3300014326 Bacteria 3007
149 Ga0157377_10136742 3300014745 Bacteria 1502
150 Ga0157376_10033775 3300014969 Bacteria 4123
151 Ga0157376_10201685 3300014969 Bacteria 1831
152 Ga0163161_10424200 3300017792 Bacteria 1071
153 Ga0207682_10166794 3300025893 Bacteria 1000
154 Ga0207645_10017784 3300025907 Bacteria 4686
155 Ga0207643_10001995 3300025908 Bacteria 11262
156 Ga0207643_10003554 3300025908 Bacteria 8393
157 Ga0207643_10037281 3300025908 Bacteria 2728
158 Ga0207684_10145461 3300025910 Bacteria 2039
159 Ga0207684_10463351 3300025910 Bacteria 1088
160 Ga0207660_10118724 3300025917 Bacteria 2001
161 Ga0207662_10018825 3300025918 Bacteria 3921
162 Ga0207646_10300301 3300025922 Bacteria 1451
163 Ga0207646_10325677 3300025922 Bacteria 1388
164 Ga0207681_10010377 3300025923 Bacteria 5699
165 Ga0207681_10209949 3300025923 Bacteria 1500
166 Ga0207650_10048223 3300025925 Bacteria 3141
167 Ga0207650_10056655 3300025925 Bacteria 2913
168 Ga0207650_10224830 3300025925 Bacteria 1512
169 Ga0207659_10001821 3300025926 Bacteria 12624
170 Ga0207659_10250244 3300025926 Bacteria 1438
171 Ga0207659_10287784 3300025926 Bacteria 1345
172 Ga0207700_10522955 3300025928 Bacteria 1051
173 Ga0207644_10145377 3300025931 Bacteria 1830
174 Ga0207706_10042749 3300025933 Bacteria 4016
175 Ga0207709_10118093 3300025935 Bacteria 1786
176 Ga0207709_10179572 3300025935 Bacteria 1493
177 Ga0207670_10017822 3300025936 Bacteria 4300
178 Ga0207669_10000865 3300025937 Bacteria 12878
179 Ga0207669_10135618 3300025937 Bacteria 1699
180 Ga0207704_10085638 3300025938 Bacteria 2052
181 Ga0207704_10136337 3300025938 Bacteria 1709
182 Ga0207704_10803673 3300025938 Bacteria 785
183 Ga0207691_10052117 3300025940 Bacteria 3738
184 Ga0207691_10103200 3300025940 Bacteria 2543
185 Ga0207691_10216126 3300025940 Bacteria 1663
186 Ga0207711_10041582 3300025941 Bacteria 3915
187 Ga0207711_10198351 3300025941 Bacteria 1831
188 Ga0207689_10043182 3300025942 Bacteria 3727
189 Ga0207689_10224666 3300025942 Bacteria 1552
190 Ga0207661_10000733 3300025944 Bacteria 21299
191 Ga0207661_10059677 3300025944 Bacteria 3075
192 Ga0207679_10030442 3300025945 Bacteria 3769
193 Ga0207651_10119250 3300025960 Bacteria 1997
194 Ga0207651_10573978 3300025960 Bacteria 983
195 Ga0207712_10119944 3300025961 Bacteria 1988
196 Ga0207712_10218235 3300025961 Bacteria 1523
197 Ga0207668_10041095 3300025972 Bacteria 3124
198 Ga0207668_10145402 3300025972 Bacteria 1829
199 Ga0207658_10172123 3300025986 Bacteria 1785
200 Ga0207703_10014676 3300026035 Bacteria 6113
201 Ga0207703_10299390 3300026035 Bacteria 1466
202 Ga0207639_10504697 3300026041 Bacteria 1106
203 Ga0207708_10020926 3300026075 Bacteria 4936
204 Ga0207708_10055041 3300026075 Bacteria 3033
205 Ga0207708_10217159 3300026075 Bacteria 1531
206 Ga0207641_10027782 3300026088 Bacteria 4674
207 Ga0207641_10202478 3300026088 Bacteria 1831
208 Ga0207648_10002044 3300026089 Bacteria 21990
209 Ga0207648_10682401 3300026089 Bacteria 951
210 Ga0207676_10003264 3300026095 Bacteria 11543
211 Ga0207676_10162349 3300026095 Bacteria 1937
212 Ga0207676_10568353 3300026095 Bacteria 1085
213 Ga0207674_10011409 3300026116 Bacteria 9984
214 Ga0207674_10040087 3300026116 Bacteria 4854
215 Ga0207675_100000566 3300026118 Bacteria 36197
216 Ga0207675_100512171 3300026118 Bacteria 1195
