F399301

General Info

Members Datasets Scaffolds Average Seq Length
307 163 614 349

Family's Representative Sequence

Representative Sequence 3300042012|Ga0439455_0010977|Ga0439455_0010977_455_1693
Length 412
Sequence MKLRVDCGDLDYFGGDTGLVDNVLAFSQILRNIPPTVLSTFSLTGLAAFVNVAALAGDFDATRLGMSLTPLPRFLLPSRARIRIVLIAVLGAIAFGTVVFHVLEGWSILDSLYLTVQTVTTVGFGDITPRTTLGRAFATVFMMVGVGIVLYALTSTVQSIVHSELFARYGHSRKMSKLRDHFIICGAGRVGGHLIRSLRAVDGIFLVIESDQKKVEELMDSGIPVLVRDATLEESLIEAGVEHARGLASCLPDDADNVYVVLTARDLNPNIHIVARAAEEQAESKLIRAGANRVVAPTIIGGHRMAMALTKPAVGDFLDSVTANHLELGFEQLEVDALSSLVGRKLSETVIRSELNIVIVSIQRNNGQIIFNPDGGTKIEPCDMLIAIGNAESLARLNVLARGRAAERAIEA

Samples

Sample ID Description Type Environment
1 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
151 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
152 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
158 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 20.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439455_0010977 3300042012 Bacteria 2003
2 MRS1b_contig_1048780 2162886011 Bacteria 2471
3 JGI24737J22298_10020859 3300001990 Bacteria 2089
4 Ga0065714_10064469 3300005288 Bacteria 61986
5 Ga0065712_10000127 3300005290 Bacteria 117106
6 Ga0065712_10004305 3300005290 Bacteria 4676
7 Ga0065712_10018436 3300005290 Unclassified 1515
8 Ga0065712_10089747 3300005290 Bacteria 2455
9 Ga0065715_10099166 3300005293 Unclassified 3449
10 Ga0065715_10102189 3300005293 Unclassified 3136
11 Ga0065707_10096682 3300005295 Unclassified 3239
12 Ga0070670_100004087 3300005331 Bacteria 12190
13 Ga0070670_100005843 3300005331 Bacteria 10403
14 Ga0070670_100008536 3300005331 Bacteria 8739
15 Ga0070670_100111533 3300005331 Bacteria 2357
16 Ga0068869_100008092 3300005334 Bacteria 6761
17 Ga0068869_100012749 3300005334 Bacteria 5560
18 Ga0068869_100023039 3300005334 Unclassified 4295
19 Ga0070666_10031546 3300005335 Bacteria 3498
20 Ga0070682_100005007 3300005337 Bacteria 7364
21 Ga0070682_100095046 3300005337 Bacteria 1956
22 Ga0068868_100193602 3300005338 Bacteria 1691
23 Ga0068868_100299737 3300005338 Bacteria 1365
24 Ga0070689_100042851 3300005340 Bacteria 3476
25 Ga0070689_100226914 3300005340 Bacteria 1534
26 Ga0070689_100240071 3300005340 Bacteria 1492
27 Ga0070692_10026956 3300005345 Unclassified 2844
28 Ga0070692_10029780 3300005345 Bacteria 2724
29 Ga0070669_100003156 3300005353 Bacteria 11851
30 Ga0070669_100032099 3300005353 Bacteria 3793
31 Ga0070675_100037163 3300005354 Bacteria 3965
32 Ga0070671_100026057 3300005355 Bacteria 4802
33 Ga0070671_100103851 3300005355 Bacteria 2384
34 Ga0070673_100140631 3300005364 Unclassified 2035
35 Ga0070688_100033761 3300005365 Bacteria 3094
36 Ga0070667_100200860 3300005367 Bacteria 1769
37 Ga0070701_10009889 3300005438 Bacteria 4196
38 Ga0070701_10096924 3300005438 Unclassified 1626
39 Ga0070705_100035424 3300005440 Bacteria 2798
40 Ga0070705_100208651 3300005440 Bacteria 1345
41 Ga0070700_100000155 3300005441 Bacteria 39898
42 Ga0070700_100028613 3300005441 Bacteria 3317
43 Ga0070694_100003337 3300005444 Bacteria 9605
44 Ga0070694_100067487 3300005444 Bacteria 2456
45 Ga0070694_100092538 3300005444 Unclassified 2124
46 Ga0070694_100129095 3300005444 Bacteria 1824
47 Ga0070708_100000123 3300005445 Bacteria 52148
48 Ga0070708_100105332 3300005445 Bacteria 2587
49 Ga0070708_100310556 3300005445 Bacteria 1485
