F398485

General Info

Members Datasets Scaffolds Average Seq Length
306 211 300 224

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100046423|Ga0070682_1000464233
Length 256
Sequence MNGARKSTRPHRYCKMGPFSSRFRRETFPPLWSQSRMTTPILLAWSGGKDCLLALQRLQADPAWQVVGLLTTLNRNYQRVAMHGVHREVLLAQTAALGLPLVEVLLDWPGSNEAYEEAHARAIRHCAFGDLFLEDVRDYRVRQLGRENWRAVFPLWGEDTAALSRRFVGEGHRAVLCCVDTGQLDAGFCGRDYDAGLLDALPAGVDPCGEHGEFHTLSYAGPLFRHPLRLRRGESVLRDGRFQYTDFLLDEHAGRA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
65 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
140 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
141 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
142 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 1.96
Isolates 1.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 4.58
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 7.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1003185 3300002737 Bacteria 5112
2 JGI25157J39369_1000860 3300002741 Bacteria 14747
3 JGI25164J39214_1000666 3300002772 Bacteria 14014
4 JGI25165J46597_1001865 3300003214 Bacteria 8677
5 Ga0055531_10001525 3300003794 Bacteria 16964
6 JGI25405J52794_10014097 3300003911 Bacteria 1558
7 Ga0070666_10000018 3300005335 Bacteria 187218
8 Ga0070682_100001177 3300005337 Bacteria 14919
9 Ga0070682_100046423 3300005337 Bacteria 2695
10 Ga0070682_100542506 3300005337 Bacteria 909
11 Ga0070660_100015354 3300005339 Bacteria 5527
12 Ga0070660_100036416 3300005339 Bacteria 3727
13 Ga0070660_100137148 3300005339 Bacteria 1961
14 Ga0070660_100170956 3300005339 Bacteria 1755
15 Ga0070692_10016178 3300005345 Bacteria 3544
16 Ga0070659_100009626 3300005366 Bacteria 7102
17 Ga0070659_100019817 3300005366 Bacteria 5105
18 Ga0070659_100411787 3300005366 Bacteria 1142
19 Ga0070667_100032024 3300005367 Bacteria 4384
20 Ga0070709_10059117 3300005434 Bacteria 2433
21 Ga0070714_100003062 3300005435 Bacteria 12403
22 Ga0070714_100012139 3300005435 Bacteria 6863
23 Ga0070714_100085598 3300005435 Bacteria 2753
24 Ga0070713_100008958 3300005436 Bacteria 7131
25 Ga0070710_10032219 3300005437 Bacteria 2838
26 Ga0070711_100193503 3300005439 Bacteria 1565
27 Ga0070694_100453854 3300005444 Bacteria 1012
28 Ga0070663_100082277 3300005455 Bacteria 2368
29 Ga0070663_100387920 3300005455 Bacteria 1139
30 Ga0070678_100117596 3300005456 Bacteria 2091
31 Ga0070662_100075947 3300005457 Bacteria 2489
32 Ga0070662_100161957 3300005457 Bacteria 1750
33 Ga0070681_10001351 3300005458 Bacteria 21429
34 Ga0070681_10011680 3300005458 Bacteria 8698
35 Ga0070681_10012180 3300005458 Bacteria 8529
36 Ga0070681_10030069 3300005458 Bacteria 5450
37 Ga0070679_100039017 3300005530 Bacteria 4721
38 Ga0068853_100143127 3300005539 Bacteria 2147
39 Ga0070686_100550046 3300005544 Bacteria 903
40 Ga0070695_100030884 3300005545 Bacteria 3337
41 Ga0070696_100001026 3300005546 Bacteria 18027
42 Ga0070696_100056484 3300005546 Bacteria 2738
43 Ga0070693_100137204 3300005547 Bacteria 1536
44 Ga0068857_100321602 3300005577 Bacteria 1429
45 Ga0068854_100003601 3300005578 Bacteria 9691
46 Ga0068854_100061134 3300005578 Bacteria 2727
47 Ga0068856_100000582 3300005614 Bacteria 39927
48 Ga0068858_100030289 3300005842 Bacteria 5025
49 Ga0068858_100048183 3300005842 Bacteria 3949
50 Ga0068860_100131093 3300005843 Bacteria 2406
51 Ga0081455_10000002 3300005937 Bacteria 460472
52 Ga0070712_100149691 3300006175 Bacteria 1791
53 Ga0070712_100351732 3300006175 Bacteria 1206
54 Ga0075367_10313655 3300006178 Bacteria 988
55 Ga0075435_100403206 3300007076 Bacteria 1176
56 Ga0105240_10046303 3300009093 Bacteria 5512
57 Ga0105240_10153191 3300009093 Bacteria 2744
58 Ga0105241_10035176 3300009174 Bacteria 3768
59 Ga0105241_10613653 3300009174 Bacteria 984
60 Ga0105237_10000675 3300009545 Bacteria 47159
61 Ga0105237_10104805 3300009545 Bacteria 2819
62 Ga0105238_10011992 3300009551 Bacteria 8731
63 Ga0105238_10139480 3300009551 Bacteria 2402
64 Ga0105238_10242673 3300009551 Bacteria 1779
65 Ga0157373_10011171 3300013100 Bacteria 6607
66 Ga0157373_10013418 3300013100 Bacteria 6010
67 Ga0157373_10175488 3300013100 Bacteria 1508
68 Ga0157371_10020571 3300013102 Bacteria 4856
69 Ga0157371_10091263 3300013102 Bacteria 2158
70 Ga0157370_10005510 3300013104 Bacteria 14184
71 Ga0157370_10020890 3300013104 Bacteria 6531
72 Ga0157370_10434714 3300013104 Bacteria 1207
73 Ga0157369_10017478 3300013105 Bacteria 8059
74 Ga0157369_10968677 3300013105 Bacteria 871