217 Ga0207683_10044065 3300026121 Bacteria 3900
218 Ga0207428_10001394 3300027907 Bacteria 25518
219 Ga0207428_10003929 3300027907 Bacteria 14253
220 Ga0207428_10105086 3300027907 Bacteria 2178
221 Ga0268265_10000816 3300028380 Bacteria 29554
222 Ga0268264_10004728 3300028381 Bacteria 11567
223 Ga0268264_10021509 3300028381 Bacteria 5266
224 Ga0268264_10244833 3300028381 Bacteria 1663
225 Ga0307408_100139775 3300031548 Bacteria 1900
226 Ga0307413_10204956 3300031824 Bacteria 1427
227 Ga0307410_10032809 3300031852 Bacteria 3347
228 Ga0307410_10210972 3300031852 Bacteria 1488
229 Ga0307412_10517680 3300031911 Bacteria 996
230 Ga0307409_100026757 3300031995 Bacteria 4075
231 Ga0307409_100154743 3300031995 Bacteria 1996
232 Ga0307416_100049921 3300032002 Bacteria 3330
233 Ga0307416_100187249 3300032002 Bacteria 1947
234 Ga0307414_10088140 3300032004 Bacteria 2296
235 Ga0307414_10114949 3300032004 Bacteria 2057
236 Ga0307415_100134624 3300032126 Bacteria 1877
237 Ga0307415_100405428 3300032126 Bacteria 1165
238 Ga0373937_0139175 3300036401 Bacteria 2270
239 Ga0373937_0952168 3300036401 Bacteria 807
240 Ga0395905_0290118 3300037471 Bacteria 1523
241 Ga0395901_0270925 3300038443 Bacteria 1766
242 Ga0436363_1570569 3300039450 Bacteria 1445
243 Ga0439444_0035117 3300042437 Bacteria 960
244 Ga0451576_0022502 3300045051 Bacteria 6834
245 Ga0451576_0043926 3300045051 Bacteria 4713
246 Ga0451576_0051453 3300045051 Bacteria 4319
247 Ga0451576_0108579 3300045051 Bacteria 2887
248 Ga0451576_0191289 3300045051 Bacteria 2137
249 Ga0451576_0267674 3300045051 Bacteria 1786
250 Ga0451576_0370859 3300045051 Bacteria 1500
251 Ga0495629_0138277 3300046459 Bacteria 1695
252 Ga0495629_0376572 3300046459 Bacteria 966
253 Ga0495584_0012987 3300046491 Bacteria 4252
254 Ga0495642_0054059 3300046528 Bacteria 1655
255 Ga0495642_0217564 3300046528 Bacteria 834
256 Ga0495598_0095332 3300046537 Bacteria 977
257 Ga0495609_0081155 3300046538 Bacteria 1418
258 Ga0495621_0011499 3300046539 Bacteria 2740
259 Ga0495621_0035421 3300046539 Bacteria 1729
260 Ga0495621_0131523 3300046539 Unclassified 974
261 Ga0495656_0077226 3300046615 Bacteria 1494
262 Ga0495656_0148466 3300046615 Bacteria 1130
263 Ga0495656_0220878 3300046615 Bacteria 947
264 Ga0495659_0030638 3300046664 Bacteria 1873
265 Ga0495659_0044286 3300046664 Bacteria 1600
266 Ga0495659_0061432 3300046664 Bacteria 1388
267 Ga0495588_0056363 3300046674 Bacteria 2029
268 Ga0495658_0222397 3300046683 Bacteria 1182
269 Ga0495670_0065393 3300046691 Bacteria 1833
270 Ga0495636_0006584 3300047318 Bacteria 4568
271 Ga0495636_0087240 3300047318 Bacteria 1350
272 Ga0495672_0051308 3300047320 Bacteria 2430
273 Ga0495676_0055702 3300047321 Bacteria 3133
274 Ga0495685_030259 3300047447 Bacteria 1862
275 Ga0496110_0000920 3300048913 Bacteria 20628
276 Ga0501067_0021836 3300049583 Bacteria 3542
277 Ga0501069_0132254 3300049585 Bacteria 1429
278 Ga0501073_0001725 3300049589 Bacteria 16245
279 nmdc:mga0k408_215576_c1 3300050493 Bacteria 1146
280 nmdc:mga05p37_165176_c1 3300050507 Bacteria 2702
281 nmdc:mga05p37_2372_c1 3300050507 Bacteria 21926
282 nmdc:mga05p37_344995_c1 3300050507 Bacteria 1755
283 nmdc:mga05p37_382019_c1 3300050507 Bacteria 1650
284 nmdc:mga05p37_734208_c1 3300050507 Bacteria 1091
285 nmdc:mga05p37_7838_c1 3300050507 Bacteria 12606