50 Ga0070708_100360907 3300005445 Bacteria 1369
51 Ga0070662_100089439 3300005457 Unclassified 2310
52 Ga0070681_10001930 3300005458 Bacteria 18715
53 Ga0070681_10012645 3300005458 Bacteria 8373
54 Ga0068867_100003147 3300005459 Bacteria 11634
55 Ga0068867_100136029 3300005459 Bacteria 1915
56 Ga0070685_10012438 3300005466 Unclassified 4472
57 Ga0070706_100008396 3300005467 Bacteria 9624
58 Ga0070706_100011966 3300005467 Bacteria 8051
59 Ga0070707_100022030 3300005468 Bacteria 6024
60 Ga0070707_100180405 3300005468 Bacteria 2058
61 Ga0070698_100002252 3300005471 Bacteria 21345
62 Ga0070698_100016061 3300005471 Bacteria 7904
63 Ga0070698_100022600 3300005471 Bacteria 6578
64 Ga0070698_100026737 3300005471 Bacteria 6003
65 Ga0070698_100113431 3300005471 Bacteria 2675
66 Ga0070699_100001087 3300005518 Bacteria 25323
67 Ga0070699_100045960 3300005518 Bacteria 3778
68 Ga0070699_100063718 3300005518 Bacteria 3196
69 Ga0070699_100119043 3300005518 Unclassified 2321
70 Ga0070679_100001494 3300005530 Bacteria 20758
71 Ga0070679_100080627 3300005530 Bacteria 3244
72 Ga0070697_100000395 3300005536 Bacteria 33783
73 Ga0070697_100024678 3300005536 Bacteria 4788
74 Ga0070686_100015178 3300005544 Bacteria 4454
75 Ga0070686_100015204 3300005544 Unclassified 4451
76 Ga0070695_100017145 3300005545 Unclassified 4393
77 Ga0070695_100073475 3300005545 Unclassified 2245
78 Ga0070695_100135138 3300005545 Unclassified 1704
79 Ga0070696_100017728 3300005546 Bacteria 4808
80 Ga0070696_100027313 3300005546 Unclassified 3888
81 Ga0070696_100046339 3300005546 Unclassified 3015
82 Ga0070693_100008907 3300005547 Unclassified 4978
83 Ga0070693_100020974 3300005547 Bacteria 3454
84 Ga0070693_100028521 3300005547 Bacteria 3035
85 Ga0070693_100040998 3300005547 Bacteria 2602
86 Ga0070704_100096935 3300005549 Bacteria 2212
87 Ga0070704_100124361 3300005549 Bacteria 1987
88 Ga0070704_100167693 3300005549 Unclassified 1743
89 Ga0070664_100001677 3300005564 Bacteria 17745
90 Ga0070664_100250167 3300005564 Bacteria 1593
91 Ga0070664_100270766 3300005564 Bacteria 1530
92 Ga0068857_100006374 3300005577 Bacteria 10108
93 Ga0068857_100092974 3300005577 Bacteria 2701
94 Ga0068854_100085513 3300005578 Bacteria 2336
95 Ga0068854_100200932 3300005578 Unclassified 1567
96 Ga0070702_100063663 3300005615 Bacteria 2154
97 Ga0068852_100453171 3300005616 Bacteria 1270
98 Ga0068852_100481075 3300005616 Unclassified 1234
99 Ga0068859_100030607 3300005617 Bacteria 5401
100 Ga0068859_100045174 3300005617 Bacteria 4426
101 Ga0068859_100118163 3300005617 Bacteria 2717
102 Ga0068859_100228979 3300005617 Bacteria 1946
103 Ga0068859_100303666 3300005617 Unclassified 1689
104 Ga0068864_100000754 3300005618 Bacteria 27198
105 Ga0068864_100004594 3300005618 Bacteria 11326
106 Ga0068864_100014419 3300005618 Bacteria 6564
107 Ga0068864_100257391 3300005618 Bacteria 1623
108 Ga0068866_10075481 3300005718 Bacteria 1795
109 Ga0068861_100011556 3300005719 Bacteria 6143
110 Ga0068863_100157282 3300005841 Bacteria 2176
111 Ga0068858_100062467 3300005842 Bacteria 3444
112 Ga0068858_100180047 3300005842 Bacteria 1995
113 Ga0068858_100227940 3300005842 Bacteria 1766
114 Ga0068860_100003407 3300005843 Bacteria 16343
115 Ga0068860_100021040 3300005843 Bacteria 6320
116 Ga0081539_10001446 3300005985 Bacteria 40634