75 Ga0163162_10001986 3300013306 Bacteria 19222
76 Ga0157372_10070476 3300013307 Bacteria 3933
77 Ga0157372_10078548 3300013307 Bacteria 3729
78 Ga0157372_10187634 3300013307 Bacteria 2394
79 Ga0157372_10932971 3300013307 Bacteria 1006
80 Ga0157375_10004011 3300013308 Bacteria 12774
81 Ga0182008_10041423 3300014497 Bacteria 2297
82 Ga0182008_10065359 3300014497 Bacteria 1790
83 Ga0157376_10116460 3300014969 Unclassified 2361
84 Ga0182007_10020699 3300015262 Bacteria 2347
85 Ga0182007_10025723 3300015262 Bacteria 2047
86 Ga0183369_1007 3300015685 Bacteria 414878
87 Ga0163161_10055869 3300017792 Bacteria 2867
88 Ga0197907_10972301 3300020069 Bacteria 1451
89 Ga0206356_11478499 3300020070 Bacteria 5285
90 Ga0206354_11579420 3300020081 Bacteria 916
91 Ga0206353_11651424 3300020082 Bacteria 883
92 Ga0206353_11923352 3300020082 Bacteria 2583
93 Ga0228598_1002558 3300024227 Bacteria 3949
94 Ga0209674_102072 3300025226 Bacteria 4567
95 Ga0207427_100242 3300025231 Bacteria 43876
96 Ga0209437_100424 3300025233 Bacteria 37579
97 Ga0209646_1004407 3300025246 Bacteria 2570
98 Ga0209026_1000098 3300025250 Bacteria 161845
99 Ga0209026_1000274 3300025250 Bacteria 61312
100 Ga0209759_1008242 3300025256 Bacteria 3265
101 Ga0209233_1000667 3300025261 Bacteria 16571
102 Ga0209455_1000095 3300025272 Bacteria 217487
103 Ga0209257_1000613 3300025304 Bacteria 58070
104 Ga0207692_10027067 3300025898 Bacteria 2696
105 Ga0207680_10000002 3300025903 Bacteria 1018646
106 Ga0207647_10021560 3300025904 Bacteria 4300
107 Ga0207647_10049605 3300025904 Bacteria 2603
108 Ga0207705_10016407 3300025909 Bacteria 5310
109 Ga0207654_10096991 3300025911 Bacteria 1809
110 Ga0207654_10140154 3300025911 Bacteria 1541
111 Ga0207707_10003140 3300025912 Bacteria 14667
112 Ga0207707_10013804 3300025912 Bacteria 7045
113 Ga0207707_10089184 3300025912 Bacteria 2695
114 Ga0207707_10114280 3300025912 Bacteria 2359
115 Ga0207671_10001518 3300025914 Bacteria 26689
116 Ga0207693_10005281 3300025915 Bacteria 10797
117 Ga0207693_10057346 3300025915 Bacteria 3053
118 Ga0207693_10167475 3300025915 Bacteria 1730
119 Ga0207657_10057975 3300025919 Bacteria 3335
120 Ga0207657_10111058 3300025919 Bacteria 2264
121 Ga0207649_10254915 3300025920 Bacteria 1265
122 Ga0207652_10528315 3300025921 Bacteria 1061
123 Ga0207694_10079355 3300025924 Bacteria 2574
124 Ga0207694_10130122 3300025924 Bacteria 2017
125 Ga0207694_10272259 3300025924 Bacteria 1389
126 Ga0207687_10458450 3300025927 Bacteria 1058
127 Ga0207700_10058481 3300025928 Bacteria 2912
128 Ga0207700_10144494 3300025928 Bacteria 1959
129 Ga0207664_10001322 3300025929 Bacteria 16316
130 Ga0207664_10001329 3300025929 Bacteria 16293
131 Ga0207664_10152943 3300025929 Bacteria 1961
132 Ga0207690_10000747 3300025932 Bacteria 20984
133 Ga0207690_10002706 3300025932 Bacteria 10697
134 Ga0207690_10011239 3300025932 Bacteria 5346
135 Ga0207690_10012135 3300025932 Bacteria 5155
136 Ga0207706_10044623 3300025933 Bacteria 3929
137 Ga0207667_10111153 3300025949 Bacteria 2826
138 Ga0207640_10014885 3300025981 Bacteria 4488
139 Ga0207640_10584371 3300025981 Bacteria 943
140 Ga0207678_10003855 3300026067 Bacteria 13482
141 Ga0207678_10020281 3300026067 Bacteria 5833
142 Ga0207678_10111625 3300026067 Bacteria 2332
143 Ga0207678_10232214 3300026067 Bacteria 1579
144 Ga0207702_10000132 3300026078 Bacteria 88794
145 Ga0207702_10030356 3300026078 Bacteria 4504
146 Ga0207674_10251279 3300026116 Bacteria 1715
147 Ga0207683_10045994 3300026121 Bacteria 3818
148 Ga0268264_10122551 3300028381 Bacteria 2293
149 Ga0307517_10106765 3300028786 Bacteria 2163
150 Ga0265338_10007405 3300028800 Bacteria 13638
151 Ga0316178_1018064 3300030735 Unclassified 975
152 Ga0265760_10029915 3300031090 Bacteria 1603
153 Ga0265325_10003514 3300031241 Bacteria 10200
154 Ga0265325_10043772 3300031241 Bacteria 2334
155 Ga0265339_10000840 3300031249 Bacteria 23652
156 Ga0265331_10000683 3300031250 Bacteria 29096
157 Ga0265331_10069014 3300031250 Bacteria 1656
158 Ga0265327_10006545 3300031251 Bacteria 9268
159 Ga0265316_10095956 3300031344 Unclassified 2258
160 Ga0307513_10214592 3300031456 Bacteria 1752
161 Ga0265313_10001284 3300031595 Bacteria 23759
162 Ga0265314_10000280 3300031711 Bacteria 74157
163 Ga0265342_10006065 3300031712 Bacteria 9067
164 Ga0307412_10130575 3300031911 Bacteria 1824
165 Ga0307411_10876587 3300032005 Bacteria 796
166 Ga0307510_10005448 3300033180 Bacteria 15156
167 Ga0373926_0006289 3300035083 Bacteria 3941
