F399968

General Info

Members Datasets Scaffolds Average Seq Length
308 187 616 97

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|649633069|649810417
Length 113
Sequence KARREGTAGGACDDRRMSSAASPDVSALAINVTVPEELRWTDTRRGEEFTLTTLNIRLLPDGRLAAKAYGRPTAGGRGAYVSFRVPDRPELAALVAAAADRAAALWAAHGGLD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 649633069 Micromonospora sp. L5 Isolate Unclassified
178 2501939600 Micromonospora sp. L5 Isolate Unclassified
179 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
180 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
181 2855683550 Micromonospora sp. RP3T Isolate Unclassified
182 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
183 2858868258 Micromonospora sp. MH33 Isolate Unclassified
184 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
185 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
186 2902582711 Micromonospora sp. AP08 Isolate Unclassified
187 2996221748 Micromonospora veneta CAP181 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 0.97
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.55
Rhizosphere 91.56
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10077194 3300001979 Bacteria 879
2 JGI24739J22299_10123683 3300001989 Bacteria 772
3 JGI24737J22298_10023699 3300001990 Bacteria 1946
4 JGI24735J21928_10137329 3300002067 Bacteria 705
5 JGI24738J21930_10110152 3300002075 Bacteria 593
6 Ga0070658_10861197 3300005327 Bacteria 788
7 Ga0070683_100082553 3300005329 Bacteria 3010
8 Ga0070683_100617630 3300005329 Bacteria 1038
9 Ga0070683_101145562 3300005329 Bacteria 747
10 Ga0070690_101017915 3300005330 Bacteria 653
11 Ga0070670_101366441 3300005331 Bacteria 649
12 Ga0070677_10246146 3300005333 Bacteria 885
13 Ga0070680_100321535 3300005336 Bacteria 1313
14 Ga0070682_100157507 3300005337 Bacteria 1565
15 Ga0070682_100965535 3300005337 Bacteria 705
16 Ga0068868_100074285 3300005338 Bacteria 2715
17 Ga0070691_10831079 3300005341 Bacteria 565
18 Ga0070661_100144201 3300005344 Bacteria 1796
19 Ga0070661_101269869 3300005344 Bacteria 617
20 Ga0070692_10350851 3300005345 Bacteria 917
21 Ga0070692_11156577 3300005345 Bacteria 549
22 Ga0070675_100665363 3300005354 Bacteria 947
23 Ga0070674_100664934 3300005356 Bacteria 887
24 Ga0070659_100036788 3300005366 Bacteria 3816
25 Ga0070714_100097003 3300005435 Bacteria 2591
26 Ga0070714_100423593 3300005435 Unclassified 1261
27 Ga0070714_100708505 3300005435 Bacteria 971
28 Ga0070713_100001480 3300005436 Bacteria 14974
29 Ga0070713_100212303 3300005436 Bacteria 1753
30 Ga0070713_100212664 3300005436 Bacteria 1751
31 Ga0070711_100634226 3300005439 Bacteria 894
32 Ga0070711_100646070 3300005439 Bacteria 886
33 Ga0070678_100338096 3300005456 Bacteria 1291
34 Ga0070678_102225055 3300005456 Unclassified 520
35 Ga0070681_10436845 3300005458 Bacteria 1221
36 Ga0070681_10728447 3300005458 Bacteria 908
37 Ga0070681_11576582 3300005458 Bacteria 582
38 Ga0068867_101819593 3300005459 Bacteria 573
39 Ga0070706_100120955 3300005467 Bacteria 2441
40 Ga0070707_100148524 3300005468 Bacteria 2282
