F399464

General Info

Members Datasets Scaffolds Average Seq Length
307 245 234 248

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003570095|8003575498
Length 283
Sequence VHDEAGDRAGTLALIIDGDNATPKIVNGLLAEIANYGTASVKRVYGDWTKPNLNGWKECLLEHSIQPVQQFAYTTGKNATDGAMIIDAMDLLYTGRFDGFCIVSSDSDFARLAARIREQGVTVYGFGERKTPRPFITACDKFVYFDVLNASVEDLATAEPAPTPGRAAVTKAAAKEIPVPATRPAPTTPVEPAAPQKSKIDKALIGMLTKAVIATADEDGWVNLGAVGSHVAKQSPEFDSRNYGFARLSDLVEATGKFDIDRSGKTQKGVLIHLKPASNATKK

Samples

Sample ID Description Type Environment
1 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
2 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
3 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
4 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
5 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
6 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
7 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
8 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
9 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
10 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
11 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
12 2718217882 Rhizobium sp. N741 Isolate Nodule
13 2718217927 Rhizobium sp. N324 Isolate Nodule
14 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
15 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
16 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
17 2721755809 Rhizobium sp. N541 Isolate Nodule
18 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
19 2728369365 Rhizobium sp. N1341 Isolate Nodule
20 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
21 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
22 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
23 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
24 2802429637 Rhizobium anhuiense C15 Isolate Nodule
25 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
26 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
27 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
28 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
29 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
30 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
31 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
32 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
33 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
34 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
35 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
36 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
37 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
38 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
39 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
40 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
41 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
42 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
43 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
44 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
45 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
46 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
47 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
48 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
49 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
50 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
51 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
52 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
53 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
54 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
55 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
56 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
57 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
58 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
59 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
60 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
61 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
62 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
63 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
64 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
65 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
66 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
74 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
101 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
107 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
108 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
163 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
164 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
167 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
168 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
171 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
172 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
233 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
234 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
