F399405

General Info

Members Datasets Scaffolds Average Seq Length
307 178 614 269

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0197546|Ga0501035_0197546_754_1659
Length 301
Sequence MTQVRGKVAVVTGAGSGIGRALACELGRRGAVLAISDVDEAGLAETAKQLRVIGAKVSVARLDVTDRAAVLRYADDVVAEFGTVNIVINNAGIAFTGDVEQMSFEQIERVVDVDFWGVVNGTKAFLPHLIASGDGHVVNVSSLFGLMAVPGQSAYNAAKFAVRGFTEALRQEMLVNRHPVRVTCVHPGGIKTAIARNAGAVEGHDAAQLAEFFDRKLARTSAESAARTIVRAIIGNRPRSVVGLDAKALDLLVRVAGPAYQRLVALTVGRTVPAPRPASPQTAPAGEAAEAPPAAHDALAG

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2547132424 Nocardia nova SH22a Isolate Unclassified
160 2643221692 Nocardia sp. Root136 Isolate Unclassified
161 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
162 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
163 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
164 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
165 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
166 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
167 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
168 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
169 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
170 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
171 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
172 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
173 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
174 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
175 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
176 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
177 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
178 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.16
Metatranscriptomes 0.33
Isolates 6.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 10.75
Nodule 0
Rhizoplane 6.19
Rhizosphere 76.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0197546 3300049822 Bacteria 1727
2 JGI24737J22298_10042436 3300001990 Bacteria 1394
3 JGI24735J21928_10005864 3300002067 Bacteria 4060
4 rootH2_10154339 3300003320 Bacteria 2083
5 Ga0070658_10064321 3300005327 Bacteria 2992
6 Ga0070683_100001398 3300005329 Bacteria 18519
7 Ga0068869_100083361 3300005334 Bacteria 2391
8 Ga0070682_100018083 3300005337 Bacteria 4115
9 Ga0070692_10013120 3300005345 Bacteria 3856
10 Ga0070714_100039936 3300005435 Bacteria 3954
11 Ga0070713_100200285 3300005436 Bacteria 1803
12 Ga0070710_10059392 3300005437 Bacteria 2172
13 Ga0070700_100094396 3300005441 Bacteria 1959
14 Ga0070663_100107201 3300005455 Bacteria 2094
15 Ga0070684_100006033 3300005535 Bacteria 9336
16 Ga0068853_100136547 3300005539 Bacteria 2199
17 Ga0070665_100568913 3300005548 Bacteria 1146
18 Ga0068855_100029647 3300005563 Bacteria 6540
19 Ga0070664_100061514 3300005564 Bacteria 3200
20 Ga0068856_100056373 3300005614 Bacteria 3877
21 Ga0068859_100000488 3300005617 Bacteria 39249
22 Ga0068866_10133377 3300005718 Bacteria 1416
23 Ga0068861_100195985 3300005719 Bacteria 1692
24 Ga0068858_100135964 3300005842 Bacteria 2306
25 Ga0075365_10000280 3300006038 Bacteria 17538