168 Ga0373934_0047309 3300035086 Bacteria 1701
169 Ga0373940_0152636 3300035088 Bacteria 737
170 Ga0373939_0001436 3300035114 Bacteria 5768
171 Ga0373953_0017751 3300035117 Bacteria 2621
172 Ga0373954_0023778 3300035118 Bacteria 2790
173 Ga0373957_0002141 3300035120 Bacteria 5561
174 Ga0373957_0003303 3300035120 Bacteria 4752
175 Ga0373960_0076339 3300035121 Bacteria 1046
176 Ga0373946_0008610 3300035171 Bacteria 3744
177 Ga0373955_0004697 3300035172 Bacteria 6069
178 Ga0373924_0013167 3300035410 Bacteria 3104
179 Ga0373931_0053507 3300035691 Bacteria 2154
180 Ga0373935_0301510 3300035692 Bacteria 1132
181 Ga0373935_0514887 3300035692 Bacteria 870
182 Ga0373933_0003782 3300035724 Bacteria 8361
183 Ga0373937_0040611 3300036401 Bacteria 4240
184 Ga0395899_0003826 3300037312 Bacteria 11879
185 Ga0395900_0004191 3300037418 Bacteria 15313
186 Ga0395900_0418799 3300037418 Bacteria 1300
187 Ga0395900_0853110 3300037418 Bacteria 836
188 Ga0395898_0007440 3300037466 Bacteria 11622
189 Ga0395898_0068334 3300037466 Bacteria 3438
190 Ga0395898_0174857 3300037466 Bacteria 2052
191 Ga0395905_0025032 3300037471 Bacteria 5630
192 Ga0395905_0359159 3300037471 Unclassified 1349
193 Ga0436364_1542567 3300037853 Bacteria 898
194 Ga0395901_0001533 3300038443 Bacteria 23956
195 Ga0395901_0009999 3300038443 Bacteria 9614
196 Ga0395901_0015703 3300038443 Bacteria 7714
197 Ga0395901_0092671 3300038443 Bacteria 3162
198 Ga0395901_0206482 3300038443 Bacteria 2057
199 Ga0395901_0766941 3300038443 Bacteria 956
200 Ga0439436_0025742 3300041404 Bacteria 1727
201 Ga0451789_0349180 3300041443 Bacteria 894
202 Ga0451791_0842962 3300041451 Bacteria 4256
203 Ga0451791_1559139 3300041451 Bacteria 4670
204 Ga0451793_0235365 3300041452 Bacteria 1332
205 Ga0451797_0190356 3300041453 Bacteria 2245
206 Ga0451797_0426262 3300041453 Bacteria 2576
207 Ga0451795_0964377 3300041456 Bacteria 2865
208 Ga0451798_1102015 3300041458 Bacteria 1211
209 Ga0451802_0567867 3300041460 Bacteria 724
210 Ga0451807_1305026 3300041486 Bacteria 1176
211 Ga0451837_0400289 3300041494 Bacteria 1921
212 Ga0451841_0752102 3300041498 Bacteria 1424
213 Ga0451853_3423423 3300041512 Bacteria 785
214 Ga0466957_0102791 3300044842 Bacteria 1803
215 Ga0466967_0197277 3300045976 Bacteria 1905
216 Ga0466967_0391179 3300045976 Bacteria 1351
217 Ga0466967_0720987 3300045976 Bacteria 988
218 Ga0495592_0310178 3300046454 Bacteria 1023
219 Ga0495603_0322126 3300046455 Bacteria 887
220 Ga0495638_0025057 3300046460 Bacteria 3882
221 Ga0495651_0121001 3300046462 Bacteria 1923
222 Ga0495639_0049624 3300046475 Bacteria 1905
223 Ga0495662_0243172 3300046476 Bacteria 886
224 Ga0495664_0063548 3300046477 Bacteria 2200
225 Ga0495608_0031465 3300046511 Bacteria 3588
226 Ga0495618_0029096 3300046514 Bacteria 3445
227 Ga0495652_0235169 3300046529 Bacteria 1367
228 Ga0495665_0134747 3300046531 Bacteria 1292
229 Ga0495622_0119243 3300046557 Bacteria 1205
230 Ga0495667_0022402 3300046559 Bacteria 4255
231 Ga0495634_0219348 3300046642 Bacteria 1174
232 Ga0495588_0155649 3300046674 Bacteria 1208
233 Ga0495657_0037929 3300046675 Bacteria 3318
234 Ga0495647_0021210 3300046681 Bacteria 2337
235 Ga0495624_0074969 3300046690 Bacteria 2101
236 Ga0495600_0131291 3300046809 Bacteria 1628
237 Ga0495604_0555334 3300047317 Bacteria 740
238 Ga0495674_0021315 3300047319 Bacteria 5994
239 Ga0495676_0030084 3300047321 Bacteria 4615
240 Ga0495680_0062470 3300047322 Bacteria 2863
241 Ga0495593_0011526 3300047673 Bacteria 5075
242 Ga0495602_0030359 3300048088 Bacteria 5128
243 Ga0496101_0056241 3300048904 Bacteria 2844
244 Ga0496107_0016925 3300048910 Bacteria 5126
245 Ga0496115_0024993 3300048918 Bacteria 4647
246 Ga0496115_0045470 3300048918 Bacteria 3505
247 Ga0496122_0018231 3300048925 Bacteria 6500
248 Ga0496124_0134071 3300048927 Bacteria 1963
249 Ga0496126_0230341 3300048929 Bacteria 1552
250 Ga0501031_0317646 3300049568 Bacteria 1009
251 Ga0501032_0009136 3300049569 Bacteria 7193
252 Ga0501033_0002369 3300049570 Bacteria 16069
253 Ga0501034_0056650 3300049571 Bacteria 3943
254 Ga0501034_0380430 3300049571 Bacteria 1337
255 Ga0501034_0880016 3300049571 Bacteria 785
256 Ga0501036_0264737 3300049572 Bacteria 1440
257 Ga0501037_0026448 3300049573 Bacteria 4290
258 Ga0501037_0321065 3300049573 Bacteria 1072
259 Ga0501038_0226776 3300049574 Bacteria 1489
260 Ga0501038_0242850 3300049574 Bacteria 1429
261 Ga0501043_0009237 3300049579 Bacteria 7748
262 Ga0501043_0374146 3300049579 Bacteria 1079
