F399265

General Info

Members Datasets Scaffolds Average Seq Length
307 219 614 89

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10647830|Ga0307405_106478301
Length 100
Sequence VVAQKSEAVRRYIEETGLPFNILIDDSREVLKAYGVWHRVGMDAWNIARPALFVIEPGGRITYSFVADRQHEFPTHDEIVGALRGATSGQRPTPDPPSGN

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
214 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 0
Rhizoplane 2.93
Rhizosphere 89.25
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10647830 3300031731 Unclassified 868
2 MBSR1b_contig_4967201 2162886012 Unclassified 887
3 Ga0065715_10132592 3300005293 Bacteria 1987
4 Ga0065715_10260982 3300005293 Bacteria 1138
5 Ga0065715_11041988 3300005293 Unclassified 534
6 Ga0065707_10007114 3300005295 Bacteria 2821
7 Ga0070676_10021763 3300005328 Bacteria 3591
8 Ga0070690_100111053 3300005330 Bacteria 1829
9 Ga0070670_100420735 3300005331 Bacteria 1181
10 Ga0070677_10229454 3300005333 Bacteria 911
11 Ga0068869_100222522 3300005334 Bacteria 1497
12 Ga0068869_101558429 3300005334 Bacteria 588
13 Ga0070666_10061153 3300005335 Bacteria 2550
14 Ga0070680_101677201 3300005336 Unclassified 551
15 Ga0068868_100042840 3300005338 Bacteria 3535
16 Ga0070660_101105689 3300005339 Bacteria 671
17 Ga0070689_100866299 3300005340 Unclassified 797
18 Ga0070691_10131468 3300005341 Bacteria 1269
19 Ga0070661_100516361 3300005344 Bacteria 958
20 Ga0070661_101187551 3300005344 Bacteria 638
21 Ga0070692_10160120 3300005345 Bacteria 1289
22 Ga0070668_100450700 3300005347 Bacteria 1106
23 Ga0070668_101440337 3300005347 Bacteria 629
24 Ga0070669_100180137 3300005353 Bacteria 1652
25 Ga0070675_100233232 3300005354 Bacteria 1606
26 Ga0070671_100052195 3300005355 Bacteria 3400
27 Ga0070671_100420728 3300005355 Bacteria 1144
28 Ga0070671_100781670 3300005355 Bacteria 831
29 Ga0070674_100034159 3300005356 Bacteria 3394
30 Ga0070674_100707823 3300005356 Bacteria 862
31 Ga0070673_100001619 3300005364 Bacteria 13321
32 Ga0070659_100220890 3300005366 Bacteria 1564
33 Ga0070667_100244937 3300005367 Bacteria 1601
34 Ga0070667_100813205 3300005367 Bacteria 868
35 Ga0070703_10218049 3300005406 Bacteria 758
36 Ga0070701_10024037 3300005438 Bacteria 2944
37 Ga0070701_11362563 3300005438 Bacteria 509
38 Ga0070705_100173212 3300005440 Bacteria 1454
39 Ga0070700_100024809 3300005441 Bacteria 3525
40 Ga0070700_101098551 3300005441 Bacteria 659
41 Ga0070663_101374986 3300005455 Bacteria 625
42 Ga0070678_100479249 3300005456 Bacteria 1094
43 Ga0070662_100650983 3300005457 Bacteria 889
44 Ga0070662_100763309 3300005457 Bacteria 821
45 Ga0070662_100780379 3300005457 Bacteria 812
46 Ga0070681_10609848 3300005458 Bacteria 1006
47 Ga0068867_100036787 3300005459 Bacteria 3555
48 Ga0070698_101215074 3300005471 Unclassified 703
49 Ga0070684_102145695 3300005535 Unclassified 527