235 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
236 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
239 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
240 8005275841 Rhizobium sp. N4311 Isolate Nodule
241 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
242 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
243 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
244 8018176218 Rhizobium sp. N122 Isolate Nodule
245 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.9
Metatranscriptomes 0.33
Isolates 23.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.66
Nodule 16.29
Rhizoplane 1.95
Rhizosphere 43.32
Stem 0
Stem Tuber 0
Unclassified 23.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1002097 3300002773 Bacteria 7838
2 JGI25153J46596_10000364 3300003215 Bacteria 31112
3 JGI25160J50197_1033559 3300003354 Bacteria 1289
4 Ga0006562J51391_1097923 3300003578 Bacteria 2051
5 Ga0055526_1004689 3300003771 Bacteria 8118
6 Ga0055526_1008581 3300003771 Bacteria 5065
7 Ga0055526_1030075 3300003771 Bacteria 1594
8 Ga0055524_1042170 3300003775 Bacteria 1139
9 Ga0055536_1000322 3300003781 Bacteria 35464
10 Ga0055536_1004927 3300003781 Bacteria 6654
11 Ga0055530_10001028 3300003791 Bacteria 22203
12 Ga0055540_1010267 3300003792 Bacteria 3129
13 Ga0055531_10002227 3300003794 Bacteria 13159
14 Ga0055531_10007713 3300003794 Bacteria 5811
15 Ga0055543_1002326 3300004625 Bacteria 6382
16 Ga0065165_1011437 3300005262 Bacteria 3702
17 Ga0070658_10359622 3300005327 Bacteria 1246
18 Ga0070670_100000566 3300005331 Bacteria 29318
19 Ga0070668_100007251 3300005347 Bacteria 8222
20 Ga0070669_100090281 3300005353 Bacteria 2296
21 Ga0070675_100454588 3300005354 Bacteria 1149
22 Ga0070681_10048313 3300005458 Bacteria 4253
23 Ga0068867_100655782 3300005459 Bacteria 921
24 Ga0070699_100374373 3300005518 Bacteria 1285
25 Ga0070679_100166297 3300005530 Bacteria 2179
26 Ga0070665_100020030 3300005548 Bacteria 6717
27 Ga0070665_100370419 3300005548 Bacteria 1439
28 Ga0070665_100497362 3300005548 Bacteria 1230
29 Ga0068859_100272112 3300005617 Bacteria 1786
30 Ga0068863_101035315 3300005841 Bacteria 824
31 Ga0068862_100274556 3300005844 Bacteria 1543
32 Ga0081455_10019067 3300005937 Bacteria 6504
33 Ga0081540_1019640 3300005983 Bacteria 4097
34 Ga0070712_100172448 3300006175 Bacteria 1679
35 Ga0075436_100033168 3300006914 Bacteria 3559
36 Ga0097620_100272110 3300006931 Bacteria 1786
37 Ga0099795_10138511 3300007788 Bacteria 988
38 Ga0105240_10076567 3300009093 Bacteria 4124
39 Ga0105241_10201325 3300009174 Bacteria 1663
40 Ga0105237_10140283 3300009545 Bacteria 2411
41 Ga0105238_10187484 3300009551 Bacteria 2045
42 Ga0123342_1027902 3300009766 Bacteria 3106
43 Ga0105032_100902 3300009979 Bacteria 2787
44 Ga0105239_10372622 3300010375 Bacteria 1613
45 Ga0157370_10019030 3300013104 Bacteria 6903
46 Ga0157369_10016091 3300013105 Bacteria 8417
47 Ga0157372_10318865 3300013307 Bacteria 1809
48 Ga0157372_10689886 3300013307 Bacteria 1188
49 Ga0214544_1000029 3300021320 Bacteria 153924
50 Ga0214542_1000092 3300021321 Bacteria 117288
51 Ga0214542_1017593 3300021321 Bacteria 6384
52 Ga0214543_1000045 3300021327 Bacteria 152699
53 Ga0213876_10001129 3300021384 Bacteria 17033
54 Ga0213876_10003173 3300021384 Bacteria 9459
55 Ga0207425_1011914 3300025245 Bacteria 2057
56 Ga0209233_1001772 3300025261 Bacteria 8325
57 Ga0209130_1013968 3300025284 Bacteria 2035
58 Ga0209676_1000373 3300025292 Bacteria 83050
59 Ga0209676_1002440 3300025292 Bacteria 13211
60 Ga0209025_1012503 3300025294 Bacteria 5431
61 Ga0209564_1001258 3300025295 Bacteria 28087
62 Ga0209564_1014964 3300025295 Bacteria 3188
63 Ga0209758_1000011 3300025297 Bacteria 1049685
64 Ga0209758_1011783 3300025297 Bacteria 5008
65 Ga0209758_1029327 3300025297 Bacteria 2304
66 Ga0209050_1000387 3300025298 Bacteria 83122
67 Ga0209256_1004222 3300025299 Bacteria 9211
68 Ga0209256_1005167 3300025299 Bacteria 7692
69 Ga0207426_1007641 3300025302 Bacteria 4494
70 Ga0209051_1000916 3300025303 Bacteria 29312
71 Ga0209257_1001775 3300025304 Bacteria 23848
72 Ga0209257_1001952 3300025304 Bacteria 22259
73 Ga0209257_1003170 3300025304 Bacteria 14628
74 Ga0207663_10134936 3300025916 Bacteria 1711
75 Ga0207652_10349385 3300025921 Bacteria 1335
76 Ga0207681_10421508 3300025923 Bacteria 1081
77 Ga0207694_10135520 3300025924 Bacteria 1977
78 Ga0207650_10000822 3300025925 Bacteria 23833
79 Ga0207668_10012286 3300025972 Bacteria 5236
80 Ga0207639_10468124 3300026041 Bacteria 1147
81 Ga0209371_1000845 3300027312 Bacteria 24984
82 Ga0209371_1022964 3300027312 Bacteria 1480
83 Ga0268266_10014573 3300028379 Bacteria 6756
84 Ga0268265_10439951 3300028380 Bacteria 1215
85 Ga0265326_10005561 3300028558 Bacteria 3969
86 Ga0265334_10010590 3300028573 Bacteria 3892
87 Ga0265323_10005631 3300028653 Bacteria 5316
88 Ga0307515_10030307 3300028794 Bacteria 9091
89 Ga0307515_10076791 3300028794 Eukaryota 4423
