F399182

General Info

Members Datasets Scaffolds Average Seq Length
307 225 614 72

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10993887|Ga0105246_109938872
Length 82
Sequence MRECEPVEETMAESVYKVIELVGTSSESWEKAAKTAVEHAAKSLRDLRVAEVVQQDLVIEDGKVMAYRTKVNVSFKYEESKG

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
52 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
119 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
122 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
123 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
124 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
125 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
126 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
127 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
128 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.96
Nodule 0
Rhizoplane 2.61
Rhizosphere 80.46
Stem 0
Stem Tuber 0
Unclassified 15.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10993887 3300011119 Unclassified 759
2 JGI25407J50210_10002735 3300003373 Bacteria 4193
3 JGI25407J50210_10010065 3300003373 Bacteria 2403
4 Ga0055531_10004807 3300003794 Bacteria 8067
5 Ga0070676_11591484 3300005328 Bacteria 505
6 Ga0068869_101402329 3300005334 Unclassified 618
7 Ga0070691_10036144 3300005341 Bacteria 2327
8 Ga0070668_101473534 3300005347 Bacteria 622
9 Ga0070700_100255855 3300005441 Bacteria 1258
10 Ga0070694_100452851 3300005444 Bacteria 1014
11 Ga0070685_11134940 3300005466 Bacteria 592
12 Ga0070699_101251619 3300005518 Bacteria 681
13 Ga0070697_101099250 3300005536 Bacteria 708
14 Ga0070686_101469924 3300005544 Bacteria 573
15 Ga0070695_100051053 3300005545 Bacteria 2652
16 Ga0070695_101167813 3300005545 Unclassified 632
17 Ga0070665_100717693 3300005548 Bacteria 1013
18 Ga0070704_102162780 3300005549 Bacteria 517
19 Ga0068857_102504384 3300005577 Bacteria 507
20 Ga0068864_102291219 3300005618 Bacteria 546
21 Ga0068866_10851032 3300005718 Unclassified 638
22 Ga0068861_100168821 3300005719 Bacteria 1812
23 Ga0068861_101864075 3300005719 Bacteria 598
24 Ga0068858_101032563 3300005842 Bacteria 806
25 Ga0068858_101730463 3300005842 Unclassified 617
26 Ga0068862_100010099 3300005844 Bacteria 7793
27 Ga0068862_100119028 3300005844 Unclassified 2326
28 Ga0081455_10004403 3300005937 Bacteria 15827
29 Ga0081455_10939982 3300005937 Unclassified 536
30 Ga0081538_10002838 3300005981 Bacteria 16566
31 Ga0081538_10003755 3300005981 Bacteria 14214
32 Ga0081538_10040576 3300005981 Bacteria 2967
33 Ga0081538_10040898 3300005981 Bacteria 2950
34 Ga0081540_1214448 3300005983 Bacteria 690
35 Ga0075365_10229723 3300006038 Bacteria 1302
36 Ga0075365_10284049 3300006038 Bacteria 1164
37 Ga0075368_10239341 3300006042 Bacteria 774
38 Ga0075363_100090489 3300006048 Bacteria 1683
39 Ga0075363_100773523 3300006048 Bacteria 583
40 Ga0075364_10951139 3300006051 Bacteria 584
41 Ga0070715_10391271 3300006163 Unclassified 770
42 Ga0070712_100235639 3300006175 Bacteria 1456
