F399339

General Info

Members Datasets Scaffolds Average Seq Length
307 193 614 130

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0207215|Ga0495606_0207215_37_519
Length 160
Sequence MLATLGRSVFTALTTIPLGPKMASPTGDIKEMIHGACHCGAVQWQFKGHPDGATACNCTVCRRYGVLWAYDYDDEGIKVSGQTQIYARGNAIEFHFCPTCGCVAFWRAQQKNQEGRRRIAVNLRLAEPDAVAQIPIDHFDGLTTFDDLPRDGRCVADYWF

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
192 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 3.58
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 10.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0207215 3300046507 Bacteria 1113
2 JGI24741J21665_1001048 3300001915 Bacteria 8290
3 JGI24750J21931_1043461 3300002070 Unclassified 687
4 rootL2_10292133 3300003322 Bacteria 2688
5 rootH1_10002416 3300003323 Unclassified 3888
6 Ga0070658_10155834 3300005327 Bacteria 1915
7 Ga0070658_10228647 3300005327 Bacteria 1575
8 Ga0070676_10246491 3300005328 Bacteria 1190
9 Ga0070683_100039423 3300005329 Bacteria 4337
10 Ga0070683_100061722 3300005329 Bacteria 3485
11 Ga0070683_100163790 3300005329 Bacteria 2110
12 Ga0070683_100858571 3300005329 Bacteria 870
13 Ga0070670_100115586 3300005331 Bacteria 2313
14 Ga0070677_10001833 3300005333 Bacteria 6717
15 Ga0068869_100334970 3300005334 Bacteria 1230
16 Ga0070680_100010782 3300005336 Bacteria 7055
17 Ga0070680_100028116 3300005336 Bacteria 4509
18 Ga0070680_100034537 3300005336 Bacteria 4077
19 Ga0070680_100081830 3300005336 Bacteria 2664
20 Ga0070682_100438747 3300005337 Bacteria 997
21 Ga0068868_100111088 3300005338 Bacteria 2227
22 Ga0070660_100008304 3300005339 Bacteria 7258
23 Ga0070660_100066030 3300005339 Bacteria 2816
24 Ga0070660_100452110 3300005339 Bacteria 1066
25 Ga0070660_101371448 3300005339 Bacteria 600
26 Ga0070691_10000023 3300005341 Bacteria 43309
27 Ga0070687_100471799 3300005343 Bacteria 839
28 Ga0070661_100000496 3300005344 Bacteria 30227
29 Ga0070692_10411646 3300005345 Bacteria 856
30 Ga0070668_100028465 3300005347 Bacteria 4242
31 Ga0070668_100666308 3300005347 Unclassified 915
32 Ga0070668_101363921 3300005347 Bacteria 646
33 Ga0070669_100059410 3300005353 Bacteria 2807
34 Ga0070669_100137374 3300005353 Bacteria 1881
35 Ga0070675_100080912 3300005354 Bacteria 2708
36 Ga0070671_100003605 3300005355 Bacteria 12112
37 Ga0070671_100021008 3300005355 Bacteria 5327
38 Ga0070674_100009516 3300005356 Bacteria 5820
39 Ga0070673_100007985 3300005364 Bacteria 7010
40 Ga0070659_100041668 3300005366 Bacteria 3590
41 Ga0070659_100079454 3300005366 Bacteria 2618
42 Ga0070659_100209117 3300005366 Bacteria 1608
43 Ga0070667_100089167 3300005367 Bacteria 2649
44 Ga0070709_10471341 3300005434 Bacteria 949
45 Ga0070714_100072497 3300005435 Bacteria 2981
46 Ga0070713_100315272 3300005436 Bacteria 1443
47 Ga0070705_101742575 3300005440 Bacteria 527
48 Ga0070700_100271584 3300005441 Bacteria 1225
49 Ga0070700_100912943 3300005441 Bacteria 716
50 Ga0070663_100088778 3300005455 Bacteria 2286
51 Ga0070663_100498211 3300005455 Bacteria 1011