26 Ga0075365_10013163 3300006038 Bacteria 4935
27 Ga0075365_10031456 3300006038 Bacteria 3404
28 Ga0075365_10115563 3300006038 Bacteria 1847
29 Ga0075368_10044699 3300006042 Bacteria 1748
30 Ga0075363_100141499 3300006048 Bacteria 1355
31 Ga0075363_100195973 3300006048 Bacteria 1153
32 Ga0075364_10018818 3300006051 Bacteria 4330
33 Ga0075364_10098665 3300006051 Bacteria 1943
34 Ga0075367_10016279 3300006178 Bacteria 4059
35 Ga0075367_10179629 3300006178 Bacteria 1319
36 Ga0075370_10020640 3300006353 Bacteria 3604
37 Ga0075370_10253360 3300006353 Bacteria 1043
38 Ga0068865_100056955 3300006881 Bacteria 2725
39 Ga0097620_100000488 3300006931 Bacteria 39249
40 Ga0105240_10024470 3300009093 Bacteria 7956
41 Ga0105245_10033587 3300009098 Bacteria 4548
42 Ga0105245_10082175 3300009098 Bacteria 2947
43 Ga0105242_10232142 3300009176 Bacteria 1654
44 Ga0105248_10056511 3300009177 Bacteria 4403
45 Ga0105249_10116413 3300009553 Bacteria 2533
46 Ga0105249_10547719 3300009553 Bacteria 1207
47 Ga0105239_10022876 3300010375 Bacteria 6890
48 Ga0105239_10273860 3300010375 Bacteria 1899
49 Ga0105246_10003855 3300011119 Bacteria 9092
50 Ga0157371_10151752 3300013102 Bacteria 1653
51 Ga0157369_10162566 3300013105 Bacteria 2356
52 Ga0157369_10512198 3300013105 Bacteria 1241
53 Ga0163162_10041244 3300013306 Bacteria 4618
54 Ga0157372_10003630 3300013307 Bacteria 16603
55 Ga0157375_10065021 3300013308 Bacteria 3634
56 Ga0163163_10018826 3300014325 Bacteria 6475
57 Ga0157380_10318929 3300014326 Bacteria 1440
58 Ga0157379_10018721 3300014968 Bacteria 6106
59 Ga0206353_10845268 3300020082 Bacteria 1229
60 Ga0207688_10028341 3300025901 Bacteria 3081
61 Ga0207671_10188303 3300025914 Bacteria 1608
62 Ga0207652_10219494 3300025921 Bacteria 1713
63 Ga0207687_10013412 3300025927 Bacteria 5349
64 Ga0207664_10466484 3300025929 Bacteria 1128
65 Ga0207686_10128548 3300025934 Bacteria 1735
66 Ga0207661_10023083 3300025944 Bacteria 4697
67 Ga0207661_10096064 3300025944 Bacteria 2479
68 Ga0207667_10084890 3300025949 Bacteria 3278
69 Ga0207667_10128481 3300025949 Bacteria 2610
70 Ga0207712_10077882 3300025961 Bacteria 2404
71 Ga0207658_10208952 3300025986 Bacteria 1635
72 Ga0207677_10062381 3300026023 Bacteria 2585
73 Ga0207703_10020531 3300026035 Bacteria 5166
74 Ga0207639_10038204 3300026041 Bacteria 3570
75 Ga0207678_10116110 3300026067 Bacteria 2283
76 Ga0207708_10026923 3300026075 Bacteria 4354
77 Ga0207702_10191434 3300026078 Bacteria 1890
78 Ga0207674_10008596 3300026116 Bacteria 11768
79 Ga0207675_100042872 3300026118 Bacteria 4225
80 Ga0207683_10162224 3300026121 Bacteria 2021
81 Ga0207698_10062974 3300026142 Bacteria 2900
82 Ga0209813_10030654 3300027866 Bacteria 1582
83 Ga0268266_10079470 3300028379 Bacteria 2856
84 Ga0307509_10001475 3300031507 Bacteria 39724
85 Ga0307405_10242164 3300031731 Bacteria 1337
86 Ga0307406_10337641 3300031901 Bacteria 1172
87 Ga0307412_10390873 3300031911 Bacteria 1129
88 Ga0307409_100128204 3300031995 Bacteria 2163
89 Ga0307409_100213047 3300031995 Bacteria 1738
90 Ga0307409_100764173 3300031995 Bacteria 971
91 Ga0307416_100000221 3300032002 Bacteria 30062
