F398483

General Info

Members Datasets Scaffolds Average Seq Length
306 167 612 292

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10120095|Ga0070666_101200951
Length 314
Sequence MTREPGRTIIPRMLRARIDSSRRTLPLFVAVLALGAALVAVPRLTAQEPTGIPKVAASEWIQLFNGKNLDGWTPKFTHHDLGENFHNTFRVEDGLLRVRYDDWPSFTDEFGHLFYKDPFSYYLLAAEYRFVGEQVAGGPSWAIRNNGLMLHSPHPRTMPKDQDFPISLEFQLLGGLGKGPRTTANLCTPGTNVVMNGQLHTQHCTNSTSQTYDGDQWVRVEVLVHGDELVRHMIDGKTVLEYSKPQIGGGSVSNFDPAVKVDGMPLTGGYISIQAETAPIDFRKIELLNLEGCMNPTAASYKSYFVKSNPAMCR

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
126 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 0.98
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 12.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10120095 3300005335 Bacteria 1822
2 rootH2_10042321 3300003320 Bacteria 4030
3 rootL2_10002661 3300003322 Bacteria 5622
4 rootL2_10022855 3300003322 Bacteria 11497
5 rootH1_10038386 3300003323 Bacteria 6075
6 Ga0065714_10089758 3300005288 Bacteria 1968
7 Ga0065712_10001185 3300005290 Bacteria 6859
8 Ga0065712_10005015 3300005290 Bacteria 4593
9 Ga0065712_10085505 3300005290 Bacteria 2693
10 Ga0065712_10174937 3300005290 Bacteria 1223
11 Ga0065707_10171573 3300005295 Bacteria 1480
12 Ga0070676_10214535 3300005328 Bacteria 1268
13 Ga0070670_100002830 3300005331 Bacteria 14348
14 Ga0070670_100144247 3300005331 Bacteria 2059
15 Ga0070670_100347322 3300005331 Unclassified 1303
16 Ga0068869_100156947 3300005334 Bacteria 1769
17 Ga0070666_10183979 3300005335 Bacteria 1466
18 Ga0070680_100125008 3300005336 Unclassified 2149
19 Ga0068868_100025284 3300005338 Bacteria 4515
20 Ga0068868_100293060 3300005338 Bacteria 1380
21 Ga0070689_100027018 3300005340 Bacteria 4325
22 Ga0070689_100518689 3300005340 Bacteria 1023
23 Ga0070661_100066774 3300005344 Bacteria 2643
24 Ga0070661_100168896 3300005344 Bacteria 1660
25 Ga0070668_100164320 3300005347 Bacteria 1803
26 Ga0070669_100017109 3300005353 Bacteria 5172
27 Ga0070669_100032402 3300005353 Bacteria 3774
28 Ga0070669_100114917 3300005353 Bacteria 2047
29 Ga0070675_100009082 3300005354 Bacteria 7722
30 Ga0070675_100119696 3300005354 Unclassified 2236
31 Ga0070675_100122679 3300005354 Bacteria 2208
32 Ga0070675_100126046 3300005354 Bacteria 2178
33 Ga0070675_100132122 3300005354 Bacteria 2128
34 Ga0070671_100118931 3300005355 Bacteria 2223
35 Ga0070674_100016758 3300005356 Bacteria 4596
36 Ga0070674_100025054 3300005356 Bacteria 3878
37 Ga0070674_100225646 3300005356 Bacteria 1459
38 Ga0070673_100076113 3300005364 Bacteria 2709
39 Ga0070673_100132843 3300005364 Unclassified 2091
40 Ga0070673_100146785 3300005364 Bacteria 1994
41 Ga0070673_100178722 3300005364 Bacteria 1815
42 Ga0070688_100050172 3300005365 Bacteria 2599
43 Ga0070688_100241361 3300005365 Bacteria 1282
44 Ga0070659_100240159 3300005366 Bacteria 1499
45 Ga0070659_100259811 3300005366 Bacteria 1441
46 Ga0070703_10065823 3300005406 Bacteria 1197
47 Ga0070701_10010675 3300005438 Bacteria 4074
48 Ga0070701_10107029 3300005438 Bacteria 1557
49 Ga0070700_100154436 3300005441 Bacteria 1573
50 Ga0070694_100101421 3300005444 Bacteria 2036
51 Ga0070694_100126871 3300005444 Bacteria 1838
52 Ga0070694_100160534 3300005444 Bacteria 1649
53 Ga0070708_100364871 3300005445 Unclassified 1361