52 Ga0070678_100033258 3300005456 Bacteria 3578
53 Ga0070678_100246570 3300005456 Bacteria 1496
54 Ga0070662_100002339 3300005457 Bacteria 11654
55 Ga0070681_10019385 3300005458 Bacteria 6807
56 Ga0070681_10397032 3300005458 Bacteria 1290
57 Ga0070681_11097710 3300005458 Bacteria 716
58 Ga0068867_100098695 3300005459 Bacteria 2227
59 Ga0070679_100024768 3300005530 Bacteria 5882
60 Ga0070679_100584771 3300005530 Unclassified 1060
61 Ga0070679_100589164 3300005530 Bacteria 1055
62 Ga0070679_100726135 3300005530 Bacteria 936
63 Ga0070684_100033894 3300005535 Bacteria 4363
64 Ga0068853_100007133 3300005539 Bacteria 8938
65 Ga0068853_100206048 3300005539 Bacteria 1791
66 Ga0070672_100000362 3300005543 Bacteria 26134
67 Ga0070695_100059760 3300005545 Bacteria 2469
68 Ga0070665_100028780 3300005548 Bacteria 5594
69 Ga0068855_100134744 3300005563 Bacteria 2818
70 Ga0068855_100313862 3300005563 Bacteria 1734
71 Ga0070664_100001472 3300005564 Bacteria 18781
72 Ga0070664_100044545 3300005564 Bacteria 3747
73 Ga0068857_100001207 3300005577 Bacteria 20142
74 Ga0068857_100167884 3300005577 Bacteria 1994
75 Ga0068857_100405254 3300005577 Bacteria 1269
76 Ga0068857_100430113 3300005577 Bacteria 1232
77 Ga0068857_101454847 3300005577 Unclassified 667
78 Ga0068854_101141625 3300005578 Bacteria 696
79 Ga0068856_100052448 3300005614 Bacteria 4022
80 Ga0068856_100057718 3300005614 Bacteria 3832
81 Ga0068856_100259672 3300005614 Bacteria 1752
82 Ga0068856_102560403 3300005614 Unclassified 516
83 Ga0068852_100114626 3300005616 Bacteria 2456
84 Ga0068852_100848034 3300005616 Unclassified 929
85 Ga0068859_103177782 3300005617 Bacteria 500
86 Ga0068864_100366076 3300005618 Bacteria 1363
87 Ga0068866_10387137 3300005718 Bacteria 898
88 Ga0068861_100000675 3300005719 Bacteria 20326
89 Ga0068851_10016377 3300005834 Bacteria 3546
90 Ga0068851_10022745 3300005834 Bacteria 3058
91 Ga0068870_10048492 3300005840 Bacteria 2237
92 Ga0068860_100153666 3300005843 Bacteria 2217
93 Ga0068862_100001895 3300005844 Bacteria 18977
94 Ga0068862_100090198 3300005844 Unclassified 2668
95 Ga0068862_102625872 3300005844 Unclassified 515
96 Ga0075368_10096461 3300006042 Bacteria 1212
97 Ga0075366_10647738 3300006195 Bacteria 655
98 Ga0097621_100044748 3300006237 Bacteria 3572
99 Ga0097621_100548984 3300006237 Bacteria 1051
100 Ga0097621_100733961 3300006237 Bacteria 911
101 Ga0068871_100321325 3300006358 Bacteria 1363
102 Ga0075428_100000212 3300006844 Bacteria 55968
103 Ga0075428_100008235 3300006844 Bacteria 11559
104 Ga0075428_100066751 3300006844 Bacteria 3938
105 Ga0075430_100130770 3300006846 Bacteria 2092
106 Ga0075431_100000078 3300006847 Bacteria 57344
107 Ga0075431_100268254 3300006847 Bacteria 1731
108 Ga0075431_101587524 3300006847 Unclassified 612
109 Ga0075429_100025268 3300006880 Bacteria 5156
110 Ga0068865_100020538 3300006881 Bacteria 4284
111 Ga0097620_103176789 3300006931 Bacteria 500
112 Ga0105240_10006259 3300009093 Bacteria 17510