92 Ga0307416_100513030 3300032002 Bacteria 1265
93 Ga0307414_10375850 3300032004 Bacteria 1227
94 Ga0307415_100000455 3300032126 Bacteria 17595
95 Ga0307415_100084745 3300032126 Bacteria 2275
96 Ga0307415_100540504 3300032126 Bacteria 1026
97 Ga0395900_0018675 3300037418 Bacteria 7071
98 Ga0395900_0020026 3300037418 Bacteria 6822
99 Ga0395905_0679981 3300037471 Bacteria 931
100 Ga0395901_0062691 3300038443 Bacteria 3869
101 Ga0436363_0697119 3300039450 Bacteria 1506
102 Ga0451837_0162414 3300041494 Bacteria 900
103 Ga0439446_0009317 3300042156 Bacteria 2626
104 Ga0439434_0008741 3300042435 Bacteria 2975
105 Ga0466969_0065194 3300044656 Bacteria 1761
106 Ga0466972_0102376 3300044658 Bacteria 1355
107 Ga0466965_0014833 3300044683 Bacteria 3692
108 Ga0466965_0025720 3300044683 Bacteria 2851
109 Ga0466965_0031171 3300044683 Bacteria 2600
110 Ga0466965_0100434 3300044683 Bacteria 1479
111 Ga0466965_0136021 3300044683 Bacteria 1277
112 Ga0466965_0174629 3300044683 Bacteria 1132
113 Ga0466966_0017737 3300044684 Bacteria 4700
114 Ga0466966_0050404 3300044684 Bacteria 2648
115 Ga0466966_0156229 3300044684 Bacteria 1389
116 Ga0466966_0162669 3300044684 Bacteria 1359
117 Ga0466961_0009211 3300044693 Bacteria 6287
118 Ga0466961_0011252 3300044693 Bacteria 5721
119 Ga0466961_0053816 3300044693 Bacteria 2567
120 Ga0466963_0005830 3300044694 Bacteria 7249
121 Ga0466963_0016483 3300044694 Bacteria 4595
122 Ga0466964_0001550 3300044706 Bacteria 7902
123 Ga0466964_0032475 3300044706 Bacteria 2075
124 Ga0466964_0034276 3300044706 Bacteria 2025
125 Ga0466971_0009199 3300044719 Bacteria 4319
126 Ga0466971_0015888 3300044719 Bacteria 3316
127 Ga0466971_0214802 3300044719 Bacteria 910
128 Ga0466968_0009363 3300044735 Bacteria 3765
129 Ga0466970_0018650 3300044765 Bacteria 3594
130 Ga0466970_0059252 3300044765 Bacteria 2050
131 Ga0466970_0067017 3300044765 Bacteria 1927
132 Ga0466970_0069917 3300044765 Bacteria 1887
133 Ga0466970_0089445 3300044765 Bacteria 1670
134 Ga0466970_0125306 3300044765 Bacteria 1408
135 Ga0466957_0008155 3300044842 Bacteria 5947
136 Ga0466957_0154901 3300044842 Bacteria 1484
137 Ga0466957_0217811 3300044842 Bacteria 1259
138 Ga0466957_0341981 3300044842 Bacteria 1013
139 Ga0466957_0376336 3300044842 Bacteria 967
140 Ga0466960_0006153 3300044901 Bacteria 4802
141 Ga0466960_0010946 3300044901 Bacteria 3777
142 Ga0466960_0031290 3300044901 Bacteria 2454
143 Ga0466960_0068673 3300044901 Bacteria 1759
144 Ga0466960_0122097 3300044901 Bacteria 1365
145 Ga0466960_0181517 3300044901 Bacteria 1141
146 Ga0466960_0272492 3300044901 Bacteria 946
147 Ga0466959_0022434 3300045049 Bacteria 4667
148 Ga0466959_0078147 3300045049 Bacteria 2387
149 Ga0466959_0109217 3300045049 Bacteria 1975
150 Ga0466959_0109596 3300045049 Bacteria 1971
151 Ga0466959_0149756 3300045049 Bacteria 1645
152 Ga0466958_0012934 3300045836 Bacteria 4740
153 Ga0466958_0109450 3300045836 Bacteria 1724
154 Ga0466958_0115283 3300045836 Bacteria 1679
155 Ga0466958_0161226 3300045836 Bacteria 1417
156 Ga0466958_0164950 3300045836 Bacteria 1401