41 Ga0070698_100049654 3300005471 Bacteria 4281
42 Ga0070679_100053809 3300005530 Bacteria 4007
43 Ga0070679_100324878 3300005530 Bacteria 1487
44 Ga0070684_100042328 3300005535 Bacteria 3931
45 Ga0070684_100092975 3300005535 Bacteria 2684
46 Ga0068853_100790755 3300005539 Bacteria 908
47 Ga0070672_100431704 3300005543 Bacteria 1133
48 Ga0070665_101130030 3300005548 Bacteria 795
49 Ga0068855_100213920 3300005563 Bacteria 2165
50 Ga0070664_100050645 3300005564 Bacteria 3515
51 Ga0070664_100537753 3300005564 Bacteria 1080
52 Ga0070664_100888207 3300005564 Bacteria 835
53 Ga0070664_101751971 3300005564 Bacteria 589
54 Ga0068857_100305454 3300005577 Bacteria 1467
55 Ga0068857_100378815 3300005577 Bacteria 1313
56 Ga0068857_100426435 3300005577 Unclassified 1237
57 Ga0068854_102151340 3300005578 Bacteria 516
58 Ga0068856_100019207 3300005614 Bacteria 6635
59 Ga0068856_101015186 3300005614 Bacteria 848
60 Ga0068856_102425768 3300005614 Bacteria 532
61 Ga0068852_100734225 3300005616 Bacteria 999
62 Ga0068852_101202650 3300005616 Bacteria 779
63 Ga0068864_100118157 3300005618 Bacteria 2367
64 Ga0068864_100739782 3300005618 Bacteria 963
65 Ga0068864_101415432 3300005618 Bacteria 697
66 Ga0068863_100046044 3300005841 Bacteria 4139
67 Ga0068860_101469951 3300005843 Bacteria 703
68 Ga0070717_10115675 3300006028 Bacteria 2292
69 Ga0070717_10386320 3300006028 Bacteria 1256
70 Ga0070717_11930613 3300006028 Bacteria 532
71 Ga0070715_10709891 3300006163 Bacteria 601
72 Ga0070716_100331591 3300006173 Bacteria 1070
73 Ga0070716_100476887 3300006173 Bacteria 915
74 Ga0070716_100790741 3300006173 Unclassified 734
75 Ga0070712_100147460 3300006175 Bacteria 1802
76 Ga0070712_100576180 3300006175 Bacteria 950
77 Ga0075428_100015429 3300006844 Bacteria 8468
78 Ga0075428_100113137 3300006844 Bacteria 2957
79 Ga0075430_100012600 3300006846 Bacteria 7199
80 Ga0075430_100027307 3300006846 Bacteria 4850
81 Ga0075431_100021815 3300006847 Bacteria 6548
82 Ga0075429_100019369 3300006880 Bacteria 5894
83 Ga0075435_100815395 3300007076 Bacteria 813
84 Ga0075435_101474614 3300007076 Unclassified 596
85 Ga0105240_10704129 3300009093 Bacteria 1102
86 Ga0105240_12698763 3300009093 Bacteria 512
87 Ga0105245_10376827 3300009098 Bacteria 1412
88 Ga0105245_11400295 3300009098 Bacteria 749
89 Ga0114129_10006319 3300009147 Bacteria 16800
90 Ga0114129_10528928 3300009147 Unclassified 1536
91 Ga0105241_10734375 3300009174 Bacteria 904
92 Ga0105241_12575224 3300009174 Bacteria 510
93 Ga0105242_11078991 3300009176 Bacteria 816
94 Ga0105248_10298133 3300009177 Bacteria 1815
95 Ga0105248_12138577 3300009177 Bacteria 637
96 Ga0105237_10443931 3300009545 Bacteria 1303
97 Ga0105249_10915704 3300009553 Bacteria 944
98 Ga0105239_10624374 3300010375 Bacteria 1230
99 Ga0105239_10874705 3300010375 Bacteria 1031
100 Ga0105239_12589384 3300010375 Bacteria 591
101 Ga0105246_10524747 3300011119 Bacteria 1010
102 Ga0105246_11701229 3300011119 Bacteria 599
103 Ga0157342_1059033 3300012507 Bacteria 558
104 Ga0157373_10180969 3300013100 Bacteria 1484