263 Ga0501046_0005419 3300049580 Bacteria 11404
264 Ga0501047_0002764 3300049581 Bacteria 16669
265 Ga0501047_0076182 3300049581 Bacteria 3228
266 Ga0501047_0153690 3300049581 Bacteria 2176
267 Ga0501047_0276973 3300049581 Bacteria 1523
268 Ga0501048_0039689 3300049582 Bacteria 3376
269 Ga0501069_0194569 3300049585 Bacteria 1174
270 Ga0501070_0028387 3300049586 Bacteria 4693
271 Ga0501070_0470482 3300049586 Unclassified 1012
272 Ga0501072_0289879 3300049588 Unclassified 1301
273 Ga0501073_0103367 3300049589 Bacteria 1978
274 Ga0501075_0840072 3300049591 Bacteria 699
275 Ga0501035_0051960 3300049822 Bacteria 3667
276 Ga0501035_0129657 3300049822 Bacteria 2199
277 Ga0501035_0224892 3300049822 Bacteria 1601
278 Ga0501035_0480445 3300049822 Bacteria 1025
279 Ga0501044_0011731 3300049823 Bacteria 9492
280 Ga0501044_0015409 3300049823 Bacteria 8233
281 Ga0501044_0230479 3300049823 Bacteria 1800
282 Ga0501044_0747439 3300049823 Bacteria 860
283 Ga0501045_0568999 3300049824 Bacteria 840
284 nmdc:mga06z11_179413_c1 3300050494 Bacteria 1220
285 Ga0495601_0000315 3300053077 Bacteria 25650
286 Ga0495601_0003404 3300053077 Bacteria 9119
287 Ga0495612_0003638 3300053078 Bacteria 6390
288 Ga0495612_0012629 3300053078 Bacteria 3405
289 Ga0495595_0003187 3300053084 Bacteria 6507
290 Ga0500643_009693 3300053087 Bacteria 3657
291 Ga0500644_0032527 3300053088 Bacteria 1668
292 Ga0500644_0076165 3300053088 Bacteria 1222
293 Ga0500651_0035382 3300053093 Bacteria 3147
294 Ga0500566_0062443 3300053094 Bacteria 2106
295 Ga0500650_0184232 3300053098 Unclassified 956
296 Ga0500595_000001 3300053119 Bacteria 1088438
297 Ga0500652_002166 3300053131 Bacteria 5905
298 Ga0500616_0000001 3300053153 Bacteria 1986011
299 Ga0500616_0013625 3300053153 Bacteria 4712
300 Ga0500645_000374 3300053730 Bacteria 31484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0840072 Ga0501075_0840072_48_656 188
2 3300053088 Ga0500644_0076165 Ga0500644_0076165_29_640 189
3 3300037418 Ga0395900_0853110 Ga0395900_0853110_25_663 196
4 3300020069 Ga0197907_10972301 Ga0197907_109723011 197
5 3300049588 Ga0501072_0289879 Ga0501072_0289879_289_936 201
6 3300049589 Ga0501073_0103367 Ga0501073_0103367_296_943 201
7 3300041443 Ga0451789_0349180 Ga0451789_0349180_123_782 203
8 3300003794 Ga0055531_10001525 Ga0055531_100015252 204
9 3300013308 Ga0157375_10004011 Ga0157375_100040112 205
10 3300014969 Ga0157376_10116460 Ga0157376_101164602 205
11 3300031250 Ga0265331_10069014 Ga0265331_100690142 205
12 3300031344 Ga0265316_10095956 Ga0265316_100959562 205
13 3300031456 Ga0307513_10214592 Ga0307513_102145922 205
14 3300045976 Ga0466967_0197277 Ga0466967_0197277_1171_1833 205
15 3300048925 Ga0496122_0018231 Ga0496122_0018231_1669_2334 205
16 3300048927 Ga0496124_0134071 Ga0496124_0134071_986_1651 205
17 3300049586 Ga0501070_0470482 Ga0501070_0470482_56_721 205
18 3300028800 Ga0265338_10007405 Ga0265338_100074055 206
19 3300031241 Ga0265325_10003514 Ga0265325_100035143 206
20 3300031249 Ga0265339_10000840 Ga0265339_100008408 206
21 3300031250 Ga0265331_10000683 Ga0265331_1000068317 206
22 3300031595 Ga0265313_10001284 Ga0265313_1000128411 206
23 3300031711 Ga0265314_10000280 Ga0265314_1000028071 206
24 3300031712 Ga0265342_10006065 Ga0265342_100060656 206
25 3300003911 JGI25405J52794_10014097 JGI25405J52794_100140972 207
26 3300005339 Ga0070660_100137148 Ga0070660_1001371482 207
27 3300005434 Ga0070709_10059117 Ga0070709_100591171 207
28 3300005455 Ga0070663_100082277 Ga0070663_1000822772 207
29 3300005456 Ga0070678_100117596 Ga0070678_1001175962 207
30 3300005457 Ga0070662_100161957 Ga0070662_1001619572 207
31 3300005458 Ga0070681_10012180 Ga0070681_100121807 207
32 3300005544 Ga0070686_100550046 Ga0070686_1005500462 207
33 3300005545 Ga0070695_100030884 Ga0070695_1000308842 207
34 3300005546 Ga0070696_100056484 Ga0070696_1000564842 207
35 3300005547 Ga0070693_100137204 Ga0070693_1001372042 207
36 3300005842 Ga0068858_100030289 Ga0068858_1000302893 207
37 3300005937 Ga0081455_10000002 Ga0081455_10000002229 207
38 3300006175 Ga0070712_100149691 Ga0070712_1001496912 207
39 3300006178 Ga0075367_10313655 Ga0075367_103136552 207
40 3300007076 Ga0075435_100403206 Ga0075435_1004032061 207
41 3300009093 Ga0105240_10153191 Ga0105240_101531913 207
42 3300009174 Ga0105241_10035176 Ga0105241_100351764 207
43 3300013100 Ga0157373_10011171 Ga0157373_100111712 207
44 3300013307 Ga0157372_10932971 Ga0157372_109329712 207