157 Ga0466958_0182077 3300045836 Bacteria 1333
158 Ga0466967_0000506 3300045976 Bacteria 19040
159 Ga0466967_0018869 3300045976 Bacteria 5529
160 Ga0466967_0021838 3300045976 Bacteria 5208
161 Ga0466967_0027735 3300045976 Bacteria 4714
162 Ga0466967_0034046 3300045976 Bacteria 4319
163 Ga0466967_0060243 3300045976 Bacteria 3363
164 Ga0466967_0074594 3300045976 Bacteria 3047
165 Ga0466967_0487176 3300045976 Bacteria 1209
166 Ga0495608_0088195 3300046511 Bacteria 2008
167 Ga0495620_0088419 3300046515 Bacteria 1245
168 Ga0495667_0173441 3300046559 Bacteria 1385
169 Ga0495635_0166378 3300046663 Bacteria 1500
170 Ga0495658_0157688 3300046683 Bacteria 1398
171 Ga0495649_0045624 3300046694 Bacteria 2389
172 Ga0495649_0190082 3300046694 Bacteria 1069
173 Ga0495683_0000380 3300047323 Bacteria 36306
174 Ga0496100_0179901 3300048903 Bacteria 1529
175 Ga0496100_0354240 3300048903 Bacteria 1109
176 Ga0496101_0058225 3300048904 Bacteria 2797
177 Ga0496102_0000013 3300048905 Bacteria 311668
178 Ga0496102_0010176 3300048905 Bacteria 8087
179 Ga0496102_0399122 3300048905 Bacteria 1293
180 Ga0496103_0001975 3300048906 Bacteria 13260
181 Ga0496103_0134240 3300048906 Bacteria 1581
182 Ga0496105_0191489 3300048908 Bacteria 1672
183 Ga0496106_0258411 3300048909 Bacteria 1393
184 Ga0496108_0018958 3300048911 Bacteria 5642
185 Ga0496108_0044361 3300048911 Bacteria 3712
186 Ga0496108_0195076 3300048911 Bacteria 1756
187 Ga0496109_0040720 3300048912 Bacteria 4208
188 Ga0496109_0087791 3300048912 Bacteria 2873
189 Ga0496109_0091039 3300048912 Bacteria 2821
190 Ga0496109_0134473 3300048912 Bacteria 2309
191 Ga0496110_0003134 3300048913 Bacteria 12559
192 Ga0496111_0025888 3300048914 Bacteria 4139
193 Ga0496118_0015526 3300048921 Bacteria 7045
194 Ga0496119_0086872 3300048922 Bacteria 1786
195 Ga0496121_0019256 3300048924 Bacteria 6835
196 Ga0501031_0063219 3300049568 Bacteria 2411
197 Ga0501031_0086357 3300049568 Bacteria 2046
198 Ga0501031_0273529 3300049568 Bacteria 1096
199 Ga0501032_0000730 3300049569 Bacteria 26674
200 Ga0501032_0002003 3300049569 Bacteria 16055
201 Ga0501032_0008675 3300049569 Bacteria 7405
202 Ga0501032_0024788 3300049569 Bacteria 4138
203 Ga0501032_0224601 3300049569 Bacteria 1222
204 Ga0501033_0070819 3300049570 Bacteria 2561
205 Ga0501033_0083552 3300049570 Bacteria 2340
206 Ga0501034_0001381 3300049571 Bacteria 32655
207 Ga0501034_0017482 3300049571 Bacteria 7355
208 Ga0501034_0049722 3300049571 Bacteria 4230
209 Ga0501034_0066768 3300049571 Bacteria 3610
210 Ga0501034_0648284 3300049571 Bacteria 958
211 Ga0501036_0004800 3300049572 Bacteria 10927
212 Ga0501036_0018208 3300049572 Bacteria 5882
213 Ga0501036_0239245 3300049572 Bacteria 1523
214 Ga0501036_0278396 3300049572 Bacteria 1400
215 Ga0501036_0443844 3300049572 Bacteria 1081
216 Ga0501037_0005611 3300049573 Bacteria 9146
217 Ga0501037_0021584 3300049573 Bacteria 4760
218 Ga0501037_0030685 3300049573 Bacteria 3971
219 Ga0501037_0263148 3300049573 Bacteria 1205
220 Ga0501038_0012082 3300049574 Bacteria 7884
221 Ga0501038_0040429 3300049574 Bacteria 4072
222 Ga0501038_0105444 3300049574 Bacteria 2341