105 Ga0157370_10881773 3300013104 Bacteria 812
106 Ga0157369_10017807 3300013105 Bacteria 7974
107 Ga0157369_10351301 3300013105 Bacteria 1531
108 Ga0157369_10399868 3300013105 Bacteria 1425
109 Ga0157369_11418383 3300013105 Bacteria 707
110 Ga0157374_11566252 3300013296 Bacteria 683
111 Ga0157374_12275808 3300013296 Bacteria 569
112 Ga0157378_11793731 3300013297 Bacteria 662
113 Ga0163162_10599354 3300013306 Bacteria 1228
114 Ga0163162_11496724 3300013306 Bacteria 769
115 Ga0157372_10257650 3300013307 Bacteria 2025
116 Ga0157372_10480120 3300013307 Bacteria 1449
117 Ga0157372_10496077 3300013307 Bacteria 1424
118 Ga0157372_10858928 3300013307 Bacteria 1053
119 Ga0157372_11178668 3300013307 Bacteria 885
120 Ga0157372_11410333 3300013307 Bacteria 803
121 Ga0157375_10224549 3300013308 Bacteria 2037
122 Ga0157375_10305257 3300013308 Bacteria 1755
123 Ga0163163_10018814 3300014325 Bacteria 6476
124 Ga0163163_10247512 3300014325 Bacteria 1833
125 Ga0163163_10727670 3300014325 Bacteria 1056
126 Ga0163163_11275504 3300014325 Bacteria 797
127 Ga0157380_10099988 3300014326 Bacteria 2413
128 Ga0157380_10101648 3300014326 Bacteria 2396
129 Ga0157380_11215009 3300014326 Bacteria 798
130 Ga0157380_13052471 3300014326 Bacteria 534
131 Ga0157379_10403176 3300014968 Bacteria 1257
132 Ga0157376_10796138 3300014969 Bacteria 957
133 Ga0157376_12272092 3300014969 Unclassified 581
134 Ga0163161_10149648 3300017792 Bacteria 1773
135 Ga0206349_1069586 3300020075 Bacteria 699
136 Ga0206350_10504038 3300020080 Bacteria 1285
137 Ga0213875_10009584 3300021388 Bacteria 4897
138 Ga0224712_10101201 3300022467 Bacteria 1222
139 Ga0207680_10768933 3300025903 Bacteria 690
140 Ga0207647_10178478 3300025904 Bacteria 1234
141 Ga0207685_10035829 3300025905 Bacteria 1814
142 Ga0207699_10198130 3300025906 Bacteria 1359
143 Ga0207699_10199422 3300025906 Bacteria 1355
144 Ga0207699_10583357 3300025906 Bacteria 813
145 Ga0207705_10029017 3300025909 Bacteria 3945
146 Ga0207705_10189613 3300025909 Bacteria 1554
147 Ga0207695_10511215 3300025913 Bacteria 1083
148 Ga0207671_10713589 3300025914 Bacteria 797
149 Ga0207693_10096372 3300025915 Bacteria 2319
150 Ga0207693_10131353 3300025915 Bacteria 1969
151 Ga0207693_10336768 3300025915 Bacteria 1181
152 Ga0207663_10262713 3300025916 Bacteria 1275
153 Ga0207660_10111456 3300025917 Bacteria 2059
154 Ga0207660_10515650 3300025917 Bacteria 971
155 Ga0207662_10076989 3300025918 Bacteria 2028
156 Ga0207657_10239840 3300025919 Bacteria 1448
157 Ga0207649_10185712 3300025920 Bacteria 1458
158 Ga0207652_10143899 3300025921 Bacteria 2133
159 Ga0207652_10313319 3300025921 Bacteria 1416
160 Ga0207646_10145992 3300025922 Bacteria 2132
161 Ga0207646_11161736 3300025922 Bacteria 678
162 Ga0207700_10007133 3300025928 Bacteria 6810
163 Ga0207700_10016706 3300025928 Bacteria 4884
164 Ga0207700_10144104 3300025928 Bacteria 1961
165 Ga0207664_10056824 3300025929 Bacteria 3109
166 Ga0207664_10068738 3300025929 Bacteria 2847
167 Ga0207690_10121590 3300025932 Bacteria 1898