113 Ga0105240_10014954 3300009093 Bacteria 10573
114 Ga0105240_12194159 3300009093 Unclassified 573
115 Ga0111539_10008125 3300009094 Bacteria 13367
116 Ga0111539_10019705 3300009094 Bacteria 8318
117 Ga0111539_10102652 3300009094 Bacteria 3356
118 Ga0105247_10000295 3300009101 Bacteria 44958
119 Ga0114129_10017037 3300009147 Bacteria 10343
120 Ga0114129_10532595 3300009147 Bacteria 1530
121 Ga0105243_10198473 3300009148 Bacteria 1758
122 Ga0105241_11033587 3300009174 Bacteria 770
123 Ga0105248_10495716 3300009177 Unclassified 1377
124 Ga0105248_10495842 3300009177 Bacteria 1377
125 Ga0105237_10922512 3300009545 Unclassified 880
126 Ga0105238_10005255 3300009551 Bacteria 12802
127 Ga0105238_10150163 3300009551 Bacteria 2305
128 Ga0105238_10216772 3300009551 Bacteria 1890
129 Ga0105238_11702875 3300009551 Bacteria 662
130 Ga0105249_10007676 3300009553 Bacteria 9405
131 Ga0105249_10185074 3300009553 Bacteria 2029
132 Ga0105239_10037416 3300010375 Bacteria 5320
133 Ga0105239_10087348 3300010375 Bacteria 3437
134 Ga0105239_10185229 3300010375 Bacteria 2330
135 Ga0105246_10126666 3300011119 Bacteria 1901
136 Ga0157373_10003501 3300013100 Bacteria 11873
137 Ga0157373_10047381 3300013100 Bacteria 3066
138 Ga0157370_10007965 3300013104 Bacteria 11479
139 Ga0157370_10018697 3300013104 Bacteria 6967
140 Ga0157369_10587843 3300013105 Bacteria 1150
141 Ga0157374_10132181 3300013296 Bacteria 2416
142 Ga0157378_11288687 3300013297 Bacteria 772
143 Ga0163162_10060879 3300013306 Bacteria 3812
144 Ga0163162_10147270 3300013306 Bacteria 2471
145 Ga0163162_10538548 3300013306 Bacteria 1296
146 Ga0163162_11538920 3300013306 Bacteria 758
147 Ga0157372_10136608 3300013307 Bacteria 2824
148 Ga0157372_11848938 3300013307 Bacteria 694
149 Ga0157375_10665628 3300013308 Bacteria 1196
150 Ga0157375_11011308 3300013308 Bacteria 971
151 Ga0163163_10184756 3300014325 Bacteria 2132
152 Ga0163163_10391263 3300014325 Bacteria 1448
153 Ga0163163_11817927 3300014325 Bacteria 669
154 Ga0183369_1003 3300015685 Bacteria 726443
155 Ga0163161_10027132 3300017792 Bacteria 4061
156 Ga0163161_10040074 3300017792 Bacteria 3364
157 Ga0213872_10022537 3300021361 Bacteria 2900
158 Ga0207697_10001628 3300025315 Bacteria 12139
159 Ga0207682_10001005 3300025893 Bacteria 13068
160 Ga0207710_10000438 3300025900 Bacteria 27211
161 Ga0207699_10571900 3300025906 Unclassified 821
162 Ga0207645_10019382 3300025907 Bacteria 4460
163 Ga0207643_10082535 3300025908 Bacteria 1864
164 Ga0207707_10021758 3300025912 Bacteria 5605
165 Ga0207707_10089021 3300025912 Bacteria 2697
166 Ga0207695_10062999 3300025913 Bacteria 3824
167 Ga0207695_10682736 3300025913 Bacteria 908
168 Ga0207671_10095878 3300025914 Bacteria 2240
169 Ga0207660_10012713 3300025917 Bacteria 5513
170 Ga0207660_10104956 3300025917 Bacteria 2116
171 Ga0207657_10066934 3300025919 Bacteria 3057
172 Ga0207657_10075883 3300025919 Bacteria 2837
173 Ga0207657_11177532 3300025919 Bacteria 583
174 Ga0207649_10019271 3300025920 Bacteria 3897