286 nmdc:mga09592_152881_c2 3300050508 Bacteria 1699
287 nmdc:mga09592_232262_c1 3300050508 Bacteria 1598
288 nmdc:mga09592_70623_c1 3300050508 Bacteria 2963
289 nmdc:mga0qj67_528479_c1 3300050509 Bacteria 947
290 nmdc:mga0qj67_87686_c1 3300050509 Bacteria 2498
291 nmdc:mga06r32_228112_c1 3300050510 Bacteria 1850
292 nmdc:mga08y16_12609_c1 3300050511 Bacteria 8892
293 nmdc:mga08y16_162855_c1 3300050511 Bacteria 2317
294 nmdc:mga08y16_38388_c1 3300050511 Bacteria 5029
295 nmdc:mga08y16_61749_c1 3300050511 Bacteria 3913
296 nmdc:mga08y16_80211_c2 3300050511 Bacteria 1075
297 nmdc:mga0n895_15412_c1 3300050512 Bacteria 6969
298 nmdc:mga0n895_238889_c1 3300050512 Bacteria 1844
299 nmdc:mga0n895_422285_c1 3300050512 Bacteria 1348
300 nmdc:mga0rr50_353755_c1 3300050513 Bacteria 1236
301 nmdc:mga0rr50_69980_c1 3300050513 Bacteria 2672
302 nmdc:mga0rr50_7931_c1 3300050513 Bacteria 6586
303 nmdc:mga0a205_1361_c2 3300050515 Bacteria 14296
304 nmdc:mga0a205_156324_c1 3300050515 Bacteria 2179
305 nmdc:mga0a205_46508_c1 3300050515 Bacteria 4186
306 nmdc:mga0a205_66489_c1 3300050515 Bacteria 3483
307 nmdc:mga0a205_93766_c1 3300050515 Bacteria 2900
308 Ga0500652_112848 3300053131 Bacteria 1136
309 Ga0500568_0009641 3300053139 Bacteria 4574
310 Ga0070670_100285206
311 Ga0065715_10197153
312 Ga0065715_10281839
313 Ga0065707_10114772
314 Ga0065707_10152795
315 Ga0070676_10130218
316 Ga0070690_100027859
317 Ga0070670_100226123
318 Ga0070670_100632809
319 Ga0068869_100097511
320 Ga0070680_100191979
321 Ga0070689_100062867
322 Ga0070687_100011421
323 Ga0070692_10005243
324 Ga0070669_100001431
325 Ga0070675_100016722
326 Ga0070675_100020368
327 Ga0070675_100022370
328 Ga0070675_100104887
329 Ga0070675_100149543
330 Ga0070675_100745756
331 Ga0070671_100128003
332 Ga0070671_100172061
333 Ga0070674_100002233
334 Ga0070674_100264823
335 Ga0070688_100041091
336 Ga0070688_100060777
337 Ga0070688_100148692
338 Ga0070667_100228756
339 Ga0070713_100954256
340 Ga0070701_10009798
341 Ga0070701_10021389
342 Ga0070705_100001734
343 Ga0070705_100307571
344 Ga0070700_100040443
345 Ga0070694_100000891
346 Ga0070694_100073719
347 Ga0070694_100125084
348 Ga0070708_100626746
349 Ga0070678_100073768
350 Ga0070662_100033099
351 Ga0068867_100000739
352 Ga0068867_100148486
353 Ga0068867_100742597
354 Ga0070706_100432553
355 Ga0070706_100626796
356 Ga0070707_100204658
357 Ga0070698_100006428
358 Ga0070698_100010289
359 Ga0070698_100074933
360 Ga0070699_100003974
361 Ga0070699_100009544
362 Ga0070699_100192497
363 Ga0070684_100100333
364 Ga0070672_100006410
365 Ga0070672_100046878
366 Ga0070672_100320157
367 Ga0070695_100016446
368 Ga0070695_100158857
369 Ga0070695_100164787
370 Ga0070696_100000400
371 Ga0070696_100447630
372 Ga0070693_100098313
373 Ga0070704_100002527
374 Ga0070704_100013602
375 Ga0070704_100118774
376 Ga0070664_100015290
377 Ga0068857_100004987
378 Ga0068857_100030064
379 Ga0068857_100168956
380 Ga0070702_100234020
381 Ga0068859_100001058
382 Ga0068859_100026627
383 Ga0068859_100095395
384 Ga0068859_100533292
385 Ga0068859_100918793
386 Ga0068864_100110593
387 Ga0068864_100143801
388 Ga0068864_100252153
389 Ga0068864_100448857
390 Ga0068861_100002675
391 Ga0068870_10005707
392 Ga0068870_10006043
393 Ga0068870_10038507
394 Ga0068863_100047908
395 Ga0068863_100299453
396 Ga0068858_100005452