43 Ga0075362_10004281 3300006177 Bacteria 5102
44 Ga0075362_10027749 3300006177 Bacteria 2425
45 Ga0075362_10325181 3300006177 Bacteria 766
46 Ga0075362_10579549 3300006177 Bacteria 578
47 Ga0075367_10051098 3300006178 Bacteria 2443
48 Ga0075367_10178066 3300006178 Bacteria 1325
49 Ga0075369_10001745 3300006186 Bacteria 7535
50 Ga0075370_10088386 3300006353 Bacteria 1786
51 Ga0075428_100308623 3300006844 Bacteria 1701
52 Ga0075431_100657489 3300006847 Bacteria 1028
53 Ga0075433_10215715 3300006852 Bacteria 1705
54 Ga0075434_101538932 3300006871 Unclassified 674
55 Ga0075434_101800220 3300006871 Unclassified 619
56 Ga0075429_100396303 3300006880 Bacteria 1209
57 Ga0075429_100625511 3300006880 Bacteria 943
58 Ga0068865_100967121 3300006881 Bacteria 744
59 Ga0068865_101047925 3300006881 Unclassified 716
60 Ga0105240_10021842 3300009093 Bacteria 8503
61 Ga0111539_10575016 3300009094 Bacteria 1312
62 Ga0111539_10972297 3300009094 Bacteria 987
63 Ga0105245_11133344 3300009098 Bacteria 829
64 Ga0105247_11553603 3300009101 Bacteria 542
65 Ga0105247_11564778 3300009101 Bacteria 540
66 Ga0114129_10959168 3300009147 Bacteria 1080
67 Ga0105242_11671654 3300009176 Bacteria 672
68 Ga0105248_11094649 3300009177 Bacteria 901
69 Ga0105238_10877974 3300009551 Unclassified 915
70 Ga0105249_11025314 3300009553 Bacteria 894
71 Ga0105030_128306 3300009987 Unclassified 517
72 Ga0105035_104242 3300009988 Bacteria 1132
73 Ga0105239_13181566 3300010375 Unclassified 535
74 Ga0105246_10409403 3300011119 Bacteria 1128
75 Ga0105246_10890912 3300011119 Bacteria 797
76 Ga0163162_10348324 3300013306 Unclassified 1614
77 Ga0163162_10613490 3300013306 Bacteria 1213
78 Ga0163162_12654939 3300013306 Bacteria 576
79 Ga0157380_11394323 3300014326 Bacteria 751
80 Ga0157380_12835249 3300014326 Unclassified 551
81 Ga0157377_10173863 3300014745 Bacteria 1349
82 Ga0157379_12287387 3300014968 Bacteria 538
83 Ga0163161_10038928 3300017792 Bacteria 3411
84 Ga0213872_10341347 3300021361 Bacteria 616
85 Ga0213876_10099778 3300021384 Bacteria 1539
86 Ga0213871_10183621 3300021441 Unclassified 647
87 Ga0224712_10439031 3300022467 Bacteria 626
88 Ga0209758_1000060 3300025297 Bacteria 324326
89 Ga0209758_1016000 3300025297 Bacteria 3838
90 Ga0209050_1007616 3300025298 Bacteria 6014
91 Ga0207426_1046221 3300025302 Bacteria 1319
92 Ga0209257_1001302 3300025304 Bacteria 30372
93 Ga0209257_1094798 3300025304 Unclassified 738
94 Ga0207710_10748969 3300025900 Bacteria 513
95 Ga0207685_10095906 3300025905 Bacteria 1259
96 Ga0207695_10030745 3300025913 Bacteria 5908
97 Ga0207693_10159406 3300025915 Bacteria 1775
98 Ga0207663_10760870 3300025916 Bacteria 770
99 Ga0207687_10670606 3300025927 Bacteria 878
100 Ga0207709_11576398 3300025935 Bacteria 545
101 Ga0207704_10568774 3300025938 Bacteria 923
102 Ga0207704_10859107 3300025938 Bacteria 761
103 Ga0207665_10906978 3300025939 Bacteria 699
104 Ga0207689_10434760 3300025942 Bacteria 1096
105 Ga0207689_11053995 3300025942 Unclassified 686