175 Ga0207652_10010177 3300025921 Bacteria 7571
176 Ga0207681_10000675 3300025923 Bacteria 22417
177 Ga0207694_10187344 3300025924 Bacteria 1680
178 Ga0207694_11025623 3300025924 Bacteria 698
179 Ga0207650_10000548 3300025925 Bacteria 30528
180 Ga0207650_10254887 3300025925 Bacteria 1422
181 Ga0207659_10011110 3300025926 Bacteria 5681
182 Ga0207700_10181648 3300025928 Bacteria 1762
183 Ga0207664_10045809 3300025929 Bacteria 3431
184 Ga0207644_10007298 3300025931 Bacteria 7194
185 Ga0207644_10107854 3300025931 Bacteria 2101
186 Ga0207690_10044466 3300025932 Bacteria 2927
187 Ga0207690_10185712 3300025932 Bacteria 1568
188 Ga0207706_10005640 3300025933 Bacteria 11661
189 Ga0207709_10343583 3300025935 Bacteria 1124
190 Ga0207669_10028156 3300025937 Bacteria 3088
191 Ga0207669_10127875 3300025937 Bacteria 1739
192 Ga0207704_10020150 3300025938 Bacteria 3521
193 Ga0207691_10000390 3300025940 Bacteria 43939
194 Ga0207691_11593477 3300025940 Bacteria 531
195 Ga0207661_10052818 3300025944 Bacteria 3249
196 Ga0207661_10161579 3300025944 Bacteria 1944
197 Ga0207661_10678677 3300025944 Archaea 947
198 Ga0207661_10792676 3300025944 Unclassified 872
199 Ga0207679_10606078 3300025945 Bacteria 987
200 Ga0207679_10871121 3300025945 Bacteria 823
201 Ga0207667_10365883 3300025949 Bacteria 1470
202 Ga0207651_10008110 3300025960 Bacteria 5646
203 Ga0207712_10092297 3300025961 Unclassified 2232
204 Ga0207668_10113257 3300025972 Bacteria 2039
205 Ga0207668_11382290 3300025972 Bacteria 634
206 Ga0207640_10035863 3300025981 Bacteria 3107
207 Ga0207658_10020314 3300025986 Bacteria 4599
208 Ga0207677_10055002 3300026023 Bacteria 2719
209 Ga0207703_10003534 3300026035 Bacteria 13079
210 Ga0207639_10016166 3300026041 Bacteria 5272
211 Ga0207678_10116892 3300026067 Bacteria 2276
212 Ga0207678_10530920 3300026067 Bacteria 1028
213 Ga0207702_10037333 3300026078 Bacteria 4066
214 Ga0207702_10481848 3300026078 Unclassified 1207
215 Ga0207702_11414746 3300026078 Bacteria 689
216 Ga0207641_10021064 3300026088 Bacteria 5358
217 Ga0207641_10168701 3300026088 Bacteria 1996
218 Ga0207641_10174145 3300026088 Unclassified 1966
219 Ga0207641_11187836 3300026088 Bacteria 762
220 Ga0207648_10005035 3300026089 Bacteria 13408
221 Ga0207676_11360827 3300026095 Bacteria 705
222 Ga0207674_10000046 3300026116 Bacteria 122047
223 Ga0207674_10117688 3300026116 Bacteria 2628
224 Ga0207674_10266923 3300026116 Bacteria 1659
225 Ga0207674_10278430 3300026116 Bacteria 1621
226 Ga0207675_100001289 3300026118 Bacteria 25106
227 Ga0207683_10004593 3300026121 Bacteria 11896
228 Ga0207683_11105006 3300026121 Bacteria 735
229 Ga0207698_10474042 3300026142 Bacteria 1213
230 Ga0207428_10041474 3300027907 Bacteria 3726
231 Ga0207428_10092667 3300027907 Bacteria 2345
232 Ga0268266_10064945 3300028379 Bacteria 3154
233 Ga0268266_10107203 3300028379 Bacteria 2470
234 Ga0268265_10000659 3300028380 Bacteria 34236
235 Ga0268265_10267447 3300028380 Bacteria 1523
236 Ga0268265_10533673 3300028380 Bacteria 1111