90 Ga0265338_10025586 3300028800 Bacteria 5984
91 Ga0265324_10017450 3300029957 Bacteria 2610
92 Ga0268256_1000694 3300030500 Bacteria 25207
93 Ga0268256_1025959 3300030500 Bacteria 1480
94 Ga0307511_10066458 3300030521 Bacteria 2687
95 Ga0265340_10007989 3300031247 Bacteria 5732
96 Ga0307513_10009275 3300031456 Bacteria 12458
97 Ga0307408_100014002 3300031548 Bacteria 5327
98 Ga0307408_100279736 3300031548 Bacteria 1389
99 Ga0307516_10068530 3300031730 Bacteria 3416
100 Ga0316577_10135799 3300031733 Bacteria 1385
101 Ga0307413_10253390 3300031824 Bacteria 1307
102 Ga0307406_10001970 3300031901 Bacteria 11211
103 Ga0307412_10005516 3300031911 Bacteria 7105
104 Ga0307412_10475586 3300031911 Bacteria 1035
105 Ga0307409_100014440 3300031995 Bacteria 5138
106 Ga0307414_10000023 3300032004 Bacteria 208037
107 Ga0307414_10003246 3300032004 Bacteria 8661
108 Ga0307414_10035683 3300032004 Bacteria 3312
109 Ga0307414_10462285 3300032004 Bacteria 1115
110 Ga0373923_0099854 3300035111 Bacteria 1279
111 Ga0316574_0227885 3300035398 Bacteria 1193
112 Ga0373947_0259675 3300035725 Bacteria 1151
113 Ga0316582_0284301 3300036647 Bacteria 1135
114 Ga0395900_0193439 3300037418 Bacteria 2062
115 Ga0436365_1067401 3300039437 Bacteria 3202
116 Ga0436365_1650855 3300039437 Bacteria 128546
117 Ga0436362_1093279 3300039453 Bacteria 4905
118 Ga0439465_0039980 3300041413 Bacteria 1515
119 Ga0451800_0334509 3300041459 Bacteria 1295
120 Ga0451835_0613083 3300041492 Bacteria 2630
121 Ga0451837_1310585 3300041494 Bacteria 3484
122 Ga0451839_0902549 3300041496 Bacteria 2406
123 Ga0451839_1477032 3300041496 Bacteria 1549
124 Ga0451841_0853971 3300041498 Bacteria 2130
125 Ga0451845_0699423 3300041501 Bacteria 5752
126 Ga0451847_0100579 3300041503 Bacteria 3111
127 Ga0451849_0833688 3300041505 Bacteria 4998
128 Ga0451851_0666566 3300041507 Bacteria 2442
129 Ga0451843_0220636 3300041509 Bacteria 2391
130 Ga0451855_0501920 3300041511 Bacteria 4107
131 Ga0451853_1185870 3300041512 Bacteria 2243
132 Ga0450893_0020755 3300042532 Bacteria 1131
133 Ga0450901_006521 3300042533 Bacteria 1200
134 Ga0466977_0000410 3300044666 Bacteria 13562
135 Ga0466961_0074930 3300044693 Bacteria 2146
136 Ga0495605_0025539 3300046474 Bacteria 3078
137 Ga0495585_0017018 3300046492 Bacteria 4208
138 Ga0495585_0032922 3300046492 Bacteria 2936
139 Ga0495585_0043055 3300046492 Bacteria 2527
140 Ga0495585_0211672 3300046492 Bacteria 982
141 Ga0495607_0000001 3300046501 Bacteria 1245328
142 Ga0495620_0000495 3300046515 Bacteria 25595
143 Ga0495643_0220340 3300046522 Bacteria 900
144 Ga0495648_0003826 3300046524 Bacteria 13069
145 Ga0495663_0026450 3300046525 Bacteria 1699
146 Ga0495597_0003904 3300046542 Bacteria 8421
147 Ga0495633_0000930 3300046558 Bacteria 24778
148 Ga0495633_0092660 3300046558 Bacteria 1404
149 Ga0495656_0106893 3300046615 Bacteria 1303
150 Ga0495668_0185587 3300046616 Bacteria 1139
151 Ga0495625_0036598 3300046660 Bacteria 3607
152 Ga0495625_0176848 3300046660 Bacteria 1422
153 Ga0495661_0092507 3300046665 Bacteria 1718
154 Ga0495588_0147621 3300046674 Bacteria 1243
155 Ga0495599_0222033 3300046678 Bacteria 1156
156 Ga0495670_0000001 3300046691 Bacteria 1556780
157 Ga0495670_0000469 3300046691 Bacteria 19212
158 Ga0495649_0024243 3300046694 Bacteria 3384
159 Ga0495672_0000058 3300047320 Bacteria 218319
160 Ga0495687_000546 3300047443 Bacteria 45042
161 Ga0495686_0008254 3300047472 Bacteria 7670
162 Ga0496105_0110687 3300048908 Bacteria 2267
163 Ga0496106_0104592 3300048909 Bacteria 2199
164 Ga0496110_0334867 3300048913 Bacteria 1379
165 Ga0496115_0112281 3300048918 Bacteria 2239
166 Ga0496116_0002287 3300048919 Bacteria 20319
167 Ga0496117_0002886 3300048920 Bacteria 20840
168 Ga0496119_0004740 3300048922 Bacteria 13365
169 Ga0496119_0009107 3300048922 Bacteria 8596
170 Ga0496120_0000399 3300048923 Bacteria 70103
171 Ga0496121_0003096 3300048924 Bacteria 24045
172 Ga0496121_0412076 3300048924 Bacteria 882
173 Ga0496122_0000004 3300048925 Bacteria 645283
174 Ga0496122_0000868 3300048925 Bacteria 56966
175 Ga0496122_0009006 3300048925 Bacteria 10605
176 Ga0496122_0016578 3300048925 Bacteria 6957
177 Ga0496122_0099520 3300048925 Bacteria 1949
178 Ga0496123_0000007 3300048926 Bacteria 645283
179 Ga0496123_0000682 3300048926 Bacteria 55995
180 Ga0496123_0001072 3300048926 Bacteria 41355
181 Ga0496123_0012867 3300048926 Bacteria 7087
182 Ga0496124_0000921 3300048927 Bacteria 47487
183 Ga0496124_0001984 3300048927 Bacteria 27899
184 Ga0496124_0002774 3300048927 Bacteria 22252
185 Ga0496124_0004364 3300048927 Bacteria 16543
186 Ga0496124_0190715 3300048927 Bacteria 1569
187 Ga0496125_0000294 3300048928 Bacteria 98233
188 Ga0496125_0001637 3300048928 Bacteria 31568
189 Ga0496125_0022171 3300048928 Bacteria 5902
190 Ga0496125_0071070 3300048928 Bacteria 2721
191 Ga0496126_0000152 3300048929 Bacteria 161615
192 Ga0496126_0022416 3300048929 Bacteria 6147
193 Ga0496126_0322969 3300048929 Bacteria 1268