168 Ga0207690_11632467 3300025932 Bacteria 539
169 Ga0207686_11482192 3300025934 Bacteria 559
170 Ga0207665_10113026 3300025939 Bacteria 1910
171 Ga0207691_10067717 3300025940 Bacteria 3228
172 Ga0207661_10121427 3300025944 Bacteria 2225
173 Ga0207661_10899315 3300025944 Bacteria 815
174 Ga0207679_10197235 3300025945 Bacteria 1679
175 Ga0207679_11060003 3300025945 Bacteria 743
176 Ga0207667_10190748 3300025949 Bacteria 2103
177 Ga0207651_10450696 3300025960 Bacteria 1104
178 Ga0207640_10700325 3300025981 Bacteria 868
179 Ga0207640_11248179 3300025981 Bacteria 662
180 Ga0207677_10784264 3300026023 Bacteria 852
181 Ga0207703_10592170 3300026035 Bacteria 1048
182 Ga0207678_10487355 3300026067 Bacteria 1074
183 Ga0207708_10135580 3300026075 Bacteria 1928
184 Ga0207702_10010960 3300026078 Bacteria 7562
185 Ga0207641_10016771 3300026088 Bacteria 5999
186 Ga0207676_10069324 3300026095 Bacteria 2823
187 Ga0207676_11228154 3300026095 Bacteria 743
188 Ga0207676_11521591 3300026095 Bacteria 666
189 Ga0207674_10108492 3300026116 Bacteria 2752
190 Ga0207674_10417139 3300026116 Bacteria 1297
191 Ga0207674_10908616 3300026116 Bacteria 849
192 Ga0207683_10172071 3300026121 Bacteria 1962
193 Ga0207683_10542804 3300026121 Bacteria 1075
194 Ga0207683_11399570 3300026121 Bacteria 647
195 Ga0268264_11189374 3300028381 Bacteria 772
196 Ga0307408_101068082 3300031548 Unclassified 747
197 Ga0307514_10314139 3300031649 Bacteria 866
198 Ga0307413_11272611 3300031824 Bacteria 642
199 Ga0307413_11449943 3300031824 Unclassified 605
200 Ga0307410_10145023 3300031852 Bacteria 1761
201 Ga0307410_10475865 3300031852 Bacteria 1024
202 Ga0307406_10007108 3300031901 Bacteria 6199
203 Ga0307406_11140497 3300031901 Bacteria 675
204 Ga0307407_10155305 3300031903 Bacteria 1491
205 Ga0307409_100032320 3300031995 Bacteria 3792
206 Ga0307409_101223577 3300031995 Bacteria 775
207 Ga0307416_100335744 3300032002 Bacteria 1521
208 Ga0307416_102953272 3300032002 Bacteria 569
209 Ga0307416_103593569 3300032002 Unclassified 519
210 Ga0307414_10822167 3300032004 Unclassified 848
211 Ga0307411_10085205 3300032005 Bacteria 2188
212 Ga0307415_100037934 3300032126 Bacteria 3171
213 Ga0373954_0083949 3300035118 Bacteria 1524
214 Ga0373946_0188209 3300035171 Bacteria 983
215 Ga0373942_0255674 3300035207 Bacteria 597
216 Ga0373935_0620545 3300035692 Bacteria 792
217 Ga0373925_1174447 3300037068 Bacteria 631
218 Ga0395900_0013335 3300037418 Bacteria 8403
219 Ga0395900_0308346 3300037418 Bacteria 1567
220 Ga0395898_0104928 3300037466 Bacteria 2710
221 Ga0395905_0717194 3300037471 Bacteria 902
222 Ga0436364_0038611 3300037853 Bacteria 10770
223 Ga0395901_0019198 3300038443 Bacteria 6989
224 Ga0451833_0614778 3300041491 Bacteria 1083
225 Ga0451853_1377755 3300041512 Bacteria 730
226 Ga0439448_0036392 3300042005 Bacteria 1579
227 Ga0466969_0004778 3300044656 Bacteria 7214
228 Ga0466965_0120345 3300044683 Bacteria 1355
229 Ga0466965_0474442 3300044683 Bacteria 699
230 Ga0466966_0394613 3300044684 Bacteria 831
231 Ga0466966_0802320 3300044684 Bacteria 567