223 Ga0501039_0002246 3300049575 Bacteria 14315
224 Ga0501039_0002348 3300049575 Bacteria 14082
225 Ga0501039_0086727 3300049575 Bacteria 2438
226 Ga0501040_0202737 3300049576 Bacteria 1409
227 Ga0501041_0427677 3300049577 Bacteria 840
228 Ga0501042_0021916 3300049578 Bacteria 4459
229 Ga0501042_0172656 3300049578 Bacteria 1560
230 Ga0501042_0348197 3300049578 Bacteria 1072
231 Ga0501043_0000567 3300049579 Bacteria 33043
232 Ga0501043_0004060 3300049579 Bacteria 11969
233 Ga0501043_0023723 3300049579 Bacteria 4812
234 Ga0501043_0064042 3300049579 Bacteria 2887
235 Ga0501043_0155329 3300049579 Bacteria 1789
236 Ga0501046_0001824 3300049580 Bacteria 20298
237 Ga0501046_0003442 3300049580 Bacteria 14522
238 Ga0501046_0007883 3300049580 Bacteria 9331
239 Ga0501047_0009852 3300049581 Bacteria 9029
240 Ga0501047_0066931 3300049581 Bacteria 3462
241 Ga0501047_0194882 3300049581 Bacteria 1888
242 Ga0501048_0010132 3300049582 Bacteria 7050
243 Ga0501048_0039516 3300049582 Bacteria 3384
244 Ga0501067_0131788 3300049583 Bacteria 1391
245 Ga0501069_0099688 3300049585 Bacteria 1649
246 Ga0501070_0001386 3300049586 Bacteria 21708
247 Ga0501070_0003993 3300049586 Bacteria 12684
248 Ga0501070_0006038 3300049586 Bacteria 10314
249 Ga0501070_0011358 3300049586 Bacteria 7526
250 Ga0501072_0567407 3300049588 Bacteria 896
251 Ga0501073_0004745 3300049589 Bacteria 10201
252 Ga0501073_0115220 3300049589 Bacteria 1863
253 Ga0501076_0094915 3300049592 Bacteria 2402
254 Ga0501080_0015317 3300049742 Bacteria 7067
255 Ga0501081_0244182 3300049743 Bacteria 1310
256 Ga0501035_0000407 3300049822 Bacteria 48754
257 Ga0501035_0014653 3300049822 Bacteria 7237
258 Ga0501035_0017899 3300049822 Bacteria 6536
259 Ga0501044_0000771 3300049823 Bacteria 38852
260 Ga0501044_0022191 3300049823 Bacteria 6766
261 Ga0501044_0053950 3300049823 Bacteria 4133
262 Ga0501044_0284829 3300049823 Bacteria 1585
263 Ga0501045_0039101 3300049824 Bacteria 3452
264 nmdc:mga03n38_12470_c1 3300050490 Bacteria 3200
265 nmdc:mga03n38_173277_c1 3300050490 Bacteria 1100
266 nmdc:mga00v17_17533_c1 3300050491 Bacteria 4056
267 nmdc:mga00v17_3399_c1 3300050491 Bacteria 8220
268 nmdc:mga0yw44_262697_c1 3300050492 Bacteria 1151
269 nmdc:mga0yw44_272137_c1 3300050492 Bacteria 1131
270 nmdc:mga0yw44_439610_c1 3300050492 Bacteria 884
271 nmdc:mga0yw44_5370_c1 3300050492 Bacteria 6037
272 nmdc:mga06z11_28261_c1 3300050494 Bacteria 2690
273 nmdc:mga06z11_58253_c1 3300050494 Bacteria 2003
274 nmdc:mga04h51_47270_c1 3300050495 Bacteria 1430
275 nmdc:mga04h51_49341_c1 3300050495 Bacteria 1406
276 nmdc:mga07m45_227808_c1 3300050496 Bacteria 1084
277 nmdc:mga07m45_42922_c1 3300050496 Bacteria 2536
278 Ga0500635_0001214 3300053080 Bacteria 6165
279 Ga0500641_0030241 3300053096 Bacteria 2127
280 Ga0500593_000518 3300053117 Bacteria 15122
281 Ga0500652_002845 3300053131 Bacteria 5217
282 Ga0500573_0001847 3300053140 Bacteria 10311
283 Ga0501082_0147775 3300060353 Bacteria 2041
284 Ga0466962_0050546 3300061719 Bacteria 1987
285 Ga0466962_0083979 3300061719 Bacteria 1523
286 Ga0466962_0084023 3300061719 Bacteria 1523