194 Ga0495678_000609 3300049459 Bacteria 33612
195 Ga0501031_0024208 3300049568 Bacteria 3958
196 Ga0501032_0022243 3300049569 Bacteria 4396
197 Ga0501034_0001574 3300049571 Bacteria 29832
198 Ga0501034_0029741 3300049571 Bacteria 5553
199 Ga0501034_0407727 3300049571 Bacteria 1281
200 Ga0501034_0572966 3300049571 Bacteria 1036
201 Ga0501034_0605637 3300049571 Bacteria 1001
202 Ga0501036_0038169 3300049572 Bacteria 4064
203 Ga0501036_0100592 3300049572 Bacteria 2445
204 Ga0501037_0045531 3300049573 Bacteria 3221
205 Ga0501037_0057504 3300049573 Bacteria 2839
206 Ga0501037_0297441 3300049573 Bacteria 1121
207 Ga0501038_0017483 3300049574 Bacteria 6482
208 Ga0501038_0446118 3300049574 Bacteria 995
209 Ga0501038_0529688 3300049574 Bacteria 898
210 Ga0501039_0214712 3300049575 Bacteria 1513
211 Ga0501041_0481808 3300049577 Bacteria 789
212 Ga0501043_0016294 3300049579 Bacteria 5828
213 Ga0501046_0031362 3300049580 Bacteria 4308
214 Ga0501047_0018103 3300049581 Bacteria 6751
215 Ga0501047_0443635 3300049581 Bacteria 1127
216 Ga0501048_0388829 3300049582 Bacteria 996
217 Ga0501070_0090322 3300049586 Bacteria 2535
218 Ga0501070_0176754 3300049586 Bacteria 1757
219 Ga0501075_0554958 3300049591 Bacteria 877
220 Ga0501076_0569356 3300049592 Bacteria 934
221 Ga0501035_0017836 3300049822 Bacteria 6547
222 Ga0501044_0107261 3300049823 Bacteria 2804
223 nmdc:mga03n38_58229_c1 3300050490 Bacteria 1750
224 nmdc:mga0yw44_208945_c1 3300050492 Bacteria 1291
225 nmdc:mga07m45_72989_c1 3300050496 Bacteria 1954
226 Ga0500578_0001440 3300053086 Bacteria 23748
227 Ga0500562_000817 3300053108 Bacteria 7591
228 Ga0500572_006311 3300053111 Bacteria 2713
229 Ga0500607_037085 3300053121 Eukaryota 2658
230 Ga0500652_043976 3300053131 Bacteria 1807
231 Ga0500564_034096 3300053138 Bacteria 2349
232 Ga0500573_0160027 3300053140 Bacteria 1226
233 Ga0500624_004740 3300053157 Bacteria 1797
234 Ga0530510_0077614 3300061734 Bacteria 2414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10035683 Ga0307414_100356833 205
2 3300042533 Ga0450901_006521 Ga0450901_006521_441_1181 206
3 3300026041 Ga0207639_10468124 Ga0207639_104681242 209
4 iso_pu_bacteria 2858688981 2858697775 218
5 3300003771 Ga0055526_1004689 Ga0055526_10046894 221
6 3300003781 Ga0055536_1004927 Ga0055536_10049272 221
7 3300003794 Ga0055531_10002227 Ga0055531_100022276 221
8 3300025292 Ga0209676_1002440 Ga0209676_10024406 221
9 3300025295 Ga0209564_1001258 Ga0209564_10012586 221
10 3300025299 Ga0209256_1004222 Ga0209256_10042226 221
11 3300025304 Ga0209257_1003170 Ga0209257_100317011 221
12 3300046694 Ga0495649_0024243 Ga0495649_0024243_642_1433 221
13 3300028794 Ga0307515_10030307 Ga0307515_100303075 222
14 3300046616 Ga0495668_0185587 Ga0495668_0185587_136_939 222
15 3300046492 Ga0495585_0211672 Ga0495585_0211672_24_827 223
16 3300046501 Ga0495607_0000001 Ga0495607_0000001_144784_145587 223
17 3300046525 Ga0495663_0026450 Ga0495663_0026450_436_1239 223
18 3300047320 Ga0495672_0000058 Ga0495672_0000058_5807_6610 223
19 3300047472 Ga0495686_0008254 Ga0495686_0008254_2043_2846 223
20 3300021384 Ga0213876_10001129 Ga0213876_1000112915 224
21 3300031911 Ga0307412_10005516 Ga0307412_100055168 224
22 3300039437 Ga0436365_1650855 Ga0436365_1650855_37950_38636 224
23 3300048927 Ga0496124_0001984 Ga0496124_0001984_20587_21357 224
24 iso_pu_bacteria 2841957949 2841959943 224
25 3300031456 Ga0307513_10009275 Ga0307513_1000927511 225
26 3300006914 Ga0075436_100033168 Ga0075436_1000331681 226
27 3300048919 Ga0496116_0002287 Ga0496116_0002287_11561_12334 226
28 3300048920 Ga0496117_0002886 Ga0496117_0002886_12864_13637 226
29 3300048922 Ga0496119_0009107 Ga0496119_0009107_134_907 226
30 3300048924 Ga0496121_0003096 Ga0496121_0003096_12622_13395 226
31 3300048925 Ga0496122_0016578 Ga0496122_0016578_3225_3998 226
32 3300048926 Ga0496123_0012867 Ga0496123_0012867_3575_4348 226
33 3300048927 Ga0496124_0000921 Ga0496124_0000921_31017_31790 226
34 3300048927 Ga0496124_0002774 Ga0496124_0002774_15720_16493 226
35 3300048928 Ga0496125_0022171 Ga0496125_0022171_2085_2858 226
36 3300048929 Ga0496126_0022416 Ga0496126_0022416_4215_4988 226
37 iso_pu_bacteria 2512047086 2512531489 226
38 iso_pu_bacteria 2838074704 2838079824 226
39 iso_pu_bacteria 2854896431 2854898897 226
40 iso_pu_bacteria 2913295892 2913298999 226
41 3300046558 Ga0495633_0000930 Ga0495633_0000930_20973_21704 227
42 3300048925 Ga0496122_0099520 Ga0496122_0099520_994_1764 228
43 3300049574 Ga0501038_0529688 Ga0501038_0529688_130_852 228
44 3300007788 Ga0099795_10138511 Ga0099795_101385111 230
45 3300046515 Ga0495620_0000495 Ga0495620_0000495_16546_17292 230
46 iso_pu_bacteria 2818991461 2819687872 231
47 3300005331 Ga0070670_100000566 Ga0070670_10000056611 232
48 3300009766 Ga0123342_1027902 Ga0123342_10279021 232
49 3300025925 Ga0207650_10000822 Ga0207650_100008228 232
50 3300039437 Ga0436365_1067401 Ga0436365_1067401_1296_2048 232