117 Ga0097621_100001283 3300006237 Bacteria 17273
118 Ga0097621_100008544 3300006237 Bacteria 7378
119 Ga0068871_100026795 3300006358 Bacteria 4501
120 Ga0068871_100053955 3300006358 Bacteria 3260
121 Ga0068871_100160833 3300006358 Bacteria 1921
122 Ga0075428_100118045 3300006844 Bacteria 2889
123 Ga0075428_100170514 3300006844 Bacteria 2359
124 Ga0075430_100045800 3300006846 Unclassified 3694
125 Ga0075431_100025975 3300006847 Bacteria 6003
126 Ga0075431_100177507 3300006847 Unclassified 2187
127 Ga0075433_10008155 3300006852 Bacteria 8341
128 Ga0075433_10011225 3300006852 Bacteria 7210
129 Ga0075433_10033232 3300006852 Unclassified 4421
130 Ga0075433_10057631 3300006852 Bacteria 3395
131 Ga0075434_100047278 3300006871 Unclassified 4270
132 Ga0075434_100115939 3300006871 Unclassified 2691
133 Ga0075434_100378341 3300006871 Bacteria 1437
134 Ga0075429_100106096 3300006880 Unclassified 2454
135 Ga0068865_100009291 3300006881 Bacteria 6091
136 Ga0097620_100030606 3300006931 Bacteria 5401
137 Ga0097620_100045175 3300006931 Bacteria 4426
138 Ga0097620_100118162 3300006931 Bacteria 2717
139 Ga0097620_100228977 3300006931 Bacteria 1946
140 Ga0097620_100303666 3300006931 Unclassified 1689
141 Ga0105240_10442277 3300009093 Bacteria 1457
142 Ga0111539_10000227 3300009094 Bacteria 67567
143 Ga0105245_10025462 3300009098 Bacteria 5203
144 Ga0105247_10002410 3300009101 Bacteria 12715
145 Ga0105247_10111740 3300009101 Bacteria 1759
146 Ga0105247_10128727 3300009101 Bacteria 1648
147 Ga0114129_10002599 3300009147 Bacteria 25103
148 Ga0114129_10212889 3300009147 Bacteria 2612
149 Ga0105243_10338623 3300009148 Bacteria 1377
150 Ga0105241_10051990 3300009174 Bacteria 3127
151 Ga0105241_10109185 3300009174 Unclassified 2212
152 Ga0105242_10011837 3300009176 Bacteria 6714
153 Ga0105242_10034080 3300009176 Bacteria 4081
154 Ga0105242_10101536 3300009176 Bacteria 2438
155 Ga0105242_10353815 3300009176 Unclassified 1357
156 Ga0105248_10005655 3300009177 Bacteria 13732
157 Ga0105248_10191157 3300009177 Unclassified 2307
158 Ga0105237_10009952 3300009545 Bacteria 10145
159 Ga0105237_10261700 3300009545 Unclassified 1732
160 Ga0105238_10050019 3300009551 Bacteria 4208
161 Ga0105249_10445205 3300009553 Unclassified 1333
162 Ga0105239_10014381 3300010375 Bacteria 8781
163 Ga0105246_10023984 3300011119 Bacteria 3955
164 Ga0157373_10005784 3300013100 Bacteria 9263
165 Ga0157373_10062603 3300013100 Bacteria 2635
166 Ga0157374_10040918 3300013296 Bacteria 4269
167 Ga0157374_10159260 3300013296 Bacteria 2199
168 Ga0157378_10003455 3300013297 Bacteria 14018
169 Ga0157378_10025298 3300013297 Bacteria 5228
170 Ga0157378_10249874 3300013297 Unclassified 1697
171 Ga0163162_10003809 3300013306 Bacteria 14465
172 Ga0163162_10087152 3300013306 Bacteria 3200
173 Ga0157372_10507891 3300013307 Bacteria 1405
174 Ga0163163_10002341 3300014325 Bacteria 16030
175 Ga0163163_10004240 3300014325 Bacteria 12219
176 Ga0163163_10005103 3300014325 Bacteria 11322
177 Ga0163163_10064035 3300014325 Bacteria 3648
178 Ga0157380_10024754 3300014326 Unclassified 4547
179 Ga0157380_10134924 3300014326 Unclassified 2111
180 Ga0157377_10148215 3300014745 Bacteria 1448
181 Ga0157376_10018278 3300014969 Bacteria 5369
182 Ga0157376_10210368 3300014969 Bacteria 1795
183 Ga0207656_10001781 3300025321 Bacteria 7167
184 Ga0207653_10002011 3300025885 Bacteria 6493