287 Ga0466962_0102003 3300061719 Bacteria 1378
288 2548698656 2547132424 Bacteria 8348532
289 2644513638 2643221692 Bacteria 7282860
290 2739366107 2738543034 Bacteria 6084756
291 2774394618 2773857762 Bacteria 5971770
292 2809194537 2808606439 Bacteria 5952208
293 2812331412 2811994874 Bacteria 5367947
294 2812349280 2811994878 Bacteria 5992952
295 2857484468 2857481737 Bacteria 4761446
296 2862996195 2862993130 Bacteria 3860849
297 2891973014 2891968417 Bacteria 5821697
298 2904767268 2904765812 Bacteria 5369154
299 2904775848 2904770941 Bacteria 5580202
300 2908812648 2908811453 Bacteria 5478616
301 2919424867 2919420072 Bacteria 5390363
302 2919437433 2919432681 Bacteria 5390474
303 2919719330 2919713450 Bacteria 7431245
304 2929217047 2929212328 Bacteria 7708288
305 2974318182 2974315732 Bacteria 4602776
306 2984526394 2984523437 Bacteria 4508481
307 3001119654 3001119090 Bacteria 3449530
308 Ga0501035_0197546
309 JGI24737J22298_10042436
310 JGI24735J21928_10005864
311 rootH2_10154339
312 Ga0070658_10064321
313 Ga0070683_100001398
314 Ga0068869_100083361
315 Ga0070682_100018083
316 Ga0070692_10013120
317 Ga0070714_100039936
318 Ga0070713_100200285
319 Ga0070710_10059392
320 Ga0070700_100094396
321 Ga0070663_100107201
322 Ga0070684_100006033
323 Ga0068853_100136547
324 Ga0070665_100568913
325 Ga0068855_100029647
326 Ga0070664_100061514
327 Ga0068856_100056373
328 Ga0068859_100000488
329 Ga0068866_10133377
330 Ga0068861_100195985
331 Ga0068858_100135964
332 Ga0075365_10000280
333 Ga0075365_10013163
334 Ga0075365_10031456
335 Ga0075365_10115563
336 Ga0075368_10044699
337 Ga0075363_100141499
338 Ga0075363_100195973
339 Ga0075364_10018818
340 Ga0075364_10098665
341 Ga0075367_10016279
342 Ga0075367_10179629
343 Ga0075370_10020640
344 Ga0075370_10253360
345 Ga0068865_100056955
346 Ga0097620_100000488
347 Ga0105240_10024470
348 Ga0105245_10033587
349 Ga0105245_10082175
350 Ga0105242_10232142
351 Ga0105248_10056511
352 Ga0105249_10116413
353 Ga0105249_10547719
354 Ga0105239_10022876
355 Ga0105239_10273860
356 Ga0105246_10003855
357 Ga0157371_10151752
358 Ga0157369_10162566
359 Ga0157369_10512198
360 Ga0163162_10041244
361 Ga0157372_10003630
362 Ga0157375_10065021
363 Ga0163163_10018826
364 Ga0157380_10318929
365 Ga0157379_10018721
366 Ga0206353_10845268
367 Ga0207688_10028341
368 Ga0207671_10188303
369 Ga0207652_10219494
370 Ga0207687_10013412
371 Ga0207664_10466484
372 Ga0207686_10128548
373 Ga0207661_10023083
374 Ga0207661_10096064
375 Ga0207667_10084890
376 Ga0207667_10128481
377 Ga0207712_10077882
378 Ga0207658_10208952
379 Ga0207677_10062381
380 Ga0207703_10020531
381 Ga0207639_10038204
382 Ga0207678_10116110
383 Ga0207708_10026923
384 Ga0207702_10191434
385 Ga0207674_10008596
386 Ga0207675_100042872
387 Ga0207683_10162224
388 Ga0207698_10062974
389 Ga0209813_10030654
390 Ga0268266_10079470
391 Ga0307509_10001475
392 Ga0307405_10242164
393 Ga0307406_10337641
394 Ga0307412_10390873
395 Ga0307409_100128204
396 Ga0307409_100213047
397 Ga0307409_100764173
398 Ga0307416_100000221
399 Ga0307416_100513030