51 3300039453 Ga0436362_1093279 Ga0436362_1093279_14_712 232
52 3300046542 Ga0495597_0003904 Ga0495597_0003904_5625_6419 232
53 3300046691 Ga0495670_0000001 Ga0495670_0000001_39227_40021 232
54 iso_pu_bacteria 2600254933 2600375128 232
55 iso_pu_bacteria 2841846520 2841848575 232
56 iso_pu_bacteria 2842124991 2842125394 232
57 iso_pu_bacteria 2919114240 2919119754 232
58 iso_pu_bacteria 2928972540 2928972838 232
59 iso_pu_bacteria 2977240413 2977242618 232
60 iso_pu_bacteria 2989349275 2989349887 232
61 3300041492 Ga0451835_0613083 Ga0451835_0613083_800_1576 233
62 3300041494 Ga0451837_1310585 Ga0451837_1310585_938_1714 233
63 3300041496 Ga0451839_0902549 Ga0451839_0902549_614_1390 233
64 3300041498 Ga0451841_0853971 Ga0451841_0853971_441_1217 233
65 3300041501 Ga0451845_0699423 Ga0451845_0699423_3244_4020 233
66 3300041503 Ga0451847_0100579 Ga0451847_0100579_735_1511 233
67 3300041505 Ga0451849_0833688 Ga0451849_0833688_2646_3422 233
68 3300041507 Ga0451851_0666566 Ga0451851_0666566_879_1655 233
69 3300041509 Ga0451843_0220636 Ga0451843_0220636_1175_1951 233
70 3300041511 Ga0451855_0501920 Ga0451855_0501920_1197_1973 233
71 3300041512 Ga0451853_1185870 Ga0451853_1185870_1033_1809 233
72 3300046474 Ga0495605_0025539 Ga0495605_0025539_1603_2379 233
73 3300046492 Ga0495585_0032922 Ga0495585_0032922_411_1187 233
74 3300046660 Ga0495625_0036598 Ga0495625_0036598_1534_2310 233
75 3300046665 Ga0495661_0092507 Ga0495661_0092507_663_1439 233
76 iso_pu_bacteria 2903448605 2903453818 233
77 iso_pu_bacteria 2968083720 2968085128 233
78 3300005458 Ga0070681_10048313 Ga0070681_100483136 234
79 3300005530 Ga0070679_100166297 Ga0070679_1001662971 234
80 3300025921 Ga0207652_10349385 Ga0207652_103493852 234
81 3300032004 Ga0307414_10462285 Ga0307414_104622852 234
82 3300047443 Ga0495687_000546 Ga0495687_000546_8950_9735 234
83 3300049569 Ga0501032_0022243 Ga0501032_0022243_3542_4282 234
84 3300049571 Ga0501034_0572966 Ga0501034_0572966_254_994 234
85 3300049572 Ga0501036_0100592 Ga0501036_0100592_1026_1766 234
86 3300049573 Ga0501037_0297441 Ga0501037_0297441_254_994 234
87 3300049574 Ga0501038_0017483 Ga0501038_0017483_1012_1752 234
88 3300049579 Ga0501043_0016294 Ga0501043_0016294_4418_5158 234
89 3300049581 Ga0501047_0443635 Ga0501047_0443635_147_887 234
90 3300049586 Ga0501070_0176754 Ga0501070_0176754_664_1404 234
91 3300049822 Ga0501035_0017836 Ga0501035_0017836_136_876 234
92 3300049823 Ga0501044_0107261 Ga0501044_0107261_378_1118 234
93 3300003215 JGI25153J46596_10000364 JGI25153J46596_1000036427 235
94 3300003771 Ga0055526_1030075 Ga0055526_10300751 235
95 3300003775 Ga0055524_1042170 Ga0055524_10421701 235
96 3300003781 Ga0055536_1000322 Ga0055536_100032224 235
97 3300003791 Ga0055530_10001028 Ga0055530_100010287 235
98 3300003792 Ga0055540_1010267 Ga0055540_10102673 235
99 3300003794 Ga0055531_10007713 Ga0055531_100077133 235
100 3300005262 Ga0065165_1011437 Ga0065165_10114372 235
101 3300005548 Ga0070665_100370419 Ga0070665_1003704191 235
102 3300009979 Ga0105032_100902 Ga0105032_1009023 235
103 3300025245 Ga0207425_1011914 Ga0207425_10119142 235
104 3300025292 Ga0209676_1000373 Ga0209676_100037327 235
105 3300025295 Ga0209564_1014964 Ga0209564_10149643 235
106 3300025297 Ga0209758_1000011 Ga0209758_100001175 235
107 3300025298 Ga0209050_1000387 Ga0209050_100038727 235
108 3300025299 Ga0209256_1005167 Ga0209256_10051672 235
109 3300025303 Ga0209051_1000916 Ga0209051_100091616 235
110 3300025304 Ga0209257_1001775 Ga0209257_100177510 235
111 3300025304 Ga0209257_1001952 Ga0209257_100195221 235
112 3300027312 Ga0209371_1022964 Ga0209371_10229642 235
113 3300030500 Ga0268256_1025959 Ga0268256_10259592 235
114 3300031548 Ga0307408_100014002 Ga0307408_1000140022 235
115 3300031730 Ga0307516_10068530 Ga0307516_100685303 235
116 3300031901 Ga0307406_10001970 Ga0307406_100019702 235
117 3300031995 Ga0307409_100014440 Ga0307409_1000144404 235
118 3300046522 Ga0495643_0220340 Ga0495643_0220340_26_826 235
119 3300048928 Ga0496125_0071070 Ga0496125_0071070_426_1169 235
120 3300049577 Ga0501041_0481808 Ga0501041_0481808_44_757 235
121 3300053138 Ga0500564_034096 Ga0500564_034096_386_1171 235
122 3300053140 Ga0500573_0160027 Ga0500573_0160027_218_961 235
123 3300053157 Ga0500624_004740 Ga0500624_004740_297_1082 235
124 iso_pu_bacteria 2838042994 2838044417 235
125 3300003578 Ga0006562J51391_1097923 Ga0006562J51391_10979232 236
126 3300005347 Ga0070668_100007251 Ga0070668_1000072516 236
127 3300005353 Ga0070669_100090281 Ga0070669_1000902811 236
128 3300005548 Ga0070665_100020030 Ga0070665_1000200304 236
129 3300005617 Ga0068859_100272112 Ga0068859_1002721121 236
130 3300005841 Ga0068863_101035315 Ga0068863_1010353151 236
131 3300005844 Ga0068862_100274556 Ga0068862_1002745562 236
132 3300006931 Ga0097620_100272110 Ga0097620_1002721103 236
133 3300013104 Ga0157370_10019030 Ga0157370_100190307 236
134 3300013105 Ga0157369_10016091 Ga0157369_100160917 236