45 3300025911 Ga0207654_10096991 Ga0207654_100969912 207
46 3300025912 Ga0207707_10114280 Ga0207707_101142802 207
47 3300025915 Ga0207693_10005281 Ga0207693_100052812 207
48 3300025915 Ga0207693_10167475 Ga0207693_101674752 207
49 3300025921 Ga0207652_10528315 Ga0207652_105283152 207
50 3300025927 Ga0207687_10458450 Ga0207687_104584502 207
51 3300025928 Ga0207700_10058481 Ga0207700_100584812 207
52 3300026067 Ga0207678_10020281 Ga0207678_100202814 207
53 3300026121 Ga0207683_10045994 Ga0207683_100459942 207
54 3300031911 Ga0307412_10130575 Ga0307412_101305752 207
55 3300032005 Ga0307411_10876587 Ga0307411_108765872 207
56 3300035083 Ga0373926_0006289 Ga0373926_0006289_2887_3558 207
57 3300035086 Ga0373934_0047309 Ga0373934_0047309_441_1112 207
58 3300035088 Ga0373940_0152636 Ga0373940_0152636_36_707 207
59 3300035117 Ga0373953_0017751 Ga0373953_0017751_755_1426 207
60 3300035118 Ga0373954_0023778 Ga0373954_0023778_1471_2142 207
61 3300035120 Ga0373957_0002141 Ga0373957_0002141_1695_2366 207
62 3300035120 Ga0373957_0003303 Ga0373957_0003303_676_1347 207
63 3300035121 Ga0373960_0076339 Ga0373960_0076339_247_918 207
64 3300035171 Ga0373946_0008610 Ga0373946_0008610_3062_3733 207
65 3300035172 Ga0373955_0004697 Ga0373955_0004697_1959_2630 207
66 3300035410 Ga0373924_0013167 Ga0373924_0013167_2224_2895 207
67 3300035691 Ga0373931_0053507 Ga0373931_0053507_1251_1922 207
68 3300035692 Ga0373935_0301510 Ga0373935_0301510_280_951 207
69 3300035692 Ga0373935_0514887 Ga0373935_0514887_127_798 207
70 3300035724 Ga0373933_0003782 Ga0373933_0003782_4164_4835 207
71 3300036401 Ga0373937_0040611 Ga0373937_0040611_174_845 207
72 3300037471 Ga0395905_0359159 Ga0395905_0359159_465_1166 207
73 3300041451 Ga0451791_0842962 Ga0451791_0842962_24_695 207
74 3300041452 Ga0451793_0235365 Ga0451793_0235365_569_1246 207
75 3300041453 Ga0451797_0426262 Ga0451797_0426262_516_1193 207
76 3300041458 Ga0451798_1102015 Ga0451798_1102015_321_998 207
77 3300041460 Ga0451802_0567867 Ga0451802_0567867_31_708 207
78 3300041486 Ga0451807_1305026 Ga0451807_1305026_428_1105 207
79 3300041498 Ga0451841_0752102 Ga0451841_0752102_284_961 207
80 3300041512 Ga0451853_3423423 Ga0451853_3423423_19_696 207
81 3300045976 Ga0466967_0391179 Ga0466967_0391179_119_787 207
82 3300046454 Ga0495592_0310178 Ga0495592_0310178_41_712 207
83 3300046455 Ga0495603_0322126 Ga0495603_0322126_65_736 207
84 3300046460 Ga0495638_0025057 Ga0495638_0025057_1203_1874 207
85 3300046462 Ga0495651_0121001 Ga0495651_0121001_573_1244 207
86 3300046475 Ga0495639_0049624 Ga0495639_0049624_491_1162 207
87 3300046476 Ga0495662_0243172 Ga0495662_0243172_11_682 207
88 3300046477 Ga0495664_0063548 Ga0495664_0063548_1105_1776 207
89 3300046511 Ga0495608_0031465 Ga0495608_0031465_1692_2363 207
90 3300046514 Ga0495618_0029096 Ga0495618_0029096_2298_2969 207
91 3300046529 Ga0495652_0235169 Ga0495652_0235169_95_766 207
92 3300046531 Ga0495665_0134747 Ga0495665_0134747_74_745 207
93 3300046557 Ga0495622_0119243 Ga0495622_0119243_307_978 207
94 3300046559 Ga0495667_0022402 Ga0495667_0022402_3540_4211 207
95 3300046642 Ga0495634_0219348 Ga0495634_0219348_444_1115 207
96 3300046675 Ga0495657_0037929 Ga0495657_0037929_1407_2078 207
97 3300046681 Ga0495647_0021210 Ga0495647_0021210_954_1625 207
98 3300046690 Ga0495624_0074969 Ga0495624_0074969_886_1557 207
99 3300046809 Ga0495600_0131291 Ga0495600_0131291_621_1292 207
100 3300047317 Ga0495604_0555334 Ga0495604_0555334_45_716 207
101 3300047319 Ga0495674_0021315 Ga0495674_0021315_2461_3132 207
102 3300047321 Ga0495676_0030084 Ga0495676_0030084_1195_1866 207
103 3300047322 Ga0495680_0062470 Ga0495680_0062470_592_1263 207
104 3300047673 Ga0495593_0011526 Ga0495593_0011526_1127_1798 207
105 3300048088 Ga0495602_0030359 Ga0495602_0030359_2647_3318 207
106 3300048904 Ga0496101_0056241 Ga0496101_0056241_1369_2040 207
107 3300048910 Ga0496107_0016925 Ga0496107_0016925_2264_2935 207
108 3300048918 Ga0496115_0024993 Ga0496115_0024993_1680_2351 207
109 3300048918 Ga0496115_0045470 Ga0496115_0045470_912_1583 207
110 3300050494 nmdc:mga06z11_179413_c1 nmdc:mga06z11_179413_c1_72_743 207
111 3300053077 Ga0495601_0000315 Ga0495601_0000315_2013_2684 207
112 3300053077 Ga0495601_0003404 Ga0495601_0003404_3540_4211 207
113 3300053078 Ga0495612_0003638 Ga0495612_0003638_2353_3024 207
114 3300053078 Ga0495612_0012629 Ga0495612_0012629_1627_2298 207
115 3300053084 Ga0495595_0003187 Ga0495595_0003187_3541_4212 207
116 3300053087 Ga0500643_009693 Ga0500643_009693_514_1185 207