397 Ga0068860_100007937
398 Ga0068860_100449443
399 Ga0068860_100567794
400 Ga0068862_100002358
401 Ga0068862_100248174
402 Ga0081455_10531860
403 Ga0075368_10026625
404 Ga0075364_10090791
405 Ga0075367_10018484
406 Ga0097621_100160067
407 Ga0097621_100372171
408 Ga0075428_100034476
409 Ga0075430_100007681
410 Ga0075430_100088779
411 Ga0075431_100077253
412 Ga0075431_100118884
413 Ga0075431_100135969
414 Ga0075433_10022235
415 Ga0075433_10062241
416 Ga0075433_10091219
417 Ga0075433_10096850
418 Ga0075433_10106330
419 Ga0075434_100012939
420 Ga0075434_100214583
421 Ga0075434_100258003
422 Ga0075429_100190172
423 Ga0075429_100455320
424 Ga0068865_100037247
425 Ga0068865_100146018
426 Ga0097620_100001058
427 Ga0097620_100026627
428 Ga0097620_100095399
429 Ga0097620_100533290
430 Ga0097620_100918974
431 Ga0075435_100292094
432 Ga0111539_10010458
433 Ga0111539_10023946
434 Ga0111539_10101534
435 Ga0111539_10114043
436 Ga0111539_10151691
437 Ga0111539_10377392
438 Ga0105245_10147149
439 Ga0114129_10001641
440 Ga0114129_10018179
441 Ga0114129_10042430
442 Ga0114129_10062321
443 Ga0114129_10214863
444 Ga0114129_10658639
445 Ga0105243_10197325
446 Ga0105242_10345687
447 Ga0105248_10133880
448 Ga0105248_10183634
449 Ga0105249_10036507
450 Ga0105249_10470525
451 Ga0163162_10557253
452 Ga0157375_10003610
453 Ga0163163_10000009
454 Ga0163163_10156791
455 Ga0157380_10012074
456 Ga0157380_10052861
457 Ga0157380_10061399
458 Ga0157377_10136742
459 Ga0157376_10033775
460 Ga0157376_10201685
461 Ga0163161_10424200
462 Ga0207682_10166794
463 Ga0207645_10017784
464 Ga0207643_10001995
465 Ga0207643_10003554
466 Ga0207643_10037281
467 Ga0207684_10145461
468 Ga0207684_10463351
469 Ga0207660_10118724
470 Ga0207662_10018825
471 Ga0207646_10300301
472 Ga0207646_10325677
473 Ga0207681_10010377
474 Ga0207681_10209949
475 Ga0207650_10048223
476 Ga0207650_10056655
477 Ga0207650_10224830
478 Ga0207659_10001821
479 Ga0207659_10250244
480 Ga0207659_10287784
481 Ga0207700_10522955
482 Ga0207644_10145377
483 Ga0207706_10042749
484 Ga0207709_10118093
485 Ga0207709_10179572
486 Ga0207670_10017822
487 Ga0207669_10000865
488 Ga0207669_10135618
489 Ga0207704_10085638
490 Ga0207704_10136337
491 Ga0207704_10803673
492 Ga0207691_10052117
493 Ga0207691_10103200
494 Ga0207691_10216126
495 Ga0207711_10041582
496 Ga0207711_10198351
497 Ga0207689_10043182
498 Ga0207689_10224666
499 Ga0207661_10000733
500 Ga0207661_10059677
501 Ga0207679_10030442
502 Ga0207651_10119250
503 Ga0207651_10573978
504 Ga0207712_10119944
505 Ga0207712_10218235
506 Ga0207668_10041095
507 Ga0207668_10145402
508 Ga0207658_10172123
509 Ga0207703_10014676
510 Ga0207703_10299390
511 Ga0207639_10504697
512 Ga0207708_10020926
513 Ga0207708_10055041
514 Ga0207708_10217159
515 Ga0207641_10027782
516 Ga0207641_10202478
517 Ga0207648_10002044
518 Ga0207648_10682401
519 Ga0207676_10003264
520 Ga0207676_10162349
521 Ga0207676_10568353
522 Ga0207674_10011409
523 Ga0207674_10040087
524 Ga0207675_100000566
525 Ga0207675_100512171
526 Ga0207683_10044065
527 Ga0207428_10001394
528 Ga0207428_10003929
529 Ga0207428_10105086
530 Ga0268265_10000816
531 Ga0268264_10004728
532 Ga0268264_10021509
533 Ga0268264_10244833
534 Ga0307408_100139775
535 Ga0307413_10204956
536 Ga0307410_10032809
537 Ga0307410_10210972
538 Ga0307412_10517680
539 Ga0307409_100026757