106 Ga0207668_10999273 3300025972 Bacteria 748
107 Ga0207708_10627979 3300026075 Bacteria 912
108 Ga0207674_11168434 3300026116 Unclassified 739
109 Ga0207675_100208640 3300026118 Bacteria 1878
110 Ga0207675_100322899 3300026118 Unclassified 1507
111 Ga0207675_100453675 3300026118 Bacteria 1271
112 Ga0207428_10310222 3300027907 Unclassified 1166
113 Ga0207428_10512953 3300027907 Bacteria 870
114 Ga0268266_11051045 3300028379 Bacteria 788
115 Ga0268265_10128770 3300028380 Unclassified 2099
116 Ga0268265_10437471 3300028380 Unclassified 1218
117 Ga0307408_100167759 3300031548 Bacteria 1750
118 Ga0307508_10225615 3300031616 Bacteria 1472
119 Ga0316578_10007155 3300031728 Bacteria 5572
120 Ga0316578_10648538 3300031728 Bacteria 617
121 Ga0307405_10010538 3300031731 Bacteria 4798
122 Ga0307413_10715176 3300031824 Bacteria 833
123 Ga0307413_10866746 3300031824 Bacteria 764
124 Ga0307410_10050192 3300031852 Bacteria 2804
125 Ga0307406_10328835 3300031901 Bacteria 1185
126 Ga0307406_10430813 3300031901 Bacteria 1053
127 Ga0307407_10027017 3300031903 Bacteria 3048
128 Ga0307412_10033347 3300031911 Bacteria 3272
129 Ga0307409_100390183 3300031995 Bacteria 1326
130 Ga0307416_100152378 3300032002 Bacteria 2122
131 Ga0307416_100816571 3300032002 Bacteria 1029
132 Ga0307414_10994174 3300032004 Bacteria 772
133 Ga0307411_10049930 3300032005 Bacteria 2722
134 Ga0307411_11034988 3300032005 Bacteria 737
135 Ga0307415_100047800 3300032126 Bacteria 2882
136 Ga0307415_100506135 3300032126 Bacteria 1057
137 Ga0307415_101457604 3300032126 Unclassified 653
138 Ga0307415_102221979 3300032126 Unclassified 537
139 Ga0307415_102565890 3300032126 Archaea 502
140 Ga0373944_0017802 3300035089 Bacteria 2022
141 Ga0373945_0019256 3300035116 Bacteria 2329
142 Ga0373943_0006446 3300035170 Bacteria 5271
143 Ga0373955_0376584 3300035172 Bacteria 861
144 Ga0373931_0743060 3300035691 Bacteria 651
145 Ga0373935_0012021 3300035692 Bacteria 5203
146 Ga0373927_0004807 3300035695 Bacteria 9393
147 Ga0373947_0088722 3300035725 Bacteria 1925
148 Ga0373937_0162649 3300036401 Bacteria 2093
149 Ga0373937_2056310 3300036401 Unclassified 517
150 Ga0316582_0431050 3300036647 Bacteria 909
151 Ga0316584_0005089 3300036712 Bacteria 8771
152 Ga0373925_0015933 3300037068 Bacteria 5441
153 Ga0436365_0324807 3300039437 Bacteria 5639
154 Ga0436360_0446539 3300039438 Bacteria 4260
155 Ga0436360_0449042 3300039438 Bacteria 547
156 Ga0436360_0886966 3300039438 Bacteria 2159
157 Ga0436360_1179203 3300039438 Unclassified 620
158 Ga0436360_1335153 3300039438 Bacteria 2069
159 Ga0436361_0771143 3300039447 Bacteria 2018
160 Ga0436361_0871663 3300039447 Bacteria 1907
161 Ga0436362_0563551 3300039453 Bacteria 589
162 Ga0436362_0942921 3300039453 Bacteria 1263
163 Ga0436362_1112296 3300039453 Bacteria 937
164 Ga0439443_000466 3300042003 Bacteria 3586
165 Ga0439448_0001402 3300042005 Bacteria 6211
166 Ga0439432_145375 3300042006 Bacteria 697
167 Ga0439450_000457 3300042008 Bacteria 5296