135 3300013307 Ga0157372_10318865 Ga0157372_103188652 236
136 3300025294 Ga0209025_1012503 Ga0209025_10125036 236
137 3300025297 Ga0209758_1029327 Ga0209758_10293273 236
138 3300025923 Ga0207681_10421508 Ga0207681_104215081 236
139 3300025972 Ga0207668_10012286 Ga0207668_100122867 236
140 3300027312 Ga0209371_1000845 Ga0209371_100084511 236
141 3300028379 Ga0268266_10014573 Ga0268266_100145734 236
142 3300028380 Ga0268265_10439951 Ga0268265_104399511 236
143 3300030500 Ga0268256_1000694 Ga0268256_100069420 236
144 3300048918 Ga0496115_0112281 Ga0496115_0112281_448_1224 236
145 3300048922 Ga0496119_0004740 Ga0496119_0004740_458_1255 236
146 3300048923 Ga0496120_0000399 Ga0496120_0000399_49491_50288 236
147 3300048925 Ga0496122_0000004 Ga0496122_0000004_221506_222303 236
148 3300048925 Ga0496122_0009006 Ga0496122_0009006_6358_7089 236
149 3300048926 Ga0496123_0000007 Ga0496123_0000007_221506_222303 236
150 3300048926 Ga0496123_0001072 Ga0496123_0001072_5786_6517 236
151 3300048927 Ga0496124_0004364 Ga0496124_0004364_15067_15864 236
152 3300048928 Ga0496125_0001637 Ga0496125_0001637_18952_19749 236
153 3300049568 Ga0501031_0024208 Ga0501031_0024208_1576_2328 236
154 3300049571 Ga0501034_0001574 Ga0501034_0001574_14988_15740 236
155 3300049572 Ga0501036_0038169 Ga0501036_0038169_1200_1952 236
156 3300049573 Ga0501037_0057504 Ga0501037_0057504_951_1703 236
157 3300049574 Ga0501038_0446118 Ga0501038_0446118_68_820 236
158 3300049575 Ga0501039_0214712 Ga0501039_0214712_593_1309 236
159 3300049580 Ga0501046_0031362 Ga0501046_0031362_3124_3876 236
160 3300049581 Ga0501047_0018103 Ga0501047_0018103_4245_4997 236
161 3300049582 Ga0501048_0388829 Ga0501048_0388829_43_795 236
162 3300049586 Ga0501070_0090322 Ga0501070_0090322_1342_2094 236
163 3300050490 nmdc:mga03n38_58229_c1 nmdc:mga03n38_58229_c1_771_1577 236
164 3300050496 nmdc:mga07m45_72989_c1 nmdc:mga07m45_72989_c1_339_1145 236
165 3300053108 Ga0500562_000817 Ga0500562_000817_6590_7327 236
166 iso_pu_bacteria 2513237305 2514417819 236
167 iso_pu_bacteria 2643221574 2643884011 236
168 iso_pu_bacteria 2643221699 2644549946 236
169 iso_pu_bacteria 2802429606 2805937073 236
170 iso_pu_bacteria 2802429637 2806077526 236
171 iso_pu_bacteria 2920760137 2920767314 236
172 3300009551 Ga0105238_10187484 Ga0105238_101874842 237
173 3300010375 Ga0105239_10372622 Ga0105239_103726222 237
174 3300025924 Ga0207694_10135520 Ga0207694_101355201 237
175 iso_pu_bacteria 2585427590 2585821441 237
176 iso_pu_bacteria 2718217882 2719184395 237
177 iso_pu_bacteria 2721755684 2723558550 237
178 iso_pu_bacteria 2728369365 2730160511 237
179 iso_pu_bacteria 2933594066 2933598831 237
180 iso_pu_bacteria 2970156795 2970160360 237
181 3300005459 Ga0068867_100655782 Ga0068867_1006557821 238
182 3300005983 Ga0081540_1019640 Ga0081540_10196403 238
183 3300028558 Ga0265326_10005561 Ga0265326_100055611 238
184 3300028573 Ga0265334_10010590 Ga0265334_100105902 238
185 3300028653 Ga0265323_10005631 Ga0265323_100056315 238
186 3300028800 Ga0265338_10025586 Ga0265338_100255865 238
187 3300029957 Ga0265324_10017450 Ga0265324_100174503 238
188 3300046660 Ga0495625_0176848 Ga0495625_0176848_103_948 238
189 3300049591 Ga0501075_0554958 Ga0501075_0554958_22_744 238
190 iso_pu_bacteria 2643221614 2644085669 238
191 iso_pu_bacteria 2643221661 2644343220 238
192 iso_pu_bacteria 2643221666 2644366520 238
193 3300025261 Ga0209233_1001772 Ga0209233_10017726 239
194 3300031733 Ga0316577_10135799 Ga0316577_101357992 239
195 3300036647 Ga0316582_0284301 Ga0316582_0284301_81_824 239
196 3300042532 Ga0450893_0020755 Ga0450893_0020755_349_1104 239
197 iso_pu_bacteria 2721755702 2723641704 239
198 iso_pu_bacteria 2721755819 2724087900 239
199 iso_pu_bacteria 2989349275 2989352140 239
200 3300032004 Ga0307414_10000023 Ga0307414_1000002365 240
201 3300035398 Ga0316574_0227885 Ga0316574_0227885_133_861 240
202 3300044693 Ga0466961_0074930 Ga0466961_0074930_110_988 240
203 3300048927 Ga0496124_0190715 Ga0496124_0190715_166_912 240
204 3300048928 Ga0496125_0000294 Ga0496125_0000294_4098_4844 240
205 3300053086 Ga0500578_0001440 Ga0500578_0001440_14556_15356 240
206 iso_pu_bacteria 2842229732 2842236124 240
207 iso_pu_bacteria 2941485952 2941487641 240
208 iso_pu_bacteria 2967721400 2967725067 240
209 iso_pu_bacteria 2970019648 2970024365 240
210 iso_pu_bacteria 2977537788 2977540434 240
211 3300003354 JGI25160J50197_1033559 JGI25160J50197_10335591 241
212 3300025284 Ga0209130_1013968 Ga0209130_10139683 241
213 3300025302 Ga0207426_1007641 Ga0207426_10076412 241
214 3300031548 Ga0307408_100279736 Ga0307408_1002797362 241
215 3300031824 Ga0307413_10253390 Ga0307413_102533902 241
216 3300031911 Ga0307412_10475586 Ga0307412_104755862 241
217 3300032004 Ga0307414_10003246 Ga0307414_100032467 241
218 3300035111 Ga0373923_0099854 Ga0373923_0099854_295_1080 241
219 3300041496 Ga0451839_1477032 Ga0451839_1477032_32_832 241
220 3300046524 Ga0495648_0003826 Ga0495648_0003826_471_1271 241