185 Ga0207710_10007579 3300025900 Bacteria 4590
186 Ga0207680_10101975 3300025903 Bacteria 1846
187 Ga0207647_10016930 3300025904 Bacteria 4963
188 Ga0207643_10005784 3300025908 Bacteria 6609
189 Ga0207684_10000297 3300025910 Bacteria 71105
190 Ga0207684_10011480 3300025910 Bacteria 7745
191 Ga0207684_10069761 3300025910 Unclassified 2987
192 Ga0207707_10000080 3300025912 Bacteria 96693
193 Ga0207707_10069779 3300025912 Unclassified 3063
194 Ga0207671_10016043 3300025914 Bacteria 5838
195 Ga0207671_10284812 3300025914 Unclassified 1304
196 Ga0207660_10034673 3300025917 Unclassified 3499
197 Ga0207660_10037515 3300025917 Bacteria 3377
198 Ga0207660_10133568 3300025917 Bacteria 1891
199 Ga0207652_10001473 3300025921 Bacteria 20844
200 Ga0207652_10042206 3300025921 Bacteria 3881
201 Ga0207646_10032310 3300025922 Bacteria 4737
202 Ga0207681_10000306 3300025923 Bacteria 36019
203 Ga0207681_10006079 3300025923 Bacteria 7404
204 Ga0207681_10063921 3300025923 Bacteria 2539
205 Ga0207694_10021731 3300025924 Bacteria 4863
206 Ga0207694_10135973 3300025924 Bacteria 1974
207 Ga0207650_10000041 3300025925 Bacteria 197115
208 Ga0207650_10028920 3300025925 Unclassified 3979
209 Ga0207650_10062975 3300025925 Bacteria 2772
210 Ga0207690_10005003 3300025932 Bacteria 7829
211 Ga0207706_10118495 3300025933 Unclassified 2328
212 Ga0207686_10201616 3300025934 Bacteria 1425
213 Ga0207709_10061418 3300025935 Bacteria 2348
214 Ga0207670_10000595 3300025936 Bacteria 19771
215 Ga0207665_10000057 3300025939 Bacteria 73138
216 Ga0207691_10011275 3300025940 Bacteria 8575
217 Ga0207711_10035728 3300025941 Bacteria 4213
218 Ga0207711_10084426 3300025941 Bacteria 2779
219 Ga0207711_10236120 3300025941 Unclassified 1675
220 Ga0207689_10002378 3300025942 Bacteria 17562
221 Ga0207689_10018089 3300025942 Bacteria 5951
222 Ga0207689_10055250 3300025942 Bacteria 3268
223 Ga0207679_10052902 3300025945 Bacteria 2980
224 Ga0207679_10353400 3300025945 Bacteria 1282
225 Ga0207679_10453848 3300025945 Bacteria 1137
226 Ga0207651_10043089 3300025960 Unclassified 3009
227 Ga0207651_10290313 3300025960 Unclassified 1356
228 Ga0207712_10032895 3300025961 Unclassified 3502
229 Ga0207712_10261357 3300025961 Unclassified 1404
230 Ga0207640_10020583 3300025981 Unclassified 3919
231 Ga0207640_10047616 3300025981 Unclassified 2767
232 Ga0207640_10111334 3300025981 Bacteria 1941
233 Ga0207658_10367081 3300025986 Bacteria 1257
234 Ga0207677_10078131 3300026023 Bacteria 2362
235 Ga0207677_10097998 3300026023 Bacteria 2150
236 Ga0207703_10035313 3300026035 Bacteria 3973
237 Ga0207703_10079826 3300026035 Bacteria 2724
238 Ga0207703_10093368 3300026035 Bacteria 2534
239 Ga0207703_10501654 3300026035 Bacteria 1139
240 Ga0207639_10011655 3300026041 Bacteria 6110
241 Ga0207639_10020487 3300026041 Bacteria 4734
242 Ga0207708_10000188 3300026075 Bacteria 48769
243 Ga0207708_10046119 3300026075 Unclassified 3320
244 Ga0207708_10048640 3300026075 Bacteria 3228
245 Ga0207708_10065709 3300026075 Bacteria 2773
246 Ga0207702_10095476 3300026078 Bacteria 2612
247 Ga0207641_10413317 3300026088 Unclassified 1298
248 Ga0207641_10414094 3300026088 Bacteria 1296
249 Ga0207648_10087463 3300026089 Bacteria 2720
250 Ga0207676_10013613 3300026095 Bacteria 5839
251 Ga0207676_10014735 3300026095 Bacteria 5631