50 Ga0070697_101892928 3300005536 Unclassified 534
51 Ga0068853_100109601 3300005539 Bacteria 2451
52 Ga0070672_100024731 3300005543 Bacteria 4443
53 Ga0070686_100040975 3300005544 Bacteria 2891
54 Ga0070695_100164724 3300005545 Bacteria 1559
55 Ga0070696_100685515 3300005546 Bacteria 834
56 Ga0070665_102089272 3300005548 Bacteria 571
57 Ga0070704_100018748 3300005549 Bacteria 4432
58 Ga0070704_101157995 3300005549 Unclassified 704
59 Ga0070704_102174327 3300005549 Bacteria 516
60 Ga0068855_100657930 3300005563 Bacteria 1124
61 Ga0070664_100689739 3300005564 Bacteria 951
62 Ga0070664_101290111 3300005564 Bacteria 689
63 Ga0068857_100243806 3300005577 Bacteria 1646
64 Ga0068857_101139445 3300005577 Bacteria 754
65 Ga0068854_100048965 3300005578 Bacteria 3017
66 Ga0068854_100154514 3300005578 Bacteria 1772
67 Ga0070702_100012666 3300005615 Bacteria 4235
68 Ga0068852_100073627 3300005616 Bacteria 3006
69 Ga0068859_100115266 3300005617 Bacteria 2752
70 Ga0068866_10012805 3300005718 Bacteria 3662
71 Ga0068866_10815248 3300005718 Bacteria 650
72 Ga0068861_100216079 3300005719 Bacteria 1618
73 Ga0068851_10405377 3300005834 Bacteria 803
74 Ga0068858_101573782 3300005842 Bacteria 648
75 Ga0068860_100025291 3300005843 Bacteria 5730
76 Ga0068860_100403171 3300005843 Bacteria 1353
77 Ga0068862_100320973 3300005844 Bacteria 1429
78 Ga0068862_100529108 3300005844 Bacteria 1123
79 Ga0075365_10070937 3300006038 Bacteria 2344
80 Ga0075365_10351866 3300006038 Unclassified 1038
81 Ga0075368_10035693 3300006042 Bacteria 1941
82 Ga0075364_10010244 3300006051 Bacteria 5656
83 Ga0075364_10654079 3300006051 Unclassified 718
84 Ga0070716_101669324 3300006173 Bacteria 525
85 Ga0070712_100526989 3300006175 Bacteria 993
86 Ga0075367_10024878 3300006178 Bacteria 3379
87 Ga0075367_10197390 3300006178 Bacteria 1257
88 Ga0075366_10009580 3300006195 Bacteria 5410
89 Ga0075370_10008661 3300006353 Bacteria 5244
90 Ga0075430_101409848 3300006846 Bacteria 573
91 Ga0075433_10207679 3300006852 Unclassified 1741
92 Ga0075434_100113237 3300006871 Bacteria 2725
93 Ga0075434_100197006 3300006871 Bacteria 2034
94 Ga0075434_100517295 3300006871 Unclassified 1214
95 Ga0068865_100051656 3300006881 Bacteria 2847
96 Ga0068865_100649456 3300006881 Bacteria 896
97 Ga0075436_100426810 3300006914 Unclassified 963
98 Ga0097620_100115267 3300006931 Bacteria 2752
99 Ga0075435_100003520 3300007076 Bacteria 10627
100 Ga0105240_10607509 3300009093 Bacteria 1203
101 Ga0111539_11880843 3300009094 Bacteria 694
102 Ga0105245_10068271 3300009098 Bacteria 3221
103 Ga0105247_10172500 3300009101 Bacteria 1439
104 Ga0114129_10000358 3300009147 Bacteria 52801
105 Ga0114129_12254585 3300009147 Bacteria 654
106 Ga0105243_10142355 3300009148 Bacteria 2047
107 Ga0105243_12393941 3300009148 Bacteria 566