168 Ga0439450_022489 3300042008 Bacteria 1362
169 Ga0439454_020743 3300042011 Bacteria 966
170 Ga0439455_0004618 3300042012 Bacteria 2743
171 Ga0439455_0091610 3300042012 Bacteria 834
172 Ga0439463_001832 3300042016 Bacteria 5519
173 Ga0450914_000103 3300042118 Bacteria 2660
174 Ga0450915_015907 3300042119 Bacteria 569
175 Ga0450898_014905 3300042134 Bacteria 1312
176 Ga0450900_003443 3300042136 Bacteria 1758
177 Ga0450902_028555 3300042137 Bacteria 936
178 Ga0450902_040362 3300042137 Bacteria 794
179 Ga0450904_009138 3300042139 Bacteria 976
180 Ga0450905_021369 3300042142 Unclassified 956
181 Ga0450910_013271 3300042147 Bacteria 1198
182 Ga0439458_0016105 3300042157 Bacteria 1699
183 Ga0439458_0039845 3300042157 Bacteria 1137
184 Ga0439458_0113928 3300042157 Bacteria 709
185 Ga0439435_0210425 3300042436 Unclassified 644
186 Ga0439444_0000501 3300042437 Bacteria 4392
187 Ga0439459_0103231 3300042438 Unclassified 700
188 Ga0439464_0000611 3300042439 Bacteria 7548
189 Ga0439460_0003741 3300042461 Bacteria 3681
190 Ga0439440_0000173 3300042993 Bacteria 9820
191 Ga0439440_0062229 3300042993 Bacteria 955
192 Ga0439440_0109458 3300042993 Unclassified 759
193 Ga0439440_0275595 3300042993 Unclassified 518
194 Ga0495603_0000790 3300046455 Bacteria 18066
195 Ga0495590_0253045 3300046457 Bacteria 656
196 Ga0495629_0001711 3300046459 Bacteria 17228
197 Ga0495641_0004234 3300046461 Bacteria 10272
198 Ga0495580_0000341 3300046472 Bacteria 38098
199 Ga0495582_0000352 3300046473 Bacteria 25196
200 Ga0495639_0001715 3300046475 Bacteria 9736
201 Ga0495662_0620217 3300046476 Unclassified 529
202 Ga0495594_0000049 3300046499 Bacteria 52677
203 Ga0495666_0031296 3300046526 Bacteria 2607
204 Ga0495665_0008693 3300046531 Bacteria 5512
205 Ga0495622_0001478 3300046557 Bacteria 11812
206 Ga0495634_0005192 3300046642 Bacteria 10058
207 Ga0495588_0001175 3300046674 Bacteria 11270
208 Ga0495657_0386875 3300046675 Bacteria 825
209 Ga0495647_0018331 3300046681 Bacteria 2490
210 Ga0495658_0001568 3300046683 Bacteria 11931
211 Ga0495613_0000244 3300046689 Bacteria 51563
212 Ga0495624_0598275 3300046690 Bacteria 657
213 Ga0495581_0002291 3300047315 Bacteria 10775
214 Ga0495676_0014209 3300047321 Bacteria 7129
215 Ga0495680_0052036 3300047322 Bacteria 3194
216 Ga0495684_0294831 3300047471 Unclassified 1166
217 Ga0495686_0000134 3300047472 Bacteria 149997
218 Ga0495686_0175987 3300047472 Bacteria 1242
219 Ga0495686_0470564 3300047472 Bacteria 665
220 Ga0495593_0000405 3300047673 Bacteria 23980
221 Ga0495602_0983391 3300048088 Unclassified 558
222 Ga0495614_0002245 3300048089 Bacteria 8575
223 Ga0496103_0483762 3300048906 Unclassified 793
224 Ga0496106_0984563 3300048909 Unclassified 664
225 Ga0496108_0911824 3300048911 Bacteria 754
226 Ga0496109_1859179 3300048912 Unclassified 535
227 Ga0496110_1351252 3300048913 Unclassified 622
228 Ga0496111_1321670 3300048914 Unclassified 507
229 Ga0496114_1079292 3300048917 Bacteria 687
230 Ga0496115_1319109 3300048918 Unclassified 537