252 Ga0207676_10019818 3300026095 Bacteria 4913
253 Ga0207676_10250923 3300026095 Unclassified 1593
254 Ga0207676_10407340 3300026095 Bacteria 1272
255 Ga0207674_10329985 3300026116 Bacteria 1475
256 Ga0207675_100011828 3300026118 Bacteria 8159
257 Ga0207675_100176570 3300026118 Bacteria 2044
258 Ga0207675_100323272 3300026118 Bacteria 1507
259 Ga0207683_10054410 3300026121 Bacteria 3510
260 Ga0207428_10009386 3300027907 Bacteria 8776
261 Ga0207428_10231725 3300027907 Bacteria 1382
262 Ga0268266_10026633 3300028379 Bacteria 4920
263 Ga0268266_10129457 3300028379 Bacteria 2256
264 Ga0268265_10189318 3300028380 Bacteria 1775
265 Ga0268264_10009915 3300028381 Bacteria 7886
266 Ga0268264_10093936 3300028381 Bacteria 2592
267 Ga0268264_10564131 3300028381 Unclassified 1118
268 Ga0265338_10064108 3300028800 Bacteria 3199
269 Ga0307408_100014017 3300031548 Bacteria 5325
270 Ga0307405_10146169 3300031731 Bacteria 1656
271 Ga0307413_10021277 3300031824 Bacteria 3469
272 Ga0307406_10007838 3300031901 Bacteria 5941
273 Ga0307412_10012770 3300031911 Bacteria 4902
274 Ga0307412_10069856 3300031911 Unclassified 2392
275 Ga0307412_10165584 3300031911 Bacteria 1648
276 Ga0307409_100171061 3300031995 Bacteria 1912
277 Ga0307416_100148161 3300032002 Bacteria 2147
278 Ga0307416_100568743 3300032002 Bacteria 1209
279 Ga0307414_10039434 3300032004 Bacteria 3181
280 Ga0307414_10108682 3300032004 Bacteria 2105
281 Ga0373942_0018335 3300035207 Unclassified 1736
282 Ga0395900_0039228 3300037418 Unclassified 4880
283 Ga0395901_0141051 3300038443 Bacteria 2533
284 Ga0466961_0001354 3300044693 Bacteria 15106
285 Ga0466958_0010526 3300045836 Bacteria 5182
286 Ga0495663_0000068 3300046525 Bacteria 47393
287 Ga0495598_0000430 3300046537 Bacteria 7590
288 Ga0495621_0000355 3300046539 Bacteria 11151
289 Ga0496110_0217877 3300048913 Bacteria 1736
290 Ga0496113_0343623 3300048916 Unclassified 1197
291 Ga0501202_003119 3300049652 Bacteria 2820
292 Ga0501207_001516 3300049654 Bacteria 2913
293 Ga0501217_003669 3300049661 Bacteria 3116
294 Ga0501223_002324 3300049663 Bacteria 4245
295 Ga0501235_001867 3300049669 Bacteria 4507
296 Ga0501257_004854 3300049686 Bacteria 2944
297 Ga0501225_0001271 3300049705 Bacteria 7820
298 Ga0501234_000865 3300049707 Bacteria 4769
299 Ga0501268_011561 3300049765 Bacteria 1396
300 nmdc:mga05p37_9380_c1 3300050507 Bacteria 10377
301 nmdc:mga09592_32705_c1 3300050508 Bacteria 4336
302 nmdc:mga08y16_29006_c1 3300050511 Bacteria 5833
303 nmdc:mga0n895_70770_c1 3300050512 Unclassified 3457
304 nmdc:mga0a205_18101_c1 3300050515 Bacteria 6619
305 nmdc:mga0a205_2078_c1 3300050515 Bacteria 17510
306 nmdc:mga0a205_237359_c1 3300050515 Unclassified 1705
307 nmdc:mga0a205_308489_c1 3300050515 Unclassified 1455
308 Ga0439455_0010977
309 MRS1b_contig_1048780
310 JGI24737J22298_10020859
311 Ga0065714_10064469
312 Ga0065712_10000127
313 Ga0065712_10004305
314 Ga0065712_10018436
315 Ga0065712_10089747
316 Ga0065715_10099166
317 Ga0065715_10102189
318 Ga0065707_10096682
319 Ga0070670_100004087
320 Ga0070670_100005843
321 Ga0070670_100008536
322 Ga0070670_100111533
323 Ga0068869_100008092
324 Ga0068869_100012749
325 Ga0068869_100023039
326 Ga0070666_10031546
327 Ga0070682_100005007
328 Ga0070682_100095046
329 Ga0068868_100193602
330 Ga0068868_100299737
331 Ga0070689_100042851
332 Ga0070689_100226914