237 Ga0268265_12597406 3300028380 Unclassified 512
238 Ga0307515_10054814 3300028794 Bacteria 5843
239 Ga0307515_10102468 3300028794 Bacteria 3442
240 Ga0307515_10121598 3300028794 Bacteria 2952
241 Ga0307513_10333541 3300031456 Unclassified 1270
242 Ga0307406_10204316 3300031901 Bacteria 1457
243 Ga0373924_0194436 3300035410 Unclassified 894
244 Ga0373931_0130022 3300035691 Bacteria 1448
245 Ga0373937_1296337 3300036401 Unclassified 676
246 Ga0395899_0002225 3300037312 Bacteria 15897
247 Ga0395900_0081790 3300037418 Bacteria 3317
248 Ga0395900_1155499 3300037418 Bacteria 690
249 Ga0395898_0072954 3300037466 Bacteria 3315
250 Ga0395901_0171406 3300038443 Bacteria 2277
251 Ga0395901_0388385 3300038443 Unclassified 1435
252 Ga0436361_0006613 3300039447 Bacteria 1811
253 Ga0436361_0061560 3300039447 Bacteria 4085
254 Ga0451807_1598963 3300041486 Bacteria 1201
255 Ga0451853_4088399 3300041512 Bacteria 787
256 Ga0439449_0047392 3300042007 Bacteria 1592
257 Ga0450911_027656 3300042115 Bacteria 735
258 Ga0451577_2011040 3300042876 Unclassified 505
259 Ga0466963_0840439 3300044694 Unclassified 647
260 Ga0451576_0041843 3300045051 Bacteria 4841
261 Ga0451576_0289866 3300045051 Bacteria 1711
262 Ga0495629_0101568 3300046459 Bacteria 2007
263 Ga0495658_0353669 3300046683 Bacteria 934
264 Ga0495669_0506848 3300046684 Unclassified 587
265 Ga0495684_0413243 3300047471 Unclassified 945
266 Ga0495686_0154178 3300047472 Bacteria 1347
267 Ga0496104_0002072 3300048907 Bacteria 17413
268 Ga0496105_0021492 3300048908 Bacteria 5221
269 Ga0496106_0113086 3300048909 Bacteria 2116
270 Ga0496106_1145877 3300048909 Unclassified 608
271 Ga0496108_0006495 3300048911 Bacteria 9486
272 Ga0496109_0003144 3300048912 Bacteria 13774
273 Ga0496110_0004451 3300048913 Bacteria 10862
274 Ga0496111_0014677 3300048914 Bacteria 5357
275 Ga0496112_0332412 3300048915 Bacteria 1463
276 Ga0496113_0064861 3300048916 Bacteria 2762
277 Ga0501033_0125295 3300049570 Bacteria 1863
278 Ga0501033_0572258 3300049570 Bacteria 777
279 Ga0501037_0744253 3300049573 Bacteria 650
280 Ga0501040_0231868 3300049576 Bacteria 1315
281 Ga0501041_0227232 3300049577 Bacteria 1171
282 Ga0501048_0000198 3300049582 Bacteria 39162
283 Ga0501070_0000126 3300049586 Bacteria 68255
284 Ga0501070_1007158 3300049586 Bacteria 646
285 Ga0501072_0239920 3300049588 Unclassified 1444
286 Ga0501072_1095523 3300049588 Unclassified 620
287 Ga0501075_0133170 3300049591 Unclassified 1894
288 Ga0501075_1038865 3300049591 Bacteria 622
289 Ga0501035_0184098 3300049822 Bacteria 1798
290 Ga0501035_0307891 3300049822 Bacteria 1333
291 Ga0501035_0342439 3300049822 Bacteria 1252
292 Ga0501044_1538000 3300049823 Bacteria 530
293 nmdc:mga0k408_275932_c1 3300050493 Bacteria 1003
294 nmdc:mga05p37_7457_c1 3300050507 Bacteria 12897
295 nmdc:mga05p37_843652_c1 3300050507 Bacteria 996
296 nmdc:mga09592_282489_c1 3300050508 Bacteria 1440
297 nmdc:mga0qj67_120827_c1 3300050509 Bacteria 2119
298 nmdc:mga06r32_191914_c1 3300050510 Bacteria 2030