231 Ga0501037_0733709 3300049573 Bacteria 655
232 Ga0501037_0765664 3300049573 Bacteria 639
233 Ga0501038_0634133 3300049574 Bacteria 806
234 Ga0501039_0464566 3300049575 Bacteria 994
235 Ga0501040_0128754 3300049576 Bacteria 1779
236 Ga0501041_0160898 3300049577 Bacteria 1404
237 Ga0501042_0138577 3300049578 Bacteria 1754
238 Ga0501043_1179256 3300049579 Bacteria 538
239 Ga0501046_0108393 3300049580 Bacteria 2124
240 Ga0501047_0880529 3300049581 Unclassified 709
241 Ga0501048_1367541 3300049582 Unclassified 509
242 Ga0501071_0487886 3300049587 Bacteria 945
243 Ga0501071_1587269 3300049587 Bacteria 505
244 Ga0501072_0967441 3300049588 Bacteria 664
245 Ga0501072_1369372 3300049588 Unclassified 548
246 Ga0501073_0056900 3300049589 Bacteria 2734
247 Ga0501073_1034438 3300049589 Bacteria 565
248 Ga0501074_1212958 3300049590 Unclassified 529
249 Ga0501075_0624328 3300049591 Bacteria 822
250 Ga0501076_1709055 3300049592 Bacteria 516
251 Ga0501077_0057183 3300049593 Bacteria 2477
252 Ga0501079_0064890 3300049741 Bacteria 2817
253 Ga0501079_0454587 3300049741 Bacteria 1006
254 Ga0501080_1806329 3300049742 Bacteria 513
255 Ga0501081_0120043 3300049743 Bacteria 1872
256 Ga0501083_0217266 3300049744 Bacteria 1246
257 Ga0501035_0067911 3300049822 Bacteria 3162
258 Ga0501044_0862938 3300049823 Bacteria 781
259 Ga0501045_0081665 3300049824 Bacteria 2384
260 nmdc:mga03683_2681_c1 3300050489 Bacteria 5577
261 nmdc:mga03683_308590_c1 3300050489 Bacteria 743
262 nmdc:mga03683_64005_c1 3300050489 Bacteria 1560
263 nmdc:mga03n38_418071_c1 3300050490 Bacteria 741
264 nmdc:mga00v17_163821_c2 3300050491 Bacteria 828
265 nmdc:mga0yw44_416105_c1 3300050492 Bacteria 910
266 nmdc:mga0yw44_626653_c1 3300050492 Bacteria 731
267 nmdc:mga0yw44_697307_c1 3300050492 Bacteria 690
268 nmdc:mga0k408_681690_c1 3300050493 Bacteria 603
269 nmdc:mga06z11_1022541_c1 3300050494 Bacteria 504
270 nmdc:mga06z11_134210_c1 3300050494 Bacteria 1393
271 nmdc:mga06z11_489294_c1 3300050494 Bacteria 745
272 nmdc:mga07m45_27653_c3 3300050496 Bacteria 1810
273 nmdc:mga05p37_580134_c1 3300050507 Bacteria 1270
274 nmdc:mga09592_1270937_c1 3300050508 Unclassified 606
275 nmdc:mga06r32_645467_c1 3300050510 Bacteria 1027
276 nmdc:mga08y16_1060188_c1 3300050511 Bacteria 787
277 nmdc:mga08y16_609525_c1 3300050511 Bacteria 1100
278 nmdc:mga08y16_703556_c1 3300050511 Bacteria 1010
279 nmdc:mga08y16_813623_c1 3300050511 Bacteria 926
280 nmdc:mga0n895_1971284_c1 3300050512 Unclassified 542
281 nmdc:mga0a205_1181853_c1 3300050515 Bacteria 613
282 nmdc:mga0a205_259889_c1 3300050515 Bacteria 1614
283 nmdc:mga0sz30_155_c1 3300050516 Bacteria 11831
284 nmdc:mga0sz30_395480_c1 3300050516 Bacteria 619
285 Ga0495595_0052500 3300053084 Bacteria 1892
286 Ga0495619_0006851 3300053085 Bacteria 7204
287 Ga0500583_0537579 3300053092 Bacteria 545
288 Ga0500651_0098292 3300053093 Bacteria 1797
289 Ga0500651_0256922 3300053093 Bacteria 1014
290 Ga0500651_0281329 3300053093 Bacteria 959
291 Ga0500651_0722509 3300053093 Bacteria 531