108 Ga0105241_11221099 3300009174 Bacteria 713
109 Ga0105242_10022315 3300009176 Bacteria 4976
110 Ga0105248_10024360 3300009177 Bacteria 6731
111 Ga0105248_11825272 3300009177 Bacteria 690
112 Ga0105238_12531018 3300009551 Bacteria 549
113 Ga0105249_10057079 3300009553 Bacteria 3575
114 Ga0105249_10234571 3300009553 Bacteria 1811
115 Ga0105239_10468382 3300010375 Bacteria 1430
116 Ga0105246_12139218 3300011119 Bacteria 543
117 Ga0157378_10133740 3300013297 Bacteria 2298
118 Ga0157378_10150142 3300013297 Bacteria 2171
119 Ga0157378_11472028 3300013297 Bacteria 725
120 Ga0163162_12240610 3300013306 Bacteria 627
121 Ga0157375_10078695 3300013308 Bacteria 3331
122 Ga0157380_11942849 3300014326 Unclassified 649
123 Ga0157376_10317945 3300014969 Bacteria 1479
124 Ga0157376_11650686 3300014969 Bacteria 676
125 Ga0207697_10347280 3300025315 Bacteria 659
126 Ga0207653_10064743 3300025885 Bacteria 1240
127 Ga0207642_10012196 3300025899 Bacteria 3095
128 Ga0207642_10333544 3300025899 Bacteria 889
129 Ga0207710_10696742 3300025900 Bacteria 533
130 Ga0207688_10113437 3300025901 Bacteria 1575
131 Ga0207680_10315815 3300025903 Bacteria 1091
132 Ga0207647_10068343 3300025904 Bacteria 2151
133 Ga0207685_10136976 3300025905 Unclassified 1093
134 Ga0207645_10020499 3300025907 Bacteria 4328
135 Ga0207654_10108207 3300025911 Bacteria 1725
136 Ga0207693_10485539 3300025915 Bacteria 965
137 Ga0207663_10290542 3300025916 Unclassified 1218
138 Ga0207662_10004576 3300025918 Bacteria 7290
139 Ga0207649_11688253 3300025920 Bacteria 501
140 Ga0207652_11129757 3300025921 Bacteria 684
141 Ga0207681_10018771 3300025923 Bacteria 4362
142 Ga0207694_10791785 3300025924 Bacteria 801
143 Ga0207650_10154922 3300025925 Bacteria 1811
144 Ga0207659_10207638 3300025926 Bacteria 1568
145 Ga0207644_10101977 3300025931 Bacteria 2157
146 Ga0207644_10552600 3300025931 Bacteria 953
147 Ga0207706_10296690 3300025933 Bacteria 1408
148 Ga0207706_10337950 3300025933 Bacteria 1310
149 Ga0207686_10064687 3300025934 Bacteria 2330
150 Ga0207709_11196712 3300025935 Bacteria 626
151 Ga0207709_11608532 3300025935 Bacteria 540
152 Ga0207669_10003835 3300025937 Bacteria 6551
153 Ga0207669_10204845 3300025937 Bacteria 1435
154 Ga0207704_10412119 3300025938 Bacteria 1069
155 Ga0207704_10661799 3300025938 Bacteria 861
156 Ga0207691_10035070 3300025940 Bacteria 4661
157 Ga0207691_10910944 3300025940 Bacteria 736
158 Ga0207711_10028502 3300025941 Bacteria 4698
159 Ga0207711_11971562 3300025941 Bacteria 527
160 Ga0207689_10399042 3300025942 Bacteria 1146
161 Ga0207689_10610727 3300025942 Bacteria 918
162 Ga0207679_10661277 3300025945 Bacteria 946
163 Ga0207679_10694169 3300025945 Bacteria 923
164 Ga0207651_10007504 3300025960 Bacteria 5814
165 Ga0207712_10111559 3300025961 Bacteria 2052
166 Ga0207712_11912717 3300025961 Bacteria 531