117 3300053088 Ga0500644_0032527 Ga0500644_0032527_371_1042 207
118 3300053093 Ga0500651_0035382 Ga0500651_0035382_1058_1729 207
119 3300053094 Ga0500566_0062443 Ga0500566_0062443_807_1478 207
120 3300053098 Ga0500650_0184232 Ga0500650_0184232_40_711 207
121 3300053119 Ga0500595_000001 Ga0500595_000001_828510_829181 207
122 3300053131 Ga0500652_002166 Ga0500652_002166_5137_5805 207
123 3300053153 Ga0500616_0000001 Ga0500616_0000001_1149553_1150221 207
124 3300053153 Ga0500616_0013625 Ga0500616_0013625_3065_3736 207
125 3300053730 Ga0500645_000374 Ga0500645_000374_6291_6959 207
126 iso_pu_bacteria 2643221577 2643895190 207
127 iso_pu_bacteria 2643221685 2644477349 207
128 3300005335 Ga0070666_10000018 Ga0070666_10000018134 208
129 3300005367 Ga0070667_100032024 Ga0070667_1000320245 208
130 3300005842 Ga0068858_100048183 Ga0068858_1000481835 208
131 3300005843 Ga0068860_100131093 Ga0068860_1001310932 208
132 3300013306 Ga0163162_10001986 Ga0163162_1000198611 208
133 3300015685 Ga0183369_1007 Ga0183369_1007185 208
134 3300024227 Ga0228598_1002558 Ga0228598_10025583 208
135 3300025304 Ga0209257_1000613 Ga0209257_100061316 208
136 3300025903 Ga0207680_10000002 Ga0207680_10000002520 208
137 3300026078 Ga0207702_10030356 Ga0207702_100303562 208
138 3300028381 Ga0268264_10122551 Ga0268264_101225511 208
139 3300031090 Ga0265760_10029915 Ga0265760_100299152 208
140 3300031251 Ga0265327_10006545 Ga0265327_100065455 208
141 3300035114 Ga0373939_0001436 Ga0373939_0001436_2117_2794 208
142 3300037853 Ga0436364_1542567 Ga0436364_1542567_106_834 208
143 3300048929 Ga0496126_0230341 Ga0496126_0230341_505_1185 208
144 3300028786 Ga0307517_10106765 Ga0307517_101067652 209
145 3300031241 Ga0265325_10043772 Ga0265325_100437723 209
146 3300033180 Ga0307510_10005448 Ga0307510_100054488 209
147 iso_pu_bacteria 2687453130 2687584007 209
148 3300006175 Ga0070712_100351732 Ga0070712_1003517322 210
149 3300017792 Ga0163161_10055869 Ga0163161_100558693 210
150 3300025932 Ga0207690_10002706 Ga0207690_100027063 210
151 3300030735 Ga0316178_1018064 Ga0316178_10180641 210
152 3300041404 Ga0439436_0025742 Ga0439436_0025742_608_1294 210
153 3300041451 Ga0451791_1559139 Ga0451791_1559139_3340_4026 210
154 3300041453 Ga0451797_0190356 Ga0451797_0190356_756_1442 210
155 3300041456 Ga0451795_0964377 Ga0451795_0964377_189_875 210
156 3300049568 Ga0501031_0317646 Ga0501031_0317646_119_802 210
157 3300049569 Ga0501032_0009136 Ga0501032_0009136_6247_6930 210
158 3300049571 Ga0501034_0056650 Ga0501034_0056650_3086_3769 210
159 3300049573 Ga0501037_0321065 Ga0501037_0321065_233_916 210
160 3300049574 Ga0501038_0226776 Ga0501038_0226776_494_1177 210
161 3300049580 Ga0501046_0005419 Ga0501046_0005419_9886_10569 210
162 iso_pu_bacteria 2537561836 2538834098 210
163 iso_pu_bacteria 2643221562 2643829558 210
164 iso_pu_bacteria 2895395659 2895397505 210
165 3300005345 Ga0070692_10016178 Ga0070692_100161783 211
166 3300005435 Ga0070714_100003062 Ga0070714_1000030623 211
167 3300005457 Ga0070662_100075947 Ga0070662_1000759473 211
168 3300005530 Ga0070679_100039017 Ga0070679_1000390173 211
169 3300009545 Ga0105237_10104805 Ga0105237_101048053 211
170 3300025904 Ga0207647_10021560 Ga0207647_100215603 211
171 3300025909 Ga0207705_10016407 Ga0207705_100164073 211
172 3300025919 Ga0207657_10111058 Ga0207657_101110582 211
173 3300025920 Ga0207649_10254915 Ga0207649_102549152 211
174 3300025929 Ga0207664_10001322 Ga0207664_100013229 211
175 3300025933 Ga0207706_10044623 Ga0207706_100446234 211
176 3300041494 Ga0451837_0400289 Ga0451837_0400289_1047_1736 211
177 3300005437 Ga0070710_10032219 Ga0070710_100322192 212
178 3300005458 Ga0070681_10030069 Ga0070681_100300694 212
179 3300013104 Ga0157370_10020890 Ga0157370_100208902 212
180 3300014497 Ga0182008_10065359 Ga0182008_100653592 212
181 3300025898 Ga0207692_10027067 Ga0207692_100270673 212
182 3300025912 Ga0207707_10089184 Ga0207707_100891843 212
183 3300037312 Ga0395899_0003826 Ga0395899_0003826_9018_9707 212
184 3300037418 Ga0395900_0004191 Ga0395900_0004191_12474_13163 212
185 3300037418 Ga0395900_0418799 Ga0395900_0418799_294_983 212
186 3300037466 Ga0395898_0068334 Ga0395898_0068334_344_1033 212
187 3300037466 Ga0395898_0174857 Ga0395898_0174857_841_1530 212
188 3300037471 Ga0395905_0025032 Ga0395905_0025032_205_894 212
189 3300038443 Ga0395901_0001533 Ga0395901_0001533_3990_4691 212
190 3300038443 Ga0395901_0015703 Ga0395901_0015703_3193_3882 212