54 Ga0070678_100067545 3300005456 Bacteria 2662
55 Ga0070678_100116977 3300005456 Bacteria 2096
56 Ga0070662_100266403 3300005457 Bacteria 1382
57 Ga0068867_100107141 3300005459 Bacteria 2142
58 Ga0070685_10082909 3300005466 Bacteria 1925
59 Ga0070707_100047778 3300005468 Bacteria 4098
60 Ga0070707_100054764 3300005468 Bacteria 3825
61 Ga0070707_100514601 3300005468 Bacteria 1159
62 Ga0070684_100134188 3300005535 Bacteria 2235
63 Ga0070672_100253387 3300005543 Bacteria 1483
64 Ga0070686_100303636 3300005544 Bacteria 1185
65 Ga0070695_100069363 3300005545 Bacteria 2304
66 Ga0070696_100097924 3300005546 Unclassified 2098
67 Ga0070696_100132625 3300005546 Bacteria 1814
68 Ga0070665_100225560 3300005548 Unclassified 1874
69 Ga0070664_100043198 3300005564 Bacteria 3802
70 Ga0070664_100300726 3300005564 Bacteria 1450
71 Ga0068859_100043979 3300005617 Bacteria 4488
72 Ga0068859_100064485 3300005617 Bacteria 3696
73 Ga0068859_100117556 3300005617 Bacteria 2724
74 Ga0068859_100161649 3300005617 Bacteria 2318
75 Ga0068864_100295502 3300005618 Bacteria 1515
76 Ga0068864_100493995 3300005618 Bacteria 1176
77 Ga0068861_100008914 3300005719 Bacteria 6914
78 Ga0068861_100084471 3300005719 Bacteria 2492
79 Ga0068861_100160779 3300005719 Bacteria 1852
80 Ga0068870_10236987 3300005840 Bacteria 1125
81 Ga0068862_100159331 3300005844 Unclassified 2014
82 Ga0081539_10003097 3300005985 Bacteria 21360
83 Ga0081539_10003245 3300005985 Bacteria 20458
84 Ga0075365_10012779 3300006038 Bacteria 5000
85 Ga0075363_100094322 3300006048 Bacteria 1650
86 Ga0075364_10078135 3300006051 Bacteria 2185
87 Ga0097621_100337439 3300006237 Bacteria 1338
88 Ga0075428_100008642 3300006844 Bacteria 11294
89 Ga0075428_100030909 3300006844 Bacteria 5921
90 Ga0075428_100602048 3300006844 Bacteria 1174
91 Ga0075430_100019702 3300006846 Bacteria 5740
92 Ga0075430_100025145 3300006846 Bacteria 5064
93 Ga0075430_100083628 3300006846 Bacteria 2674
94 Ga0075431_100000577 3300006847 Bacteria 31018
95 Ga0075431_100027575 3300006847 Bacteria 5828
96 Ga0075431_100206253 3300006847 Bacteria 2009
97 Ga0075433_10365286 3300006852 Bacteria 1275
98 Ga0075433_10473976 3300006852 Bacteria 1103
99 Ga0075429_100000949 3300006880 Bacteria 22972
100 Ga0075429_100060217 3300006880 Bacteria 3307
101 Ga0075429_100223413 3300006880 Bacteria 1649
102 Ga0075429_100474904 3300006880 Bacteria 1096
103 Ga0068865_100255460 3300006881 Bacteria 1385
104 Ga0097620_100043979 3300006931 Bacteria 4488
105 Ga0097620_100064484 3300006931 Bacteria 3696
106 Ga0097620_100117556 3300006931 Bacteria 2724
107 Ga0097620_100161637 3300006931 Bacteria 2318
108 Ga0111539_10004119 3300009094 Bacteria 19078
109 Ga0111539_10010561 3300009094 Bacteria 11628
110 Ga0111539_10044203 3300009094 Bacteria 5337
111 Ga0111539_10073761 3300009094 Bacteria 4023
112 Ga0111539_10222604 3300009094 Unclassified 2198
113 Ga0111539_10288323 3300009094 Bacteria 1910
114 Ga0111539_10355844 3300009094 Bacteria 1704
115 Ga0105245_10364166 3300009098 Unclassified 1436
116 Ga0114129_10003600 3300009147 Bacteria 21781
117 Ga0114129_10010763 3300009147 Bacteria 13037
118 Ga0114129_10042915 3300009147 Bacteria 6365
119 Ga0114129_10046079 3300009147 Bacteria 6129