232 Ga0466961_0025992 3300044693 Bacteria 3763
233 Ga0466961_0262574 3300044693 Bacteria 1059
234 Ga0466961_0376900 3300044693 Bacteria 862
235 Ga0466963_0127910 3300044694 Bacteria 1752
236 Ga0466963_0166155 3300044694 Bacteria 1537
237 Ga0466964_0087686 3300044706 Bacteria 1349
238 Ga0466971_0035767 3300044719 Bacteria 2227
239 Ga0466971_0245608 3300044719 Bacteria 852
240 Ga0466970_0005362 3300044765 Bacteria 6361
241 Ga0466970_0028656 3300044765 Bacteria 2928
242 Ga0466970_0772980 3300044765 Bacteria 562
243 Ga0466957_0153531 3300044842 Bacteria 1491
244 Ga0466957_0200250 3300044842 Bacteria 1311
245 Ga0466957_0251091 3300044842 Bacteria 1176
246 Ga0466957_1390562 3300044842 Bacteria 511
247 Ga0466960_0023976 3300044901 Bacteria 2747
248 Ga0466960_0084872 3300044901 Bacteria 1603
249 Ga0466960_0163783 3300044901 Bacteria 1196
250 Ga0466960_0240891 3300044901 Bacteria 1002
251 Ga0466960_0242137 3300044901 Bacteria 999
252 Ga0466960_0551706 3300044901 Bacteria 680
253 Ga0466960_0651967 3300044901 Bacteria 628
254 Ga0466960_0816647 3300044901 Bacteria 565
255 Ga0466960_0823666 3300044901 Bacteria 563
256 Ga0466960_0903749 3300044901 Bacteria 539
257 Ga0466960_1005456 3300044901 Bacteria 512
258 Ga0466960_1038548 3300044901 Bacteria 505
259 Ga0466959_0024865 3300045049 Bacteria 4435
260 Ga0466959_0307552 3300045049 Unclassified 1085
261 Ga0466958_0059953 3300045836 Bacteria 2316
262 Ga0466967_0068616 3300045976 Bacteria 3167
263 Ga0466967_0467006 3300045976 Bacteria 1235
264 Ga0466967_0954621 3300045976 Bacteria 853
265 Ga0466967_1184866 3300045976 Bacteria 761
266 Ga0466967_1606938 3300045976 Bacteria 647
267 Ga0466967_2175463 3300045976 Bacteria 551
268 Ga0495580_0563164 3300046472 Bacteria 756
269 Ga0495639_0055179 3300046475 Bacteria 1812
270 Ga0495593_0279375 3300047673 Bacteria 835
271 Ga0496103_0653335 3300048906 Bacteria 668
272 Ga0496104_0086513 3300048907 Bacteria 2992
273 Ga0496105_0073615 3300048908 Bacteria 2822
274 Ga0496106_0598833 3300048909 Bacteria 883
275 Ga0496108_0008905 3300048911 Bacteria 8137
276 Ga0496109_0029872 3300048912 Bacteria 4884
277 Ga0496109_0350930 3300048912 Bacteria 1394
278 Ga0496110_0062653 3300048913 Bacteria 3285
279 Ga0496111_0167241 3300048914 Bacteria 1633
280 Ga0496112_0080570 3300048915 Bacteria 3219
281 Ga0496112_1565327 3300048915 Bacteria 573
282 Ga0496113_0047311 3300048916 Bacteria 3196
283 Ga0496114_0195942 3300048917 Bacteria 1768
284 Ga0496115_0622935 3300048918 Bacteria 856
285 Ga0501039_1123779 3300049575 Bacteria 609
286 Ga0501067_0102517 3300049583 Bacteria 1590
287 nmdc:mga05p37_158644_c1 3300050507 Unclassified 2763
288 nmdc:mga05p37_75231_c1 3300050507 Bacteria 4157
289 nmdc:mga09592_10067_c1 3300050508 Bacteria 7689
290 nmdc:mga0qj67_39530_c1 3300050509 Bacteria 3705
291 nmdc:mga0qj67_9101_c1 3300050509 Bacteria 7369
292 nmdc:mga06r32_22052_c1 3300050510 Bacteria 5884
293 nmdc:mga0rr50_145333_c1 3300050513 Bacteria 1911
294 Ga0466962_0151231 3300061719 Bacteria 1126
295 Ga0466962_0221222 3300061719 Bacteria 927