221 3300046691 Ga0495670_0000469 Ga0495670_0000469_13083_13883 241
222 3300048925 Ga0496122_0000868 Ga0496122_0000868_26533_27333 241
223 3300048926 Ga0496123_0000682 Ga0496123_0000682_26613_27413 241
224 3300049459 Ga0495678_000609 Ga0495678_000609_9273_10073 241
225 3300049571 Ga0501034_0605637 Ga0501034_0605637_187_948 241
226 3300053111 Ga0500572_006311 Ga0500572_006311_1357_2157 241
227 3300053131 Ga0500652_043976 Ga0500652_043976_194_994 241
228 iso_pu_bacteria 2718217927 2719384522 241
229 iso_pu_bacteria 2721755809 2724037044 241
230 iso_pu_bacteria 2841851746 2841856687 241
231 iso_pu_bacteria 8005275841 8005279236 241
232 iso_pu_bacteria 8005695170 8005697193 241
233 iso_pu_bacteria 8018127388 8018134413 241
234 iso_pu_bacteria 8018176218 8018181570 241
235 iso_pu_bacteria 8024486573 8024492026 241
236 3300035725 Ga0373947_0259675 Ga0373947_0259675_224_1012 242
237 iso_pu_bacteria 2690316117 2692317813 242
238 iso_pu_bacteria 2847417321 2847423687 242
239 iso_pu_bacteria 2848992105 2848998773 242
240 iso_pu_bacteria 2855872281 2855873016 242
241 3300013307 Ga0157372_10689886 Ga0157372_106898861 243
242 3300021320 Ga0214544_1000029 Ga0214544_100002957 243
243 3300021321 Ga0214542_1000092 Ga0214542_100009225 243
244 3300021327 Ga0214543_1000045 Ga0214543_100004557 243
245 3300061734 Ga0530510_0077614 Ga0530510_0077614_106_837 243
246 iso_pu_bacteria 2802429605 2805931194 243
247 3300003771 Ga0055526_1008581 Ga0055526_10085813 244
248 3300005354 Ga0070675_100454588 Ga0070675_1004545882 244
249 3300021321 Ga0214542_1017593 Ga0214542_10175933 244
250 3300028794 Ga0307515_10076791 Ga0307515_100767912 244
251 3300046492 Ga0495585_0017018 Ga0495585_0017018_1589_2374 244
252 3300046558 Ga0495633_0092660 Ga0495633_0092660_13_798 244
253 3300046615 Ga0495656_0106893 Ga0495656_0106893_190_975 244
254 3300046674 Ga0495588_0147621 Ga0495588_0147621_42_827 244
255 3300049571 Ga0501034_0029741 Ga0501034_0029741_491_1249 244
256 3300053121 Ga0500607_037085 Ga0500607_037085_222_1037 244
257 iso_pu_bacteria 2657244999 2657685710 244
258 iso_pu_bacteria 2802429268 2804755631 244
259 3300044666 Ga0466977_0000410 Ga0466977_0000410_10462_11250 245
260 3300046492 Ga0495585_0043055 Ga0495585_0043055_360_1151 245
261 3300048909 Ga0496106_0104592 Ga0496106_0104592_1221_1991 245
262 iso_pu_bacteria 2721755686 2723575961 245
263 iso_pu_bacteria 2871488783 2871495349 245
264 iso_pu_bacteria 2878753008 2878757985 245
265 iso_pu_bacteria 2881845957 2881850926 245
266 iso_pu_bacteria 2882912400 2882917711 245
267 iso_pu_bacteria 2903492973 2903502117 245
268 iso_pu_bacteria 2961170736 2961174558 245
269 iso_pu_bacteria 2967996073 2968000550 245
270 iso_pu_bacteria 2968003550 2968010078 245
271 iso_pu_bacteria 2968091066 2968091770 245
272 iso_pu_bacteria 2970503327 2970507145 245
273 iso_pu_bacteria 2977821940 2977828941 245
274 iso_pu_bacteria 2979808191 2979812340 245
275 iso_pu_bacteria 8004374579 8004379497 245
276 3300009093 Ga0105240_10076567 Ga0105240_100765671 246
277 3300009545 Ga0105237_10140283 Ga0105237_101402832 246
278 3300048908 Ga0496105_0110687 Ga0496105_0110687_1007_1789 246
279 3300048913 Ga0496110_0334867 Ga0496110_0334867_111_893 246
280 3300048929 Ga0496126_0000152 Ga0496126_0000152_45107_45946 246
281 iso_pu_bacteria 8003570095 8003575498 246
282 3300005327 Ga0070658_10359622 Ga0070658_103596222 247
283 3300005937 Ga0081455_10019067 Ga0081455_100190675 247
284 3300009174 Ga0105241_10201325 Ga0105241_102013251 249
285 3300037418 Ga0395900_0193439 Ga0395900_0193439_1071_1829 249
286 3300050492 nmdc:mga0yw44_208945_c1 nmdc:mga0yw44_208945_c1_315_1064 249
287 iso_pu_bacteria 2842395702 2842401198 249
288 iso_pu_bacteria 2791355196 2793060883 250
289 3300025916 Ga0207663_10134936 Ga0207663_101349362 251
290 3300049592 Ga0501076_0569356 Ga0501076_0569356_101_859 251
291 3300049571 Ga0501034_0407727 Ga0501034_0407727_144_908 252
292 3300049573 Ga0501037_0045531 Ga0501037_0045531_830_1588 252
293 3300004625 Ga0055543_1002326 Ga0055543_10023262 254
294 3300031247 Ga0265340_10007989 Ga0265340_100079893 254
295 iso_pu_bacteria 8016575299 8016576607 254
296 3300005548 Ga0070665_100497362 Ga0070665_1004973621 255
297 3300006175 Ga0070712_100172448 Ga0070712_1001724483 255
298 3300021384 Ga0213876_10003173 Ga0213876_100031734 255
299 3300030521 Ga0307511_10066458 Ga0307511_100664583 255
300 3300041413 Ga0439465_0039980 Ga0439465_0039980_165_935 255
301 3300046678 Ga0495599_0222033 Ga0495599_0222033_45_827 255
302 3300041459 Ga0451800_0334509 Ga0451800_0334509_10_789 256
303 3300048924 Ga0496121_0412076 Ga0496121_0412076_28_798 256
304 3300005518 Ga0070699_100374373 Ga0070699_1003743732 257
305 3300025297 Ga0209758_1011783 Ga0209758_10117836 257
306 3300048929 Ga0496126_0322969 Ga0496126_0322969_112_984 257
307 3300002773 JGI25152J39213_1002097 JGI25152J39213_10020974 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01936