299 nmdc:mga06r32_27_c1 3300050510 Bacteria 88363
300 nmdc:mga08y16_403463_c1 3300050511 Bacteria 1399
301 nmdc:mga08y16_562_c2 3300050511 Bacteria 27914
302 nmdc:mga08y16_60522_c1 3300050511 Bacteria 3955
303 Ga0495619_1036715 3300053085 Unclassified 548
304 Ga0500578_0036160 3300053086 Bacteria 3173
305 Ga0500569_096945 3300053109 Bacteria 962
306 Ga0500637_0053949 3300053178 Unclassified 2294
307 Ga0500645_002335 3300053730 Bacteria 8541
308 Ga0495606_0207215
309 JGI24741J21665_1001048
310 JGI24750J21931_1043461
311 rootL2_10292133
312 rootH1_10002416
313 Ga0070658_10155834
314 Ga0070658_10228647
315 Ga0070676_10246491
316 Ga0070683_100039423
317 Ga0070683_100061722
318 Ga0070683_100163790
319 Ga0070683_100858571
320 Ga0070670_100115586
321 Ga0070677_10001833
322 Ga0068869_100334970
323 Ga0070680_100010782
324 Ga0070680_100028116
325 Ga0070680_100034537
326 Ga0070680_100081830
327 Ga0070682_100438747
328 Ga0068868_100111088
329 Ga0070660_100008304
330 Ga0070660_100066030
331 Ga0070660_100452110
332 Ga0070660_101371448
333 Ga0070691_10000023
334 Ga0070687_100471799
335 Ga0070661_100000496
336 Ga0070692_10411646
337 Ga0070668_100028465
338 Ga0070668_100666308
339 Ga0070668_101363921
340 Ga0070669_100059410
341 Ga0070669_100137374
342 Ga0070675_100080912
343 Ga0070671_100003605
344 Ga0070671_100021008
345 Ga0070674_100009516
346 Ga0070673_100007985
347 Ga0070659_100041668
348 Ga0070659_100079454
349 Ga0070659_100209117
350 Ga0070667_100089167
351 Ga0070709_10471341
352 Ga0070714_100072497
353 Ga0070713_100315272
354 Ga0070705_101742575
355 Ga0070700_100271584
356 Ga0070700_100912943
357 Ga0070663_100088778
358 Ga0070663_100498211
359 Ga0070678_100033258
360 Ga0070678_100246570
361 Ga0070662_100002339
362 Ga0070681_10019385
363 Ga0070681_10397032
364 Ga0070681_11097710
365 Ga0068867_100098695
366 Ga0070679_100024768
367 Ga0070679_100584771
368 Ga0070679_100589164
369 Ga0070679_100726135
370 Ga0070684_100033894
371 Ga0068853_100007133
372 Ga0068853_100206048
373 Ga0070672_100000362
374 Ga0070695_100059760
375 Ga0070665_100028780
376 Ga0068855_100134744
377 Ga0068855_100313862
378 Ga0070664_100001472
379 Ga0070664_100044545
380 Ga0068857_100001207
381 Ga0068857_100167884
382 Ga0068857_100405254
383 Ga0068857_100430113
384 Ga0068857_101454847
385 Ga0068854_101141625
386 Ga0068856_100052448
387 Ga0068856_100057718
388 Ga0068856_100259672
389 Ga0068856_102560403
390 Ga0068852_100114626
391 Ga0068852_100848034
392 Ga0068859_103177782
393 Ga0068864_100366076
394 Ga0068866_10387137
395 Ga0068861_100000675
396 Ga0068851_10016377
397 Ga0068851_10022745
398 Ga0068870_10048492
399 Ga0068860_100153666
400 Ga0068862_100001895
401 Ga0068862_100090198
402 Ga0068862_102625872
403 Ga0075368_10096461
404 Ga0075366_10647738
405 Ga0097621_100044748
406 Ga0097621_100548984
407 Ga0097621_100733961
408 Ga0068871_100321325
409 Ga0075428_100000212
410 Ga0075428_100008235
411 Ga0075428_100066751
412 Ga0075430_100130770
413 Ga0075431_100000078