167 Ga0207658_10363059 3300025986 Bacteria 1264
168 Ga0207677_10584444 3300026023 Bacteria 978
169 Ga0207703_11871428 3300026035 Bacteria 576
170 Ga0207639_10101359 3300026041 Bacteria 2328
171 Ga0207678_10247289 3300026067 Bacteria 1527
172 Ga0207678_11387883 3300026067 Bacteria 621
173 Ga0207708_10009307 3300026075 Bacteria 7272
174 Ga0207641_10348427 3300026088 Bacteria 1411
175 Ga0207648_10014447 3300026089 Bacteria 7296
176 Ga0207648_10272010 3300026089 Bacteria 1514
177 Ga0207648_11281466 3300026089 Bacteria 689
178 Ga0207674_10363954 3300026116 Bacteria 1398
179 Ga0207674_10473272 3300026116 Bacteria 1211
180 Ga0207675_100076311 3300026118 Bacteria 3138
181 Ga0207675_101309677 3300026118 Bacteria 745
182 Ga0207683_10623198 3300026121 Bacteria 999
183 Ga0209966_1056857 3300027695 Bacteria 840
184 Ga0209813_10360540 3300027866 Bacteria 578
185 Ga0209974_10043204 3300027876 Bacteria 1501
186 Ga0268266_11186136 3300028379 Bacteria 738
187 Ga0268264_12361411 3300028381 Bacteria 538
188 Ga0307408_100714977 3300031548 Bacteria 902
189 Ga0307405_11917713 3300031731 Bacteria 529
190 Ga0307413_10084968 3300031824 Bacteria 2042
191 Ga0307406_10021983 3300031901 Bacteria 3781
192 Ga0307407_10137661 3300031903 Bacteria 1571
193 Ga0307407_10639196 3300031903 Bacteria 796
194 Ga0307407_11057722 3300031903 Unclassified 629
195 Ga0307412_10126491 3300031911 Bacteria 1849
196 Ga0307409_100113908 3300031995 Bacteria 2274
197 Ga0307409_101294205 3300031995 Bacteria 754
198 Ga0307409_101496260 3300031995 Bacteria 702
199 Ga0307416_100073165 3300032002 Bacteria 2856
200 Ga0307416_100289751 3300032002 Bacteria 1620
201 Ga0307416_101308997 3300032002 Bacteria 830
202 Ga0307414_10405924 3300032004 Bacteria 1185
203 Ga0307414_11784053 3300032004 Unclassified 574
204 Ga0307411_10134999 3300032005 Bacteria 1810
205 Ga0307411_10195201 3300032005 Bacteria 1549
206 Ga0307411_10634606 3300032005 Bacteria 923
207 Ga0307411_10914468 3300032005 Bacteria 780
208 Ga0307411_11324571 3300032005 Unclassified 657
209 Ga0307415_102040204 3300032126 Bacteria 559
210 Ga0373944_0386107 3300035089 Unclassified 538
211 Ga0373949_0050421 3300035090 Bacteria 1047
212 Ga0373949_0305988 3300035090 Bacteria 506
213 Ga0373952_0047085 3300035092 Bacteria 1015
214 Ga0373945_0285165 3300035116 Unclassified 704
215 Ga0373960_0055710 3300035121 Bacteria 1186
216 Ga0373943_0033558 3300035170 Unclassified 2446
217 Ga0373943_0311753 3300035170 Bacteria 895
218 Ga0373961_0158836 3300035241 Bacteria 775
219 Ga0373931_0144292 3300035691 Bacteria 1382
220 Ga0373935_0187834 3300035692 Bacteria 1422
221 Ga0373947_0233845 3300035725 Unclassified 1211
222 Ga0373925_0002370 3300037068 Bacteria 15111
223 Ga0395900_0917180 3300037418 Bacteria 799
224 Ga0439433_0028481 3300041999 Unclassified 1270