333 Ga0070689_100240071
334 Ga0070692_10026956
335 Ga0070692_10029780
336 Ga0070669_100003156
337 Ga0070669_100032099
338 Ga0070675_100037163
339 Ga0070671_100026057
340 Ga0070671_100103851
341 Ga0070673_100140631
342 Ga0070688_100033761
343 Ga0070667_100200860
344 Ga0070701_10009889
345 Ga0070701_10096924
346 Ga0070705_100035424
347 Ga0070705_100208651
348 Ga0070700_100000155
349 Ga0070700_100028613
350 Ga0070694_100003337
351 Ga0070694_100067487
352 Ga0070694_100092538
353 Ga0070694_100129095
354 Ga0070708_100000123
355 Ga0070708_100105332
356 Ga0070708_100310556
357 Ga0070708_100360907
358 Ga0070662_100089439
359 Ga0070681_10001930
360 Ga0070681_10012645
361 Ga0068867_100003147
362 Ga0068867_100136029
363 Ga0070685_10012438
364 Ga0070706_100008396
365 Ga0070706_100011966
366 Ga0070707_100022030
367 Ga0070707_100180405
368 Ga0070698_100002252
369 Ga0070698_100016061
370 Ga0070698_100022600
371 Ga0070698_100026737
372 Ga0070698_100113431
373 Ga0070699_100001087
374 Ga0070699_100045960
375 Ga0070699_100063718
376 Ga0070699_100119043
377 Ga0070679_100001494
378 Ga0070679_100080627
379 Ga0070697_100000395
380 Ga0070697_100024678
381 Ga0070686_100015178
382 Ga0070686_100015204
383 Ga0070695_100017145
384 Ga0070695_100073475
385 Ga0070695_100135138
386 Ga0070696_100017728
387 Ga0070696_100027313
388 Ga0070696_100046339
389 Ga0070693_100008907
390 Ga0070693_100020974
391 Ga0070693_100028521
392 Ga0070693_100040998
393 Ga0070704_100096935
394 Ga0070704_100124361
395 Ga0070704_100167693
396 Ga0070664_100001677
397 Ga0070664_100250167
398 Ga0070664_100270766
399 Ga0068857_100006374
400 Ga0068857_100092974
401 Ga0068854_100085513
402 Ga0068854_100200932
403 Ga0070702_100063663
404 Ga0068852_100453171
405 Ga0068852_100481075
406 Ga0068859_100030607
407 Ga0068859_100045174
408 Ga0068859_100118163
409 Ga0068859_100228979
410 Ga0068859_100303666
411 Ga0068864_100000754
412 Ga0068864_100004594
413 Ga0068864_100014419
414 Ga0068864_100257391
415 Ga0068866_10075481
416 Ga0068861_100011556
417 Ga0068863_100157282
418 Ga0068858_100062467
419 Ga0068858_100180047
420 Ga0068858_100227940
421 Ga0068860_100003407
422 Ga0068860_100021040
423 Ga0081539_10001446
424 Ga0097621_100001283
425 Ga0097621_100008544
426 Ga0068871_100026795
427 Ga0068871_100053955
428 Ga0068871_100160833
429 Ga0075428_100118045
430 Ga0075428_100170514
431 Ga0075430_100045800
432 Ga0075431_100025975
433 Ga0075431_100177507
434 Ga0075433_10008155
435 Ga0075433_10011225
436 Ga0075433_10033232
437 Ga0075433_10057631
438 Ga0075434_100047278
439 Ga0075434_100115939
440 Ga0075434_100378341
441 Ga0075429_100106096
442 Ga0068865_100009291
443 Ga0097620_100030606
444 Ga0097620_100045175
445 Ga0097620_100118162
446 Ga0097620_100228977
447 Ga0097620_100303666
448 Ga0105240_10442277
449 Ga0111539_10000227
450 Ga0105245_10025462
451 Ga0105247_10002410
452 Ga0105247_10111740
453 Ga0105247_10128727
454 Ga0114129_10002599
455 Ga0114129_10212889
456 Ga0105243_10338623
457 Ga0105241_10051990
458 Ga0105241_10109185
459 Ga0105242_10011837
460 Ga0105242_10034080
461 Ga0105242_10101536
462 Ga0105242_10353815
463 Ga0105248_10005655
464 Ga0105248_10191157
465 Ga0105237_10009952
466 Ga0105237_10261700
467 Ga0105238_10050019
468 Ga0105249_10445205
469 Ga0105239_10014381
470 Ga0105246_10023984
471 Ga0157373_10005784
472 Ga0157373_10062603