540 Ga0307409_100154743
541 Ga0307416_100049921
542 Ga0307416_100187249
543 Ga0307414_10088140
544 Ga0307414_10114949
545 Ga0307415_100134624
546 Ga0307415_100405428
547 Ga0373937_0139175
548 Ga0373937_0952168
549 Ga0395905_0290118
550 Ga0395901_0270925
551 Ga0436363_1570569
552 Ga0439444_0035117
553 Ga0451576_0022502
554 Ga0451576_0043926
555 Ga0451576_0051453
556 Ga0451576_0108579
557 Ga0451576_0191289
558 Ga0451576_0267674
559 Ga0451576_0370859
560 Ga0495629_0138277
561 Ga0495629_0376572
562 Ga0495584_0012987
563 Ga0495642_0054059
564 Ga0495642_0217564
565 Ga0495598_0095332
566 Ga0495609_0081155
567 Ga0495621_0011499
568 Ga0495621_0035421
569 Ga0495621_0131523
570 Ga0495656_0077226
571 Ga0495656_0148466
572 Ga0495656_0220878
573 Ga0495659_0030638
574 Ga0495659_0044286
575 Ga0495659_0061432
576 Ga0495588_0056363
577 Ga0495658_0222397
578 Ga0495670_0065393
579 Ga0495636_0006584
580 Ga0495636_0087240
581 Ga0495672_0051308
582 Ga0495676_0055702
583 Ga0495685_030259
584 Ga0496110_0000920
585 Ga0501067_0021836
586 Ga0501069_0132254
587 Ga0501073_0001725
588 nmdc:mga0k408_215576_c1
589 nmdc:mga05p37_165176_c1
590 nmdc:mga05p37_2372_c1
591 nmdc:mga05p37_344995_c1
592 nmdc:mga05p37_382019_c1
593 nmdc:mga05p37_734208_c1
594 nmdc:mga05p37_7838_c1
595 nmdc:mga09592_152881_c2
596 nmdc:mga09592_232262_c1
597 nmdc:mga09592_70623_c1
598 nmdc:mga0qj67_528479_c1
599 nmdc:mga0qj67_87686_c1
600 nmdc:mga06r32_228112_c1
601 nmdc:mga08y16_12609_c1
602 nmdc:mga08y16_162855_c1
603 nmdc:mga08y16_38388_c1
604 nmdc:mga08y16_61749_c1
605 nmdc:mga08y16_80211_c2
606 nmdc:mga0n895_15412_c1
607 nmdc:mga0n895_238889_c1
608 nmdc:mga0n895_422285_c1
609 nmdc:mga0rr50_353755_c1
610 nmdc:mga0rr50_69980_c1
611 nmdc:mga0rr50_7931_c1
612 nmdc:mga0a205_1361_c2
613 nmdc:mga0a205_156324_c1
614 nmdc:mga0a205_46508_c1
615 nmdc:mga0a205_66489_c1
616 nmdc:mga0a205_93766_c1
617 Ga0500652_112848
618 Ga0500568_0009641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

141

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9761 1 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9746 3 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.974 3 118
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9732 3 118
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9712 1 118
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9931 2 79 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9826 2 83 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9803 2 77 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9787 3 84 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9786 1 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-T1ATB7-F1-model_v4 Two component transcriptional regulator, winged helix family 0.8255 2 150 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2S5LA93-F1-model_v4 Two-component system response regulator KdpE 0.7951 3 157 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A377DWT1-F1-model_v4 Two-component response regulator 0.7849 1 154 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0R2PGL1-F1-model_v4 Two-component system response regulator 0.7774 2 157 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-T1ATB7-F1-model_v4 Two component transcriptional regulator, winged helix family 0.7759 2 150 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map