225 Ga0439449_0092031 3300042007 Bacteria 1120
226 Ga0439434_0098866 3300042435 Bacteria 939
227 Ga0450918_042398 3300042531 Unclassified 819
228 Ga0451576_0399432 3300045051 Bacteria 1441
229 Ga0451576_1630953 3300045051 Bacteria 669
230 Ga0495603_0160471 3300046455 Bacteria 1304
231 Ga0495629_0035207 3300046459 Bacteria 3539
232 Ga0495594_0646622 3300046499 Unclassified 599
233 Ga0495586_0422684 3300046535 Unclassified 768
234 Ga0495622_0274384 3300046557 Bacteria 738
235 Ga0495656_0176076 3300046615 Bacteria 1049
236 Ga0495671_0393461 3300046692 Bacteria 664
237 Ga0496100_0842959 3300048903 Bacteria 719
238 Ga0496102_0668348 3300048905 Bacteria 962
239 Ga0496103_0679583 3300048906 Bacteria 653
240 Ga0496106_0079544 3300048909 Bacteria 2517
241 Ga0496107_0346690 3300048910 Bacteria 1105
242 Ga0496112_0100759 3300048915 Bacteria 2858
243 Ga0496112_0196272 3300048915 Bacteria 1979
244 Ga0496113_0391182 3300048916 Bacteria 1116
245 Ga0496114_0372442 3300048917 Bacteria 1264
246 Ga0501031_0037733 3300049568 Bacteria 3154
247 Ga0501032_0350545 3300049569 Bacteria 951
248 Ga0501033_0729380 3300049570 Bacteria 673
249 Ga0501036_0455620 3300049572 Bacteria 1066
250 Ga0501040_0827222 3300049576 Bacteria 670
251 Ga0501040_1202547 3300049576 Bacteria 550
252 Ga0501041_0115289 3300049577 Bacteria 1668
253 Ga0501041_0173244 3300049577 Bacteria 1350
254 Ga0501046_0141927 3300049580 Bacteria 1817
255 Ga0501048_0116349 3300049582 Bacteria 1889
256 Ga0501048_1357746 3300049582 Bacteria 511
257 Ga0501069_0043581 3300049585 Bacteria 2484
258 Ga0501071_0006809 3300049587 Bacteria 7445
259 Ga0501071_0465035 3300049587 Bacteria 969
260 Ga0501071_1344853 3300049587 Bacteria 552
261 Ga0501072_0038560 3300049588 Bacteria 3750
262 Ga0501072_0087245 3300049588 Bacteria 2476
263 Ga0501072_1191353 3300049588 Bacteria 592
264 Ga0501074_0622390 3300049590 Bacteria 763
265 Ga0501075_0020558 3300049591 Bacteria 4805
266 Ga0501075_0091234 3300049591 Bacteria 2312
267 Ga0501075_0505127 3300049591 Bacteria 922
268 Ga0501076_0085798 3300049592 Bacteria 2530
269 Ga0501076_0088920 3300049592 Bacteria 2483
270 Ga0501077_0152659 3300049593 Bacteria 1466
271 Ga0501235_091880 3300049669 Bacteria 734
272 Ga0501221_101706 3300049704 Bacteria 714
273 Ga0501079_0556354 3300049741 Bacteria 902
274 Ga0501079_0650456 3300049741 Bacteria 830
275 Ga0501080_0229812 3300049742 Bacteria 1696
276 Ga0501080_0557586 3300049742 Bacteria 1020
277 Ga0501263_093934 3300049760 Unclassified 509
278 Ga0501045_0116058 3300049824 Bacteria 1986
279 Ga0501045_0188460 3300049824 Bacteria 1537
280 nmdc:mga03683_1732_c1 3300050489 Bacteria 6585
281 nmdc:mga00v17_18773_c1 3300050491 Bacteria 3935
282 nmdc:mga00v17_474399_c1 3300050491 Unclassified 812
283 nmdc:mga00v17_596_c1 3300050491 Bacteria 20095
284 nmdc:mga0yw44_100084_c1 3300050492 Bacteria 1845