414 Ga0075431_100268254
415 Ga0075431_101587524
416 Ga0075429_100025268
417 Ga0068865_100020538
418 Ga0097620_103176789
419 Ga0105240_10006259
420 Ga0105240_10014954
421 Ga0105240_12194159
422 Ga0111539_10008125
423 Ga0111539_10019705
424 Ga0111539_10102652
425 Ga0105247_10000295
426 Ga0114129_10017037
427 Ga0114129_10532595
428 Ga0105243_10198473
429 Ga0105241_11033587
430 Ga0105248_10495716
431 Ga0105248_10495842
432 Ga0105237_10922512
433 Ga0105238_10005255
434 Ga0105238_10150163
435 Ga0105238_10216772
436 Ga0105238_11702875
437 Ga0105249_10007676
438 Ga0105249_10185074
439 Ga0105239_10037416
440 Ga0105239_10087348
441 Ga0105239_10185229
442 Ga0105246_10126666
443 Ga0157373_10003501
444 Ga0157373_10047381
445 Ga0157370_10007965
446 Ga0157370_10018697
447 Ga0157369_10587843
448 Ga0157374_10132181
449 Ga0157378_11288687
450 Ga0163162_10060879
451 Ga0163162_10147270
452 Ga0163162_10538548
453 Ga0163162_11538920
454 Ga0157372_10136608
455 Ga0157372_11848938
456 Ga0157375_10665628
457 Ga0157375_11011308
458 Ga0163163_10184756
459 Ga0163163_10391263
460 Ga0163163_11817927
461 Ga0183369_1003
462 Ga0163161_10027132
463 Ga0163161_10040074
464 Ga0213872_10022537
465 Ga0207697_10001628
466 Ga0207682_10001005
467 Ga0207710_10000438
468 Ga0207699_10571900
469 Ga0207645_10019382
470 Ga0207643_10082535
471 Ga0207707_10021758
472 Ga0207707_10089021
473 Ga0207695_10062999
474 Ga0207695_10682736
475 Ga0207671_10095878
476 Ga0207660_10012713
477 Ga0207660_10104956
478 Ga0207657_10066934
479 Ga0207657_10075883
480 Ga0207657_11177532
481 Ga0207649_10019271
482 Ga0207652_10010177
483 Ga0207681_10000675
484 Ga0207694_10187344
485 Ga0207694_11025623
486 Ga0207650_10000548
487 Ga0207650_10254887
488 Ga0207659_10011110
489 Ga0207700_10181648
490 Ga0207664_10045809
491 Ga0207644_10007298
492 Ga0207644_10107854
493 Ga0207690_10044466
494 Ga0207690_10185712
495 Ga0207706_10005640
496 Ga0207709_10343583
497 Ga0207669_10028156
498 Ga0207669_10127875
499 Ga0207704_10020150
500 Ga0207691_10000390
501 Ga0207691_11593477
502 Ga0207661_10052818
503 Ga0207661_10161579
504 Ga0207661_10678677
505 Ga0207661_10792676
506 Ga0207679_10606078
507 Ga0207679_10871121
508 Ga0207667_10365883
509 Ga0207651_10008110
510 Ga0207712_10092297
511 Ga0207668_10113257
512 Ga0207668_11382290
513 Ga0207640_10035863
514 Ga0207658_10020314
515 Ga0207677_10055002
516 Ga0207703_10003534
517 Ga0207639_10016166
518 Ga0207678_10116892
519 Ga0207678_10530920
520 Ga0207702_10037333
521 Ga0207702_10481848
522 Ga0207702_11414746
523 Ga0207641_10021064
524 Ga0207641_10168701
525 Ga0207641_10174145
526 Ga0207641_11187836
527 Ga0207648_10005035
528 Ga0207676_11360827
529 Ga0207674_10000046
530 Ga0207674_10117688
531 Ga0207674_10266923
532 Ga0207674_10278430
533 Ga0207675_100001289
534 Ga0207683_10004593
535 Ga0207683_11105006
536 Ga0207698_10474042
537 Ga0207428_10041474
538 Ga0207428_10092667
539 Ga0268266_10064945
540 Ga0268266_10107203
541 Ga0268265_10000659
542 Ga0268265_10267447
543 Ga0268265_10533673