292 Ga0500641_0013155 3300053096 Bacteria 3037
293 Ga0500556_0094169 3300053104 Bacteria 1147
294 Ga0500642_0458281 3300053130 Bacteria 546
295 Ga0500577_0034745 3300053142 Bacteria 1793
296 Ga0500577_0065262 3300053142 Unclassified 1412
297 Ga0500588_0020123 3300053146 Bacteria 1785
298 Ga0500616_0001687 3300053153 Bacteria 20336
299 Ga0500616_0006273 3300053153 Bacteria 7822
300 Ga0501084_1646973 3300054114 Bacteria 536
301 Ga0590074_003008 3300059423 Bacteria 2783
302 Ga0590075_014929 3300059424 Bacteria 1902
303 Ga0590077_004290 3300059426 Bacteria 2934
304 Ga0587111_0001489 3300060346 Bacteria 2833
305 Ga0501082_0578481 3300060353 Bacteria 983
306 Ga0530510_0099880 3300061734 Bacteria 2122
307 Ga0530510_1045950 3300061734 Bacteria 625
308 Ga0105246_10993887
309 JGI25407J50210_10002735
310 JGI25407J50210_10010065
311 Ga0055531_10004807
312 Ga0070676_11591484
313 Ga0068869_101402329
314 Ga0070691_10036144
315 Ga0070668_101473534
316 Ga0070700_100255855
317 Ga0070694_100452851
318 Ga0070685_11134940
319 Ga0070699_101251619
320 Ga0070697_101099250
321 Ga0070686_101469924
322 Ga0070695_100051053
323 Ga0070695_101167813
324 Ga0070665_100717693
325 Ga0070704_102162780
326 Ga0068857_102504384
327 Ga0068864_102291219
328 Ga0068866_10851032
329 Ga0068861_100168821
330 Ga0068861_101864075
331 Ga0068858_101032563
332 Ga0068858_101730463
333 Ga0068862_100010099
334 Ga0068862_100119028
335 Ga0081455_10004403
336 Ga0081455_10939982
337 Ga0081538_10002838
338 Ga0081538_10003755
339 Ga0081538_10040576
340 Ga0081538_10040898
341 Ga0081540_1214448
342 Ga0075365_10229723
343 Ga0075365_10284049
344 Ga0075368_10239341
345 Ga0075363_100090489
346 Ga0075363_100773523
347 Ga0075364_10951139
348 Ga0070715_10391271
349 Ga0070712_100235639
350 Ga0075362_10004281
351 Ga0075362_10027749
352 Ga0075362_10325181
353 Ga0075362_10579549
354 Ga0075367_10051098
355 Ga0075367_10178066
356 Ga0075369_10001745
357 Ga0075370_10088386
358 Ga0075428_100308623
359 Ga0075431_100657489
360 Ga0075433_10215715
361 Ga0075434_101538932
362 Ga0075434_101800220
363 Ga0075429_100396303
364 Ga0075429_100625511
365 Ga0068865_100967121
366 Ga0068865_101047925
367 Ga0105240_10021842
368 Ga0111539_10575016
369 Ga0111539_10972297
370 Ga0105245_11133344
371 Ga0105247_11553603
372 Ga0105247_11564778
373 Ga0114129_10959168
374 Ga0105242_11671654
375 Ga0105248_11094649
376 Ga0105238_10877974
377 Ga0105249_11025314
378 Ga0105030_128306
379 Ga0105035_104242
380 Ga0105239_13181566
381 Ga0105246_10409403
382 Ga0105246_10890912
383 Ga0163162_10348324
384 Ga0163162_10613490
385 Ga0163162_12654939
386 Ga0157380_11394323
387 Ga0157380_12835249
388 Ga0157377_10173863
389 Ga0157379_12287387
390 Ga0163161_10038928
391 Ga0213872_10341347
392 Ga0213876_10099778
393 Ga0213871_10183621
394 Ga0224712_10439031
395 Ga0209758_1000060
396 Ga0209758_1016000
397 Ga0209050_1007616
398 Ga0207426_1046221
399 Ga0209257_1001302
400 Ga0209257_1094798
401 Ga0207710_10748969
402 Ga0207685_10095906