285 nmdc:mga0yw44_124840_c1 3300050492 Bacteria 1661
286 nmdc:mga0yw44_16636_c1 3300050492 Bacteria 3979
287 nmdc:mga0k408_13946_c1 3300050493 Bacteria 4417
288 nmdc:mga0k408_20683_c1 3300050493 Bacteria 3690
289 nmdc:mga06z11_13242_c1 3300050494 Bacteria 3615
290 nmdc:mga06z11_5666_c1 3300050494 Bacteria 5031
291 nmdc:mga04h51_395539_c1 3300050495 Bacteria 578
292 nmdc:mga07m45_33768_c1 3300050496 Bacteria 2842
293 nmdc:mga05p37_158_c1 3300050507 Bacteria 65027
294 nmdc:mga0qj67_749115_c1 3300050509 Bacteria 775
295 nmdc:mga0n895_200934_c1 3300050512 Bacteria 2024
296 nmdc:mga0n895_741041_c1 3300050512 Unclassified 976
297 nmdc:mga0rr50_1208565_c1 3300050513 Bacteria 642
298 nmdc:mga0rr50_22887_c1 3300050513 Bacteria 4298
299 nmdc:mga0a205_203439_c1 3300050515 Archaea 1870
300 Ga0500628_062234 3300053129 Bacteria 914
301 Ga0590071_012382 3300059421 Bacteria 1998
302 Ga0590071_086984 3300059421 Bacteria 780
303 Ga0590074_034584 3300059423 Bacteria 898
304 Ga0590075_118262 3300059424 Bacteria 693
305 Ga0590077_096238 3300059426 Bacteria 690
306 Ga0501082_0158385 3300060353 Bacteria 1967
307 Ga0530510_0265663 3300061734 Bacteria 1280
308 Ga0307405_10647830
309 MBSR1b_contig_4967201
310 Ga0065715_10132592
311 Ga0065715_10260982
312 Ga0065715_11041988
313 Ga0065707_10007114
314 Ga0070676_10021763
315 Ga0070690_100111053
316 Ga0070670_100420735
317 Ga0070677_10229454
318 Ga0068869_100222522
319 Ga0068869_101558429
320 Ga0070666_10061153
321 Ga0070680_101677201
322 Ga0068868_100042840
323 Ga0070660_101105689
324 Ga0070689_100866299
325 Ga0070691_10131468
326 Ga0070661_100516361
327 Ga0070661_101187551
328 Ga0070692_10160120
329 Ga0070668_100450700
330 Ga0070668_101440337
331 Ga0070669_100180137
332 Ga0070675_100233232
333 Ga0070671_100052195
334 Ga0070671_100420728
335 Ga0070671_100781670
336 Ga0070674_100034159
337 Ga0070674_100707823
338 Ga0070673_100001619
339 Ga0070659_100220890
340 Ga0070667_100244937
341 Ga0070667_100813205
342 Ga0070703_10218049
343 Ga0070701_10024037
344 Ga0070701_11362563
345 Ga0070705_100173212
346 Ga0070700_100024809
347 Ga0070700_101098551
348 Ga0070663_101374986
349 Ga0070678_100479249
350 Ga0070662_100650983
351 Ga0070662_100763309
352 Ga0070662_100780379
353 Ga0070681_10609848
354 Ga0068867_100036787
355 Ga0070698_101215074
356 Ga0070684_102145695
357 Ga0070697_101892928
358 Ga0068853_100109601
359 Ga0070672_100024731
360 Ga0070686_100040975
361 Ga0070695_100164724
362 Ga0070696_100685515
363 Ga0070665_102089272
364 Ga0070704_100018748
365 Ga0070704_101157995
366 Ga0070704_102174327
367 Ga0068855_100657930
368 Ga0070664_100689739
369 Ga0070664_101290111
370 Ga0068857_100243806
371 Ga0068857_101139445
372 Ga0068854_100048965
373 Ga0068854_100154514
374 Ga0070702_100012666
375 Ga0068852_100073627
376 Ga0068859_100115266