544 Ga0268265_12597406
545 Ga0307515_10054814
546 Ga0307515_10102468
547 Ga0307515_10121598
548 Ga0307513_10333541
549 Ga0307406_10204316
550 Ga0373924_0194436
551 Ga0373931_0130022
552 Ga0373937_1296337
553 Ga0395899_0002225
554 Ga0395900_0081790
555 Ga0395900_1155499
556 Ga0395898_0072954
557 Ga0395901_0171406
558 Ga0395901_0388385
559 Ga0436361_0006613
560 Ga0436361_0061560
561 Ga0451807_1598963
562 Ga0451853_4088399
563 Ga0439449_0047392
564 Ga0450911_027656
565 Ga0451577_2011040
566 Ga0466963_0840439
567 Ga0451576_0041843
568 Ga0451576_0289866
569 Ga0495629_0101568
570 Ga0495658_0353669
571 Ga0495669_0506848
572 Ga0495684_0413243
573 Ga0495686_0154178
574 Ga0496104_0002072
575 Ga0496105_0021492
576 Ga0496106_0113086
577 Ga0496106_1145877
578 Ga0496108_0006495
579 Ga0496109_0003144
580 Ga0496110_0004451
581 Ga0496111_0014677
582 Ga0496112_0332412
583 Ga0496113_0064861
584 Ga0501033_0125295
585 Ga0501033_0572258
586 Ga0501037_0744253
587 Ga0501040_0231868
588 Ga0501041_0227232
589 Ga0501048_0000198
590 Ga0501070_0000126
591 Ga0501070_1007158
592 Ga0501072_0239920
593 Ga0501072_1095523
594 Ga0501075_0133170
595 Ga0501075_1038865
596 Ga0501035_0184098
597 Ga0501035_0307891
598 Ga0501035_0342439
599 Ga0501044_1538000
600 nmdc:mga0k408_275932_c1
601 nmdc:mga05p37_7457_c1
602 nmdc:mga05p37_843652_c1
603 nmdc:mga09592_282489_c1
604 nmdc:mga0qj67_120827_c1
605 nmdc:mga06r32_191914_c1
606 nmdc:mga06r32_27_c1
607 nmdc:mga08y16_403463_c1
608 nmdc:mga08y16_562_c2
609 nmdc:mga08y16_60522_c1
610 Ga0495619_1036715
611 Ga0500578_0036160
612 Ga0500569_096945
613 Ga0500637_0053949
614 Ga0500645_002335

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

54

135

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7818 3 97
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.6991 3 97
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.6937 2 121
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.6914 3 97
7by6-assembly1.cif.gz_B-2 plasmodium vivax cytoplasmic phenylalanyl-trna synthetase in complex with brd1389 0.6347 52 95
ID Description Score Start End Superfamily
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8089 4 116 2.170.150.70
af_Q54X87_13_141_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8039 3 95 2.170.150.70
af_K7MPT9_9_124_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7771 4 115 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7646 3 98 2.170.150.70
af_A0A0P0W298_97_213_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.751 52 85 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A529T9M0-F1-model_v4 GFA family protein 0.9774 1 98 GO:0016846
GO:0046872
AF-A0A7X2LTL4-F1-model_v4 GFA family protein 0.9685 1 130 GO:0016846
GO:0046872
AF-A0A7W8NCE4-F1-model_v4 CENP-V/GFA domain-containing protein 0.9677 2 130 GO:0016846
GO:0046872
AF-A0A1E4PN95-F1-model_v4 Aldehyde-activating protein 0.9651 1 130 GO:0016846
GO:0046872
AF-A0A7X2LTL4-F1-model_v4 GFA family protein 0.9612 1 130 GO:0016846
GO:0046872

Map