403 Ga0207695_10030745
404 Ga0207693_10159406
405 Ga0207663_10760870
406 Ga0207687_10670606
407 Ga0207709_11576398
408 Ga0207704_10568774
409 Ga0207704_10859107
410 Ga0207665_10906978
411 Ga0207689_10434760
412 Ga0207689_11053995
413 Ga0207668_10999273
414 Ga0207708_10627979
415 Ga0207674_11168434
416 Ga0207675_100208640
417 Ga0207675_100322899
418 Ga0207675_100453675
419 Ga0207428_10310222
420 Ga0207428_10512953
421 Ga0268266_11051045
422 Ga0268265_10128770
423 Ga0268265_10437471
424 Ga0307408_100167759
425 Ga0307508_10225615
426 Ga0316578_10007155
427 Ga0316578_10648538
428 Ga0307405_10010538
429 Ga0307413_10715176
430 Ga0307413_10866746
431 Ga0307410_10050192
432 Ga0307406_10328835
433 Ga0307406_10430813
434 Ga0307407_10027017
435 Ga0307412_10033347
436 Ga0307409_100390183
437 Ga0307416_100152378
438 Ga0307416_100816571
439 Ga0307414_10994174
440 Ga0307411_10049930
441 Ga0307411_11034988
442 Ga0307415_100047800
443 Ga0307415_100506135
444 Ga0307415_101457604
445 Ga0307415_102221979
446 Ga0307415_102565890
447 Ga0373944_0017802
448 Ga0373945_0019256
449 Ga0373943_0006446
450 Ga0373955_0376584
451 Ga0373931_0743060
452 Ga0373935_0012021
453 Ga0373927_0004807
454 Ga0373947_0088722
455 Ga0373937_0162649
456 Ga0373937_2056310
457 Ga0316582_0431050
458 Ga0316584_0005089
459 Ga0373925_0015933
460 Ga0436365_0324807
461 Ga0436360_0446539
462 Ga0436360_0449042
463 Ga0436360_0886966
464 Ga0436360_1179203
465 Ga0436360_1335153
466 Ga0436361_0771143
467 Ga0436361_0871663
468 Ga0436362_0563551
469 Ga0436362_0942921
470 Ga0436362_1112296
471 Ga0439443_000466
472 Ga0439448_0001402
473 Ga0439432_145375
474 Ga0439450_000457
475 Ga0439450_022489
476 Ga0439454_020743
477 Ga0439455_0004618
478 Ga0439455_0091610
479 Ga0439463_001832
480 Ga0450914_000103
481 Ga0450915_015907
482 Ga0450898_014905
483 Ga0450900_003443
484 Ga0450902_028555
485 Ga0450902_040362
486 Ga0450904_009138
487 Ga0450905_021369
488 Ga0450910_013271
489 Ga0439458_0016105
490 Ga0439458_0039845
491 Ga0439458_0113928
492 Ga0439435_0210425
493 Ga0439444_0000501
494 Ga0439459_0103231
495 Ga0439464_0000611
496 Ga0439460_0003741
497 Ga0439440_0000173
498 Ga0439440_0062229
499 Ga0439440_0109458
500 Ga0439440_0275595
501 Ga0495603_0000790
502 Ga0495590_0253045
503 Ga0495629_0001711
504 Ga0495641_0004234
505 Ga0495580_0000341
506 Ga0495582_0000352
507 Ga0495639_0001715
508 Ga0495662_0620217
509 Ga0495594_0000049
510 Ga0495666_0031296
511 Ga0495665_0008693
512 Ga0495622_0001478
513 Ga0495634_0005192
514 Ga0495588_0001175
515 Ga0495657_0386875
516 Ga0495647_0018331
517 Ga0495658_0001568
518 Ga0495613_0000244
519 Ga0495624_0598275
520 Ga0495581_0002291
521 Ga0495676_0014209
522 Ga0495680_0052036
523 Ga0495684_0294831
524 Ga0495686_0000134
525 Ga0495686_0175987
526 Ga0495686_0470564
527 Ga0495593_0000405
528 Ga0495602_0983391
529 Ga0495614_0002245
530 Ga0496103_0483762
531 Ga0496106_0984563
532 Ga0496108_0911824
533 Ga0496109_1859179
534 Ga0496110_1351252
535 Ga0496111_1321670
536 Ga0496114_1079292