377 Ga0068866_10012805
378 Ga0068866_10815248
379 Ga0068861_100216079
380 Ga0068851_10405377
381 Ga0068858_101573782
382 Ga0068860_100025291
383 Ga0068860_100403171
384 Ga0068862_100320973
385 Ga0068862_100529108
386 Ga0075365_10070937
387 Ga0075365_10351866
388 Ga0075368_10035693
389 Ga0075364_10010244
390 Ga0075364_10654079
391 Ga0070716_101669324
392 Ga0070712_100526989
393 Ga0075367_10024878
394 Ga0075367_10197390
395 Ga0075366_10009580
396 Ga0075370_10008661
397 Ga0075430_101409848
398 Ga0075433_10207679
399 Ga0075434_100113237
400 Ga0075434_100197006
401 Ga0075434_100517295
402 Ga0068865_100051656
403 Ga0068865_100649456
404 Ga0075436_100426810
405 Ga0097620_100115267
406 Ga0075435_100003520
407 Ga0105240_10607509
408 Ga0111539_11880843
409 Ga0105245_10068271
410 Ga0105247_10172500
411 Ga0114129_10000358
412 Ga0114129_12254585
413 Ga0105243_10142355
414 Ga0105243_12393941
415 Ga0105241_11221099
416 Ga0105242_10022315
417 Ga0105248_10024360
418 Ga0105248_11825272
419 Ga0105238_12531018
420 Ga0105249_10057079
421 Ga0105249_10234571
422 Ga0105239_10468382
423 Ga0105246_12139218
424 Ga0157378_10133740
425 Ga0157378_10150142
426 Ga0157378_11472028
427 Ga0163162_12240610
428 Ga0157375_10078695
429 Ga0157380_11942849
430 Ga0157376_10317945
431 Ga0157376_11650686
432 Ga0207697_10347280
433 Ga0207653_10064743
434 Ga0207642_10012196
435 Ga0207642_10333544
436 Ga0207710_10696742
437 Ga0207688_10113437
438 Ga0207680_10315815
439 Ga0207647_10068343
440 Ga0207685_10136976
441 Ga0207645_10020499
442 Ga0207654_10108207
443 Ga0207693_10485539
444 Ga0207663_10290542
445 Ga0207662_10004576
446 Ga0207649_11688253
447 Ga0207652_11129757
448 Ga0207681_10018771
449 Ga0207694_10791785
450 Ga0207650_10154922
451 Ga0207659_10207638
452 Ga0207644_10101977
453 Ga0207644_10552600
454 Ga0207706_10296690
455 Ga0207706_10337950
456 Ga0207686_10064687
457 Ga0207709_11196712
458 Ga0207709_11608532
459 Ga0207669_10003835
460 Ga0207669_10204845
461 Ga0207704_10412119
462 Ga0207704_10661799
463 Ga0207691_10035070
464 Ga0207691_10910944
465 Ga0207711_10028502
466 Ga0207711_11971562
467 Ga0207689_10399042
468 Ga0207689_10610727
469 Ga0207679_10661277
470 Ga0207679_10694169
471 Ga0207651_10007504
472 Ga0207712_10111559
473 Ga0207712_11912717
474 Ga0207658_10363059
475 Ga0207677_10584444
476 Ga0207703_11871428
477 Ga0207639_10101359
478 Ga0207678_10247289
479 Ga0207678_11387883
480 Ga0207708_10009307
481 Ga0207641_10348427
482 Ga0207648_10014447
483 Ga0207648_10272010
484 Ga0207648_11281466
485 Ga0207674_10363954
486 Ga0207674_10473272
487 Ga0207675_100076311
488 Ga0207675_101309677
489 Ga0207683_10623198
490 Ga0209966_1056857
491 Ga0209813_10360540
492 Ga0209974_10043204
493 Ga0268266_11186136
494 Ga0268264_12361411
495 Ga0307408_100714977
496 Ga0307405_11917713
497 Ga0307413_10084968