296 Ga0530510_0314252 3300061734 Bacteria 1174
297 Ga0530510_0330617 3300061734 Bacteria 1143
298 649810417 649633069 Bacteria 6962533
299 2501942401 2501939600 Bacteria 6907073
300 2623589962 2622736626 Bacteria 7181580
301 2827629366 2827628540 Bacteria 6858585
302 2855685483 2855683550 Bacteria 7134265
303 2856859932 2856858025 Bacteria 7255264
304 2858869801 2858868258 Bacteria 7683772
305 2862181558 2862178590 Bacteria 8583590
306 2883823992 2883821847 Bacteria 5121194
307 2902586585 2902582711 Bacteria 6187705
308 2996225342 2996221748 Bacteria 6799777
309 JGI24740J21852_10077194
310 JGI24739J22299_10123683
311 JGI24737J22298_10023699
312 JGI24735J21928_10137329
313 JGI24738J21930_10110152
314 Ga0070658_10861197
315 Ga0070683_100082553
316 Ga0070683_100617630
317 Ga0070683_101145562
318 Ga0070690_101017915
319 Ga0070670_101366441
320 Ga0070677_10246146
321 Ga0070680_100321535
322 Ga0070682_100157507
323 Ga0070682_100965535
324 Ga0068868_100074285
325 Ga0070691_10831079
326 Ga0070661_100144201
327 Ga0070661_101269869
328 Ga0070692_10350851
329 Ga0070692_11156577
330 Ga0070675_100665363
331 Ga0070674_100664934
332 Ga0070659_100036788
333 Ga0070714_100097003
334 Ga0070714_100423593
335 Ga0070714_100708505
336 Ga0070713_100001480
337 Ga0070713_100212303
338 Ga0070713_100212664
339 Ga0070711_100634226
340 Ga0070711_100646070
341 Ga0070678_100338096
342 Ga0070678_102225055
343 Ga0070681_10436845
344 Ga0070681_10728447
345 Ga0070681_11576582
346 Ga0068867_101819593
347 Ga0070706_100120955
348 Ga0070707_100148524
349 Ga0070698_100049654
350 Ga0070679_100053809
351 Ga0070679_100324878
352 Ga0070684_100042328
353 Ga0070684_100092975
354 Ga0068853_100790755
355 Ga0070672_100431704
356 Ga0070665_101130030
357 Ga0068855_100213920
358 Ga0070664_100050645
359 Ga0070664_100537753
360 Ga0070664_100888207
361 Ga0070664_101751971
362 Ga0068857_100305454
363 Ga0068857_100378815
364 Ga0068857_100426435
365 Ga0068854_102151340
366 Ga0068856_100019207
367 Ga0068856_101015186
368 Ga0068856_102425768
369 Ga0068852_100734225
370 Ga0068852_101202650
371 Ga0068864_100118157
372 Ga0068864_100739782
373 Ga0068864_101415432
374 Ga0068863_100046044
375 Ga0068860_101469951
376 Ga0070717_10115675
377 Ga0070717_10386320
378 Ga0070717_11930613
379 Ga0070715_10709891
380 Ga0070716_100331591
381 Ga0070716_100476887
382 Ga0070716_100790741
383 Ga0070712_100147460
384 Ga0070712_100576180
385 Ga0075428_100015429
386 Ga0075428_100113137
387 Ga0075430_100012600
388 Ga0075430_100027307
389 Ga0075431_100021815
390 Ga0075429_100019369
391 Ga0075435_100815395
392 Ga0075435_101474614
393 Ga0105240_10704129
394 Ga0105240_12698763
395 Ga0105245_10376827
396 Ga0105245_11400295
397 Ga0114129_10006319
398 Ga0114129_10528928
399 Ga0105241_10734375
400 Ga0105241_12575224
401 Ga0105242_11078991
402 Ga0105248_10298133
403 Ga0105248_12138577
404 Ga0105237_10443931
405 Ga0105249_10915704
406 Ga0105239_10624374
407 Ga0105239_10874705
408 Ga0105239_12589384
409 Ga0105246_10524747
410 Ga0105246_11701229
411 Ga0157342_1059033