473 Ga0157374_10040918
474 Ga0157374_10159260
475 Ga0157378_10003455
476 Ga0157378_10025298
477 Ga0157378_10249874
478 Ga0163162_10003809
479 Ga0163162_10087152
480 Ga0157372_10507891
481 Ga0163163_10002341
482 Ga0163163_10004240
483 Ga0163163_10005103
484 Ga0163163_10064035
485 Ga0157380_10024754
486 Ga0157380_10134924
487 Ga0157377_10148215
488 Ga0157376_10018278
489 Ga0157376_10210368
490 Ga0207656_10001781
491 Ga0207653_10002011
492 Ga0207710_10007579
493 Ga0207680_10101975
494 Ga0207647_10016930
495 Ga0207643_10005784
496 Ga0207684_10000297
497 Ga0207684_10011480
498 Ga0207684_10069761
499 Ga0207707_10000080
500 Ga0207707_10069779
501 Ga0207671_10016043
502 Ga0207671_10284812
503 Ga0207660_10034673
504 Ga0207660_10037515
505 Ga0207660_10133568
506 Ga0207652_10001473
507 Ga0207652_10042206
508 Ga0207646_10032310
509 Ga0207681_10000306
510 Ga0207681_10006079
511 Ga0207681_10063921
512 Ga0207694_10021731
513 Ga0207694_10135973
514 Ga0207650_10000041
515 Ga0207650_10028920
516 Ga0207650_10062975
517 Ga0207690_10005003
518 Ga0207706_10118495
519 Ga0207686_10201616
520 Ga0207709_10061418
521 Ga0207670_10000595
522 Ga0207665_10000057
523 Ga0207691_10011275
524 Ga0207711_10035728
525 Ga0207711_10084426
526 Ga0207711_10236120
527 Ga0207689_10002378
528 Ga0207689_10018089
529 Ga0207689_10055250
530 Ga0207679_10052902
531 Ga0207679_10353400
532 Ga0207679_10453848
533 Ga0207651_10043089
534 Ga0207651_10290313
535 Ga0207712_10032895
536 Ga0207712_10261357
537 Ga0207640_10020583
538 Ga0207640_10047616
539 Ga0207640_10111334
540 Ga0207658_10367081
541 Ga0207677_10078131
542 Ga0207677_10097998
543 Ga0207703_10035313
544 Ga0207703_10079826
545 Ga0207703_10093368
546 Ga0207703_10501654
547 Ga0207639_10011655
548 Ga0207639_10020487
549 Ga0207708_10000188
550 Ga0207708_10046119
551 Ga0207708_10048640
552 Ga0207708_10065709
553 Ga0207702_10095476
554 Ga0207641_10413317
555 Ga0207641_10414094
556 Ga0207648_10087463
557 Ga0207676_10013613
558 Ga0207676_10014735
559 Ga0207676_10019818
560 Ga0207676_10250923
561 Ga0207676_10407340
562 Ga0207674_10329985
563 Ga0207675_100011828
564 Ga0207675_100176570
565 Ga0207675_100323272
566 Ga0207683_10054410
567 Ga0207428_10009386
568 Ga0207428_10231725
569 Ga0268266_10026633
570 Ga0268266_10129457
571 Ga0268265_10189318
572 Ga0268264_10009915
573 Ga0268264_10093936
574 Ga0268264_10564131
575 Ga0265338_10064108
576 Ga0307408_100014017
577 Ga0307405_10146169
578 Ga0307413_10021277
579 Ga0307406_10007838
580 Ga0307412_10012770
581 Ga0307412_10069856
582 Ga0307412_10165584
583 Ga0307409_100171061
584 Ga0307416_100148161
585 Ga0307416_100568743
586 Ga0307414_10039434
587 Ga0307414_10108682
588 Ga0373942_0018335
589 Ga0395900_0039228
590 Ga0395901_0141051
591 Ga0466961_0001354
592 Ga0466958_0010526
593 Ga0495663_0000068
594 Ga0495598_0000430
595 Ga0495621_0000355
596 Ga0496110_0217877
597 Ga0496113_0343623
598 Ga0501202_003119
599 Ga0501207_001516
600 Ga0501217_003669
601 Ga0501223_002324
602 Ga0501235_001867
603 Ga0501257_004854
604 Ga0501225_0001271
605 Ga0501234_000865
606 Ga0501268_011561
607 nmdc:mga05p37_9380_c1
608 nmdc:mga09592_32705_c1
609 nmdc:mga08y16_29006_c1
610 nmdc:mga0n895_70770_c1
611 nmdc:mga0a205_18101_c1
612 nmdc:mga0a205_2078_c1
613 nmdc:mga0a205_237359_c1
614 nmdc:mga0a205_308489_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