498 Ga0307406_10021983
499 Ga0307407_10137661
500 Ga0307407_10639196
501 Ga0307407_11057722
502 Ga0307412_10126491
503 Ga0307409_100113908
504 Ga0307409_101294205
505 Ga0307409_101496260
506 Ga0307416_100073165
507 Ga0307416_100289751
508 Ga0307416_101308997
509 Ga0307414_10405924
510 Ga0307414_11784053
511 Ga0307411_10134999
512 Ga0307411_10195201
513 Ga0307411_10634606
514 Ga0307411_10914468
515 Ga0307411_11324571
516 Ga0307415_102040204
517 Ga0373944_0386107
518 Ga0373949_0050421
519 Ga0373949_0305988
520 Ga0373952_0047085
521 Ga0373945_0285165
522 Ga0373960_0055710
523 Ga0373943_0033558
524 Ga0373943_0311753
525 Ga0373961_0158836
526 Ga0373931_0144292
527 Ga0373935_0187834
528 Ga0373947_0233845
529 Ga0373925_0002370
530 Ga0395900_0917180
531 Ga0439433_0028481
532 Ga0439449_0092031
533 Ga0439434_0098866
534 Ga0450918_042398
535 Ga0451576_0399432
536 Ga0451576_1630953
537 Ga0495603_0160471
538 Ga0495629_0035207
539 Ga0495594_0646622
540 Ga0495586_0422684
541 Ga0495622_0274384
542 Ga0495656_0176076
543 Ga0495671_0393461
544 Ga0496100_0842959
545 Ga0496102_0668348
546 Ga0496103_0679583
547 Ga0496106_0079544
548 Ga0496107_0346690
549 Ga0496112_0100759
550 Ga0496112_0196272
551 Ga0496113_0391182
552 Ga0496114_0372442
553 Ga0501031_0037733
554 Ga0501032_0350545
555 Ga0501033_0729380
556 Ga0501036_0455620
557 Ga0501040_0827222
558 Ga0501040_1202547
559 Ga0501041_0115289
560 Ga0501041_0173244
561 Ga0501046_0141927
562 Ga0501048_0116349
563 Ga0501048_1357746
564 Ga0501069_0043581
565 Ga0501071_0006809
566 Ga0501071_0465035
567 Ga0501071_1344853
568 Ga0501072_0038560
569 Ga0501072_0087245
570 Ga0501072_1191353
571 Ga0501074_0622390
572 Ga0501075_0020558
573 Ga0501075_0091234
574 Ga0501075_0505127
575 Ga0501076_0085798
576 Ga0501076_0088920
577 Ga0501077_0152659
578 Ga0501235_091880
579 Ga0501221_101706
580 Ga0501079_0556354
581 Ga0501079_0650456
582 Ga0501080_0229812
583 Ga0501080_0557586
584 Ga0501263_093934
585 Ga0501045_0116058
586 Ga0501045_0188460
587 nmdc:mga03683_1732_c1
588 nmdc:mga00v17_18773_c1
589 nmdc:mga00v17_474399_c1
590 nmdc:mga00v17_596_c1
591 nmdc:mga0yw44_100084_c1
592 nmdc:mga0yw44_124840_c1
593 nmdc:mga0yw44_16636_c1
594 nmdc:mga0k408_13946_c1
595 nmdc:mga0k408_20683_c1
596 nmdc:mga06z11_13242_c1
597 nmdc:mga06z11_5666_c1
598 nmdc:mga04h51_395539_c1
599 nmdc:mga07m45_33768_c1
600 nmdc:mga05p37_158_c1
601 nmdc:mga0qj67_749115_c1
602 nmdc:mga0n895_200934_c1
603 nmdc:mga0n895_741041_c1
604 nmdc:mga0rr50_1208565_c1
605 nmdc:mga0rr50_22887_c1
606 nmdc:mga0a205_203439_c1
607 Ga0500628_062234
608 Ga0590071_012382
609 Ga0590071_086984
610 Ga0590074_034584
611 Ga0590075_118262
612 Ga0590077_096238
613 Ga0501082_0158385
614 Ga0530510_0265663

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

64

0.94

PF08534

Redoxin

Redoxin

1

83

0.85

Map