412 Ga0157373_10180969
413 Ga0157370_10881773
414 Ga0157369_10017807
415 Ga0157369_10351301
416 Ga0157369_10399868
417 Ga0157369_11418383
418 Ga0157374_11566252
419 Ga0157374_12275808
420 Ga0157378_11793731
421 Ga0163162_10599354
422 Ga0163162_11496724
423 Ga0157372_10257650
424 Ga0157372_10480120
425 Ga0157372_10496077
426 Ga0157372_10858928
427 Ga0157372_11178668
428 Ga0157372_11410333
429 Ga0157375_10224549
430 Ga0157375_10305257
431 Ga0163163_10018814
432 Ga0163163_10247512
433 Ga0163163_10727670
434 Ga0163163_11275504
435 Ga0157380_10099988
436 Ga0157380_10101648
437 Ga0157380_11215009
438 Ga0157380_13052471
439 Ga0157379_10403176
440 Ga0157376_10796138
441 Ga0157376_12272092
442 Ga0163161_10149648
443 Ga0206349_1069586
444 Ga0206350_10504038
445 Ga0213875_10009584
446 Ga0224712_10101201
447 Ga0207680_10768933
448 Ga0207647_10178478
449 Ga0207685_10035829
450 Ga0207699_10198130
451 Ga0207699_10199422
452 Ga0207699_10583357
453 Ga0207705_10029017
454 Ga0207705_10189613
455 Ga0207695_10511215
456 Ga0207671_10713589
457 Ga0207693_10096372
458 Ga0207693_10131353
459 Ga0207693_10336768
460 Ga0207663_10262713
461 Ga0207660_10111456
462 Ga0207660_10515650
463 Ga0207662_10076989
464 Ga0207657_10239840
465 Ga0207649_10185712
466 Ga0207652_10143899
467 Ga0207652_10313319
468 Ga0207646_10145992
469 Ga0207646_11161736
470 Ga0207700_10007133
471 Ga0207700_10016706
472 Ga0207700_10144104
473 Ga0207664_10056824
474 Ga0207664_10068738
475 Ga0207690_10121590
476 Ga0207690_11632467
477 Ga0207686_11482192
478 Ga0207665_10113026
479 Ga0207691_10067717
480 Ga0207661_10121427
481 Ga0207661_10899315
482 Ga0207679_10197235
483 Ga0207679_11060003
484 Ga0207667_10190748
485 Ga0207651_10450696
486 Ga0207640_10700325
487 Ga0207640_11248179
488 Ga0207677_10784264
489 Ga0207703_10592170
490 Ga0207678_10487355
491 Ga0207708_10135580
492 Ga0207702_10010960
493 Ga0207641_10016771
494 Ga0207676_10069324
495 Ga0207676_11228154
496 Ga0207676_11521591
497 Ga0207674_10108492
498 Ga0207674_10417139
499 Ga0207674_10908616
500 Ga0207683_10172071
501 Ga0207683_10542804
502 Ga0207683_11399570
503 Ga0268264_11189374
504 Ga0307408_101068082
505 Ga0307514_10314139
506 Ga0307413_11272611
507 Ga0307413_11449943
508 Ga0307410_10145023
509 Ga0307410_10475865
510 Ga0307406_10007108
511 Ga0307406_11140497
512 Ga0307407_10155305
513 Ga0307409_100032320
514 Ga0307409_101223577
515 Ga0307416_100335744
516 Ga0307416_102953272
517 Ga0307416_103593569
518 Ga0307414_10822167
519 Ga0307411_10085205
520 Ga0307415_100037934
521 Ga0373954_0083949
522 Ga0373946_0188209
523 Ga0373942_0255674
524 Ga0373935_0620545
525 Ga0373925_1174447
526 Ga0395900_0013335
527 Ga0395900_0308346
528 Ga0395898_0104928
529 Ga0395905_0717194
530 Ga0436364_0038611
531 Ga0395901_0019198
532 Ga0451833_0614778
533 Ga0451853_1377755
534 Ga0439448_0036392
535 Ga0466969_0004778
536 Ga0466965_0120345
537 Ga0466965_0474442
538 Ga0466966_0394613
539 Ga0466966_0802320
540 Ga0466961_0025992
541 Ga0466961_0262574
542 Ga0466961_0376900
543 Ga0466963_0127910
544 Ga0466963_0166155