400 Ga0307414_10375850
401 Ga0307415_100000455
402 Ga0307415_100084745
403 Ga0307415_100540504
404 Ga0395900_0018675
405 Ga0395900_0020026
406 Ga0395905_0679981
407 Ga0395901_0062691
408 Ga0436363_0697119
409 Ga0451837_0162414
410 Ga0439446_0009317
411 Ga0439434_0008741
412 Ga0466969_0065194
413 Ga0466972_0102376
414 Ga0466965_0014833
415 Ga0466965_0025720
416 Ga0466965_0031171
417 Ga0466965_0100434
418 Ga0466965_0136021
419 Ga0466965_0174629
420 Ga0466966_0017737
421 Ga0466966_0050404
422 Ga0466966_0156229
423 Ga0466966_0162669
424 Ga0466961_0009211
425 Ga0466961_0011252
426 Ga0466961_0053816
427 Ga0466963_0005830
428 Ga0466963_0016483
429 Ga0466964_0001550
430 Ga0466964_0032475
431 Ga0466964_0034276
432 Ga0466971_0009199
433 Ga0466971_0015888
434 Ga0466971_0214802
435 Ga0466968_0009363
436 Ga0466970_0018650
437 Ga0466970_0059252
438 Ga0466970_0067017
439 Ga0466970_0069917
440 Ga0466970_0089445
441 Ga0466970_0125306
442 Ga0466957_0008155
443 Ga0466957_0154901
444 Ga0466957_0217811
445 Ga0466957_0341981
446 Ga0466957_0376336
447 Ga0466960_0006153
448 Ga0466960_0010946
449 Ga0466960_0031290
450 Ga0466960_0068673
451 Ga0466960_0122097
452 Ga0466960_0181517
453 Ga0466960_0272492
454 Ga0466959_0022434
455 Ga0466959_0078147
456 Ga0466959_0109217
457 Ga0466959_0109596
458 Ga0466959_0149756
459 Ga0466958_0012934
460 Ga0466958_0109450
461 Ga0466958_0115283
462 Ga0466958_0161226
463 Ga0466958_0164950
464 Ga0466958_0182077
465 Ga0466967_0000506
466 Ga0466967_0018869
467 Ga0466967_0021838
468 Ga0466967_0027735
469 Ga0466967_0034046
470 Ga0466967_0060243
471 Ga0466967_0074594
472 Ga0466967_0487176
473 Ga0495608_0088195
474 Ga0495620_0088419
475 Ga0495667_0173441
476 Ga0495635_0166378
477 Ga0495658_0157688
478 Ga0495649_0045624
479 Ga0495649_0190082
480 Ga0495683_0000380
481 Ga0496100_0179901
482 Ga0496100_0354240
483 Ga0496101_0058225
484 Ga0496102_0000013
485 Ga0496102_0010176
486 Ga0496102_0399122
487 Ga0496103_0001975
488 Ga0496103_0134240
489 Ga0496105_0191489
490 Ga0496106_0258411
491 Ga0496108_0018958
492 Ga0496108_0044361
493 Ga0496108_0195076
494 Ga0496109_0040720
495 Ga0496109_0087791
496 Ga0496109_0091039
497 Ga0496109_0134473
498 Ga0496110_0003134
499 Ga0496111_0025888
500 Ga0496118_0015526
501 Ga0496119_0086872
502 Ga0496121_0019256
503 Ga0501031_0063219
504 Ga0501031_0086357
505 Ga0501031_0273529
506 Ga0501032_0000730
507 Ga0501032_0002003
508 Ga0501032_0008675
509 Ga0501032_0024788
510 Ga0501032_0224601
511 Ga0501033_0070819
512 Ga0501033_0083552
513 Ga0501034_0001381
514 Ga0501034_0017482
515 Ga0501034_0049722
516 Ga0501034_0066768
517 Ga0501034_0648284
518 Ga0501036_0004800
519 Ga0501036_0018208
520 Ga0501036_0239245
521 Ga0501036_0278396
522 Ga0501036_0443844
523 Ga0501037_0005611
524 Ga0501037_0021584
525 Ga0501037_0030685
526 Ga0501037_0263148
527 Ga0501038_0012082
528 Ga0501038_0040429
529 Ga0501038_0105444
530 Ga0501039_0002246
531 Ga0501039_0002348
532 Ga0501039_0086727
533 Ga0501040_0202737
534 Ga0501041_0427677
535 Ga0501042_0021916
536 Ga0501042_0172656
537 Ga0501042_0348197
538 Ga0501043_0000567
539 Ga0501043_0004060