191 3300038443 Ga0395901_0092671 Ga0395901_0092671_192_881 212
192 3300045976 Ga0466967_0720987 Ga0466967_0720987_116_805 212
193 3300049571 Ga0501034_0380430 Ga0501034_0380430_210_899 212
194 3300049571 Ga0501034_0880016 Ga0501034_0880016_64_753 212
195 3300049572 Ga0501036_0264737 Ga0501036_0264737_410_1099 212
196 3300049573 Ga0501037_0026448 Ga0501037_0026448_2509_3198 212
197 3300049574 Ga0501038_0242850 Ga0501038_0242850_172_861 212
198 3300049579 Ga0501043_0009237 Ga0501043_0009237_6452_7141 212
199 3300049579 Ga0501043_0374146 Ga0501043_0374146_147_836 212
200 3300049581 Ga0501047_0002764 Ga0501047_0002764_2404_3093 212
201 3300049581 Ga0501047_0076182 Ga0501047_0076182_1938_2627 212
202 3300049582 Ga0501048_0039689 Ga0501048_0039689_1099_1788 212
203 3300049822 Ga0501035_0051960 Ga0501035_0051960_1397_2086 212
204 3300049822 Ga0501035_0480445 Ga0501035_0480445_241_936 212
205 3300049823 Ga0501044_0015409 Ga0501044_0015409_5458_6147 212
206 3300049823 Ga0501044_0747439 Ga0501044_0747439_77_766 212
207 3300049824 Ga0501045_0568999 Ga0501045_0568999_11_700 212
208 3300005435 Ga0070714_100012139 Ga0070714_1000121396 213
209 3300005439 Ga0070711_100193503 Ga0070711_1001935032 213
210 3300005577 Ga0068857_100321602 Ga0068857_1003216022 213
211 3300005578 Ga0068854_100061134 Ga0068854_1000611343 213
212 3300005614 Ga0068856_100000582 Ga0068856_10000058227 213
213 3300009093 Ga0105240_10046303 Ga0105240_100463034 213
214 3300009545 Ga0105237_10000675 Ga0105237_100006754 213
215 3300009551 Ga0105238_10139480 Ga0105238_101394802 213
216 3300013100 Ga0157373_10175488 Ga0157373_101754881 213
217 3300013102 Ga0157371_10020571 Ga0157371_100205715 213
218 3300013104 Ga0157370_10434714 Ga0157370_104347142 213
219 3300013105 Ga0157369_10017478 Ga0157369_100174782 213
220 3300013307 Ga0157372_10187634 Ga0157372_101876342 213
221 3300014497 Ga0182008_10041423 Ga0182008_100414231 213
222 3300015262 Ga0182007_10025723 Ga0182007_100257233 213
223 3300020070 Ga0206356_11478499 Ga0206356_114784993 213
224 3300020082 Ga0206353_11923352 Ga0206353_119233522 213
225 3300025246 Ga0209646_1004407 Ga0209646_10044073 213
226 3300025250 Ga0209026_1000274 Ga0209026_100027417 213
227 3300025256 Ga0209759_1008242 Ga0209759_10082424 213
228 3300025272 Ga0209455_1000095 Ga0209455_1000095102 213
229 3300025904 Ga0207647_10049605 Ga0207647_100496052 213
230 3300025914 Ga0207671_10001518 Ga0207671_100015187 213
231 3300025929 Ga0207664_10001329 Ga0207664_1000132910 213
232 3300025981 Ga0207640_10584371 Ga0207640_105843712 213
233 3300026067 Ga0207678_10003855 Ga0207678_100038552 213
234 3300026078 Ga0207702_10000132 Ga0207702_100001324 213
235 3300049581 Ga0501047_0153690 Ga0501047_0153690_1301_1999 213
236 3300049581 Ga0501047_0276973 Ga0501047_0276973_563_1252 213
237 3300049585 Ga0501069_0194569 Ga0501069_0194569_438_1127 213
238 3300049586 Ga0501070_0028387 Ga0501070_0028387_1655_2344 213
239 3300049822 Ga0501035_0129657 Ga0501035_0129657_448_1146 213
240 3300049823 Ga0501044_0011731 Ga0501044_0011731_6860_7558 213
241 3300049823 Ga0501044_0230479 Ga0501044_0230479_901_1599 213
242 3300002737 JGI25162J39368_1003185 JGI25162J39368_10031855 214
243 3300002741 JGI25157J39369_1000860 JGI25157J39369_10008602 214
244 3300002772 JGI25164J39214_1000666 JGI25164J39214_10006669 214
245 3300003214 JGI25165J46597_1001865 JGI25165J46597_10018651 214
246 3300005337 Ga0070682_100001177 Ga0070682_1000011779 214
247 3300005337 Ga0070682_100046423 Ga0070682_1000464233 214
248 3300005337 Ga0070682_100542506 Ga0070682_1005425061 214
249 3300005339 Ga0070660_100015354 Ga0070660_1000153542 214
250 3300005339 Ga0070660_100036416 Ga0070660_1000364163 214
251 3300005339 Ga0070660_100170956 Ga0070660_1001709562 214
252 3300005366 Ga0070659_100009626 Ga0070659_1000096265 214
253 3300005366 Ga0070659_100019817 Ga0070659_1000198175 214
254 3300005366 Ga0070659_100411787 Ga0070659_1004117871 214
255 3300005435 Ga0070714_100085598 Ga0070714_1000855982 214
256 3300005436 Ga0070713_100008958 Ga0070713_1000089582 214
257 3300005444 Ga0070694_100453854 Ga0070694_1004538542 214
258 3300005455 Ga0070663_100387920 Ga0070663_1003879201 214
259 3300005458 Ga0070681_10001351 Ga0070681_1000135111 214
260 3300005458 Ga0070681_10011680 Ga0070681_100116805 214
261 3300005539 Ga0068853_100143127 Ga0068853_1001431272 214
262 3300005546 Ga0070696_100001026 Ga0070696_1000010267 214
263 3300005578 Ga0068854_100003601 Ga0068854_1000036019 214