545 Ga0466964_0087686
546 Ga0466971_0035767
547 Ga0466971_0245608
548 Ga0466970_0005362
549 Ga0466970_0028656
550 Ga0466970_0772980
551 Ga0466957_0153531
552 Ga0466957_0200250
553 Ga0466957_0251091
554 Ga0466957_1390562
555 Ga0466960_0023976
556 Ga0466960_0084872
557 Ga0466960_0163783
558 Ga0466960_0240891
559 Ga0466960_0242137
560 Ga0466960_0551706
561 Ga0466960_0651967
562 Ga0466960_0816647
563 Ga0466960_0823666
564 Ga0466960_0903749
565 Ga0466960_1005456
566 Ga0466960_1038548
567 Ga0466959_0024865
568 Ga0466959_0307552
569 Ga0466958_0059953
570 Ga0466967_0068616
571 Ga0466967_0467006
572 Ga0466967_0954621
573 Ga0466967_1184866
574 Ga0466967_1606938
575 Ga0466967_2175463
576 Ga0495580_0563164
577 Ga0495639_0055179
578 Ga0495593_0279375
579 Ga0496103_0653335
580 Ga0496104_0086513
581 Ga0496105_0073615
582 Ga0496106_0598833
583 Ga0496108_0008905
584 Ga0496109_0029872
585 Ga0496109_0350930
586 Ga0496110_0062653
587 Ga0496111_0167241
588 Ga0496112_0080570
589 Ga0496112_1565327
590 Ga0496113_0047311
591 Ga0496114_0195942
592 Ga0496115_0622935
593 Ga0501039_1123779
594 Ga0501067_0102517
595 nmdc:mga05p37_158644_c1
596 nmdc:mga05p37_75231_c1
597 nmdc:mga09592_10067_c1
598 nmdc:mga0qj67_39530_c1
599 nmdc:mga0qj67_9101_c1
600 nmdc:mga06r32_22052_c1
601 nmdc:mga0rr50_145333_c1
602 Ga0466962_0151231
603 Ga0466962_0221222
604 Ga0530510_0314252
605 Ga0530510_0330617
606 649810417
607 2501942401
608 2623589962
609 2827629366
610 2855685483
611 2856859932
612 2858869801
613 2862181558
614 2883823992
615 2902586585
616 2996225342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6os5-assembly1.cif.gz_A crystal structure of cymd prenyltransferase complexed with l-tryptophan 0.5574 24 53
4dlh-assembly2.cif.gz_B crystal structure of the protein q9hre7 from halobacterium salinarium at the resolution 1.9a, northeast structural genomics consortium (nesg) target hsr50 0.5504 8 57
7oyc-assembly1.cif.gz_11 cryo-em structure of the xenopus egg 80s ribosome 0.5232 1 66
7oya-assembly1.cif.gz_11 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.5221 1 66
7aoi-assembly1.cif.gz_AK trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.5189 25 56
ID Description Score Start End Superfamily
af_F4JUX3_73_134_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6423 23 70 2.30.30.30
af_K7KA31_292_412_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6249 14 59 3.90.70.10
3cinA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.6187 29 54 3.30.360.10
af_Q54F16_21_348_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.5461 30 69 3.90.70.10
af_Q9UU84_90_243_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5423 23 54 2.60.40.640
ID Description Score Start End GO Terms
AF-A0A3D9VAV6-F1-model_v4 Uncharacterized protein 0.9879 5 95
AF-A0A7J5BLD0-F1-model_v4 Dihydrofolate reductase 0.9877 3 92 GO:0008703
GO:0009231
AF-A0A1H1YGY9-F1-model_v4 Uncharacterized protein 0.987 4 95
AF-A0A1C4ULZ9-F1-model_v4 Uncharacterized protein 0.9843 14 95
AF-A0A852Z9T5-F1-model_v4 Uncharacterized protein 0.9806 2 95

Map