540 Ga0501043_0023723
541 Ga0501043_0064042
542 Ga0501043_0155329
543 Ga0501046_0001824
544 Ga0501046_0003442
545 Ga0501046_0007883
546 Ga0501047_0009852
547 Ga0501047_0066931
548 Ga0501047_0194882
549 Ga0501048_0010132
550 Ga0501048_0039516
551 Ga0501067_0131788
552 Ga0501069_0099688
553 Ga0501070_0001386
554 Ga0501070_0003993
555 Ga0501070_0006038
556 Ga0501070_0011358
557 Ga0501072_0567407
558 Ga0501073_0004745
559 Ga0501073_0115220
560 Ga0501076_0094915
561 Ga0501080_0015317
562 Ga0501081_0244182
563 Ga0501035_0000407
564 Ga0501035_0014653
565 Ga0501035_0017899
566 Ga0501044_0000771
567 Ga0501044_0022191
568 Ga0501044_0053950
569 Ga0501044_0284829
570 Ga0501045_0039101
571 nmdc:mga03n38_12470_c1
572 nmdc:mga03n38_173277_c1
573 nmdc:mga00v17_17533_c1
574 nmdc:mga00v17_3399_c1
575 nmdc:mga0yw44_262697_c1
576 nmdc:mga0yw44_272137_c1
577 nmdc:mga0yw44_439610_c1
578 nmdc:mga0yw44_5370_c1
579 nmdc:mga06z11_28261_c1
580 nmdc:mga06z11_58253_c1
581 nmdc:mga04h51_47270_c1
582 nmdc:mga04h51_49341_c1
583 nmdc:mga07m45_227808_c1
584 nmdc:mga07m45_42922_c1
585 Ga0500635_0001214
586 Ga0500641_0030241
587 Ga0500593_000518
588 Ga0500652_002845
589 Ga0500573_0001847
590 Ga0501082_0147775
591 Ga0466962_0050546
592 Ga0466962_0083979
593 Ga0466962_0084023
594 Ga0466962_0102003
595 2548698656
596 2644513638
597 2739366107
598 2774394618
599 2809194537
600 2812331412
601 2812349280
602 2857484468
603 2862996195
604 2891973014
605 2904767268
606 2904775848
607 2908812648
608 2919424867
609 2919437433
610 2919719330
611 2929217047
612 2974318182
613 2984526394
614 3001119654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

203

0.97

PF08659

KR

KR domain

8

182

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

230

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vsp-assembly1.cif.gz_B structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a 0.9678 3 185
6xex-assembly1.cif.gz_B structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a/v139q 0.9673 3 185
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.9656 3 185
2q2v-assembly1.cif.gz_B structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida 0.9648 4 185
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9648 3 185
ID Description Score Start End Superfamily
af_Q8N3Y7_32_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9712 2 185 3.40.50.720
af_P9WGP9_1_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9671 1 223 3.40.50.720
af_Q9VCR9_81_353_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 2 185 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.965 89 185 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 3 185 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7J5WRX2-F1-model_v4 Putative oxidoreductase SadH (EC 1.-.-.-) 0.9785 5 188 GO:0016020
GO:0016491
AF-X8C438-F1-model_v4 deleted 0.9775 1 188
AF-A0A838XGU7-F1-model_v4 SDR family oxidoreductase 0.9764 7 185 GO:0016491
AF-A0A421K8Y1-F1-model_v4 3-oxoacyl-ACP reductase 0.9761 7 185 GO:0016491
AF-A0A3B0ACB9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.973 7 185 GO:0016020
GO:0016491

Map