264 3300009174 Ga0105241_10613653 Ga0105241_106136531 214
265 3300009551 Ga0105238_10011992 Ga0105238_100119924 214
266 3300009551 Ga0105238_10242673 Ga0105238_102426731 214
267 3300013100 Ga0157373_10013418 Ga0157373_100134184 214
268 3300013102 Ga0157371_10091263 Ga0157371_100912632 214
269 3300013104 Ga0157370_10005510 Ga0157370_100055109 214
270 3300013105 Ga0157369_10968677 Ga0157369_109686771 214
271 3300013307 Ga0157372_10070476 Ga0157372_100704764 214
272 3300013307 Ga0157372_10078548 Ga0157372_100785482 214
273 3300015262 Ga0182007_10020699 Ga0182007_100206992 214
274 3300020081 Ga0206354_11579420 Ga0206354_115794201 214
275 3300020082 Ga0206353_11651424 Ga0206353_116514242 214
276 3300025226 Ga0209674_102072 Ga0209674_1020723 214
277 3300025231 Ga0207427_100242 Ga0207427_10024220 214
278 3300025233 Ga0209437_100424 Ga0209437_10042425 214
279 3300025250 Ga0209026_1000098 Ga0209026_1000098137 214
280 3300025261 Ga0209233_1000667 Ga0209233_10006679 214
281 3300025911 Ga0207654_10140154 Ga0207654_101401542 214
282 3300025912 Ga0207707_10003140 Ga0207707_100031406 214
283 3300025912 Ga0207707_10013804 Ga0207707_100138043 214
284 3300025915 Ga0207693_10057346 Ga0207693_100573462 214
285 3300025919 Ga0207657_10057975 Ga0207657_100579753 214
286 3300025924 Ga0207694_10079355 Ga0207694_100793552 214
287 3300025924 Ga0207694_10130122 Ga0207694_101301221 214
288 3300025924 Ga0207694_10272259 Ga0207694_102722592 214
289 3300025928 Ga0207700_10144494 Ga0207700_101444942 214
290 3300025929 Ga0207664_10152943 Ga0207664_101529432 214
291 3300025932 Ga0207690_10000747 Ga0207690_100007477 214
292 3300025932 Ga0207690_10011239 Ga0207690_100112395 214
293 3300025932 Ga0207690_10012135 Ga0207690_100121355 214
294 3300025949 Ga0207667_10111153 Ga0207667_101111533 214
295 3300025981 Ga0207640_10014885 Ga0207640_100148852 214
296 3300026067 Ga0207678_10111625 Ga0207678_101116252 214
297 3300026067 Ga0207678_10232214 Ga0207678_102322142 214
298 3300026116 Ga0207674_10251279 Ga0207674_102512792 214
299 3300037466 Ga0395898_0007440 Ga0395898_0007440_9117_9824 214
300 3300038443 Ga0395901_0009999 Ga0395901_0009999_8321_9028 214
301 3300038443 Ga0395901_0206482 Ga0395901_0206482_587_1294 214
302 3300038443 Ga0395901_0766941 Ga0395901_0766941_30_722 214
303 3300044842 Ga0466957_0102791 Ga0466957_0102791_944_1651 214
304 3300046674 Ga0495588_0155649 Ga0495588_0155649_234_962 214
305 3300049570 Ga0501033_0002369 Ga0501033_0002369_3651_4346 214
306 3300049822 Ga0501035_0224892 Ga0501035_0224892_309_1004 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01902

Diphthami_syn_2

Diphthamide synthase

38

246

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fz0-assembly1.cif.gz_B inosine-guanosine nucleoside hydrolase (ig-nh) 0.858 1 35
3rk1-assembly1.cif.gz_A 'x-ray crystal structure of the putative n-type atp pyrophosphatase (pf0828) in complex with atp from pyrococcus furiosus, northeast structural genomics consortium target pfr23 0.8227 3 207
8qnd-assembly1.cif.gz_B crystal structure of the ribonucleoside hydrolase c from lactobacillus reuteri 0.8163 1 38
8oic-assembly2.cif.gz_E trichomonas vaginalis riboside hydrolase (his-tagged) 0.8041 1 36
8oib-assembly1.cif.gz_B trichomonas vaginalis riboside hydrolase in complex with glycerol 0.8012 1 37
ID Description Score Start End Superfamily
af_Q9XWN7_2_332_3.90.245.10 Alpha Beta;Alpha-Beta Complex;Inosine-uridine Nucleoside N-ribohydrolase; Chain A;Ribonucleoside hydrolase-like 0.8583 2 34 3.90.245.10
af_Q2G032_1_148_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8001 1 34 3.40.50.720
2d13D02 Alpha Beta;Alpha-Beta Complex;putative n-type atp pyrophosphatase, domain 2;putative n-type atp pyrophosphatase, domain 2 0.7674 117 208 3.90.1490.10
2d13C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7499 4 116 3.40.50.620
af_Q8I5J0_1_157_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7451 3 129 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4Q3B9U0-F1-model_v4 Diphthamide synthase domain-containing protein 0.9941 1 71
AF-A0A359CM52-F1-model_v4 ATP-binding protein 0.992 125 206 GO:0005524
AF-A0A2V7FMB5-F1-model_v4 Diphthamide synthase domain-containing protein 0.9908 118 207
AF-A0A0A0ETP9-F1-model_v4 Diphthamide synthase domain-containing protein 0.9876 130 207
AF-A0A534AFB1-F1-model_v4 ATP-binding protein 0.9871 112 207 GO:0005524

Feature Viewer

pLDDT pTM Quality
86.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map