182

297

0.99

PF02080

TrkA_C

TrkA-C domain

330

401

0.95

PF07885

Ion_trans_2

Ion channel

87

162

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ahz-assembly1.cif.gz_A k+ complex of the nak channel 0.9254 2 76
2q69-assembly1.cif.gz_A crystal structure of nak channel d66n mutant 0.9232 2 79
2q67-assembly1.cif.gz_A crystal structure of nak channel d66a mutant 0.9196 2 79
2q68-assembly1.cif.gz_A crystal structure of nak channel d66a, s70e double mutants 0.9189 2 79
2q6a-assembly1.cif.gz_A crystal structure of nak channel d66e mutant 0.9143 2 79
ID Description Score Start End Superfamily
af_A0A2R8QB85_115_265_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9435 4 73 1.10.287.70
af_K7L5I6_274_336_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9323 7 65 1.10.287.70
af_B5BNY0_223_353_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9284 2 89 1.10.287.70
2ahzA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9254 2 76 1.10.287.70
af_Q9SVV6_260_370_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9252 2 89 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9688 101 212 GO:0005886
GO:0006813
GO:0015297
AF-A0A800LVK7-F1-model_v4 RCK C-terminal domain-containing protein 0.9487 244 320 GO:0006813
GO:0008324
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9442 101 212 GO:0005886
GO:0006813
GO:0015297
AF-X1ERI5-F1-model_v4 RCK N-terminal domain-containing protein 0.9356 125 215 GO:0006813
AF-A0A6P1B333-F1-model_v4 deleted 0.9225 125 217

Map