NYN

NYN domain

11

149

0.96

PF12872

OST-HTH

OST-HTH/LOTUS domain

196

270

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dim-assembly1.cif.gz_A crystal structure of phosphoribosylglycinamide synthetase from anaerococcus prevotii 0.8693 96 142
5yaa-assembly4.cif.gz_D crystal structure of marf1 nyn domain from mus musculus 0.8218 7 148
6fdl-assembly2.cif.gz_B crystal structure of the nyn domain of human marf1 0.8064 7 149
7n70-assembly1.cif.gz_A cryo-em structure of atp13a2 in the bef-bound e2p-like state 0.8035 108 142
1kjq-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp 0.797 93 142
ID Description Score Start End Superfamily
af_Q9FJ91_216_314_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9047 53 145 3.40.50.1010
af_Q57905_62_208_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8586 7 143 3.40.50.1010
3v4sB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8521 96 141 3.40.50.20
af_A0A096P6L2_1483_1558_3.30.420.610 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;LOTUS domain-like 0.8434 166 240 3.30.420.610
af_Q55DB7_4_147_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8418 8 144 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A7X0KP36-F1-model_v4 NYN domain-containing protein 0.9658 1 140 GO:0004540
AF-A0A3C0F240-F1-model_v4 deleted 0.9652 7 146
AF-F0XZS7-F1-model_v4 NYN domain-containing protein 0.9634 10 142 GO:0004540
AF-A0A434DGT3-F1-model_v4 NYN domain-containing protein 0.9625 1 141 GO:0004540
AF-A0A3D1PRW5-F1-model_v4 Maebl 0.962 6 144 GO:0004540

Feature Viewer

pLDDT pTM Quality
75.22 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map