537 Ga0496115_1319109
538 Ga0501037_0733709
539 Ga0501037_0765664
540 Ga0501038_0634133
541 Ga0501039_0464566
542 Ga0501040_0128754
543 Ga0501041_0160898
544 Ga0501042_0138577
545 Ga0501043_1179256
546 Ga0501046_0108393
547 Ga0501047_0880529
548 Ga0501048_1367541
549 Ga0501071_0487886
550 Ga0501071_1587269
551 Ga0501072_0967441
552 Ga0501072_1369372
553 Ga0501073_0056900
554 Ga0501073_1034438
555 Ga0501074_1212958
556 Ga0501075_0624328
557 Ga0501076_1709055
558 Ga0501077_0057183
559 Ga0501079_0064890
560 Ga0501079_0454587
561 Ga0501080_1806329
562 Ga0501081_0120043
563 Ga0501083_0217266
564 Ga0501035_0067911
565 Ga0501044_0862938
566 Ga0501045_0081665
567 nmdc:mga03683_2681_c1
568 nmdc:mga03683_308590_c1
569 nmdc:mga03683_64005_c1
570 nmdc:mga03n38_418071_c1
571 nmdc:mga00v17_163821_c2
572 nmdc:mga0yw44_416105_c1
573 nmdc:mga0yw44_626653_c1
574 nmdc:mga0yw44_697307_c1
575 nmdc:mga0k408_681690_c1
576 nmdc:mga06z11_1022541_c1
577 nmdc:mga06z11_134210_c1
578 nmdc:mga06z11_489294_c1
579 nmdc:mga07m45_27653_c3
580 nmdc:mga05p37_580134_c1
581 nmdc:mga09592_1270937_c1
582 nmdc:mga06r32_645467_c1
583 nmdc:mga08y16_1060188_c1
584 nmdc:mga08y16_609525_c1
585 nmdc:mga08y16_703556_c1
586 nmdc:mga08y16_813623_c1
587 nmdc:mga0n895_1971284_c1
588 nmdc:mga0a205_1181853_c1
589 nmdc:mga0a205_259889_c1
590 nmdc:mga0sz30_155_c1
591 nmdc:mga0sz30_395480_c1
592 Ga0495595_0052500
593 Ga0495619_0006851
594 Ga0500583_0537579
595 Ga0500651_0098292
596 Ga0500651_0256922
597 Ga0500651_0281329
598 Ga0500651_0722509
599 Ga0500641_0013155
600 Ga0500556_0094169
601 Ga0500642_0458281
602 Ga0500577_0034745
603 Ga0500577_0065262
604 Ga0500588_0020123
605 Ga0500616_0001687
606 Ga0500616_0006273
607 Ga0501084_1646973
608 Ga0590074_003008
609 Ga0590075_014929
610 Ga0590077_004290
611 Ga0587111_0001489
612 Ga0501082_0578481
613 Ga0530510_0099880
614 Ga0530510_1045950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

15

78

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9611 3 67
2yj0-assembly1.cif.gz_A x-ray structure of chemically engineered mycobacterium tuberculosis dodecin 0.9505 2 67
6r1e-assembly1.cif.gz_A structure of dodecin from streptomyces coelicolor 0.9368 1 69
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9334 3 67
6ri3-assembly1.cif.gz_A dodecin from streptomyces davaonensis 0.9323 2 67
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9247 5 67 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9106 5 67 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8873 5 71 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8503 1 69 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8405 5 71 3.30.1660.10
ID Description Score Start End GO Terms
AF-A0A6L4YFD2-F1-model_v4 Transporter 0.9961 3 67
AF-A0A3M1TYH8-F1-model_v4 deleted 0.9957 2 67
AF-A0A536UTK4-F1-model_v4 Dodecin domain-containing protein 0.9945 2 67
AF-A0A069PJV5-F1-model_v4 Transporter 0.9938 5 67
AF-A0A2N7WVL4-F1-model_v4 Dodecin domain-containing protein 0.9937 3 67

Map