120 Ga0114129_10046331 3300009147 Bacteria 6111
121 Ga0114129_10046953 3300009147 Bacteria 6069
122 Ga0114129_10076562 3300009147 Bacteria 4657
123 Ga0114129_10430352 3300009147 Bacteria 1734
124 Ga0105243_10022023 3300009148 Bacteria 4841
125 Ga0105243_10388803 3300009148 Bacteria 1292
126 Ga0105249_10594906 3300009553 Bacteria 1160
127 Ga0105249_10730607 3300009553 Unclassified 1051
128 Ga0157374_10154730 3300013296 Unclassified 2231
129 Ga0157375_10242363 3300013308 Bacteria 1962
130 Ga0163163_10013148 3300014325 Bacteria 7564
131 Ga0163163_10119320 3300014325 Bacteria 2671
132 Ga0163163_10186977 3300014325 Unclassified 2119
133 Ga0163163_10528819 3300014325 Bacteria 1242
134 Ga0163163_11013949 3300014325 Bacteria 893
135 Ga0157380_10020120 3300014326 Bacteria 4985
136 Ga0157380_10024824 3300014326 Bacteria 4540
137 Ga0157380_10037707 3300014326 Bacteria 3747
138 Ga0157380_10175755 3300014326 Bacteria 1876
139 Ga0157380_10295752 3300014326 Bacteria 1489
140 Ga0157380_10668885 3300014326 Bacteria 1039
141 Ga0157377_10008611 3300014745 Unclassified 4980
142 Ga0207697_10001479 3300025315 Bacteria 12837
143 Ga0207653_10073519 3300025885 Bacteria 1172
144 Ga0207642_10027731 3300025899 Unclassified 2321
145 Ga0207688_10032116 3300025901 Bacteria 2901
146 Ga0207688_10051481 3300025901 Bacteria 2307
147 Ga0207680_10090122 3300025903 Bacteria 1948
148 Ga0207645_10193945 3300025907 Bacteria 1335
149 Ga0207643_10071261 3300025908 Bacteria 2000
150 Ga0207643_10085724 3300025908 Bacteria 1829
151 Ga0207684_10037891 3300025910 Bacteria 4091
152 Ga0207660_10239853 3300025917 Bacteria 1428
153 Ga0207646_10038943 3300025922 Bacteria 4279
154 Ga0207681_10052819 3300025923 Bacteria 2757
155 Ga0207650_10003579 3300025925 Bacteria 10657
156 Ga0207659_10014532 3300025926 Bacteria 5080
157 Ga0207659_10063651 3300025926 Bacteria 2667
158 Ga0207659_10069967 3300025926 Bacteria 2558
159 Ga0207659_10075588 3300025926 Bacteria 2472
160 Ga0207659_10205974 3300025926 Bacteria 1574
161 Ga0207659_10255288 3300025926 Bacteria 1424
162 Ga0207659_10470702 3300025926 Bacteria 1060
163 Ga0207687_10311208 3300025927 Unclassified 1272
164 Ga0207644_10103051 3300025931 Bacteria 2147
165 Ga0207644_10446506 3300025931 Bacteria 1062
166 Ga0207686_10042316 3300025934 Bacteria 2784
167 Ga0207709_10110403 3300025935 Bacteria 1838
168 Ga0207670_10029221 3300025936 Bacteria 3509
169 Ga0207670_10201518 3300025936 Bacteria 1512
170 Ga0207670_10403799 3300025936 Bacteria 1093
171 Ga0207669_10046073 3300025937 Bacteria 2574
172 Ga0207704_10114391 3300025938 Bacteria 1832
173 Ga0207691_10007390 3300025940 Bacteria 10586
174 Ga0207691_10011101 3300025940 Bacteria 8648
175 Ga0207691_10056004 3300025940 Bacteria 3593
176 Ga0207691_10064832 3300025940 Bacteria 3308
177 Ga0207691_10308683 3300025940 Unclassified 1358
178 Ga0207691_10403226 3300025940 Bacteria 1166
179 Ga0207689_10011227 3300025942 Bacteria 7687
180 Ga0207689_10090383 3300025942 Bacteria 2516
181 Ga0207679_10402915 3300025945 Bacteria 1204
182 Ga0207651_10045296 3300025960 Bacteria 2949
183 Ga0207651_10104643 3300025960 Unclassified 2109
184 Ga0207668_10109327 3300025972 Bacteria 2071
185 Ga0207677_10087097 3300026023 Bacteria 2260
186 Ga0207703_10228475 3300026035 Bacteria 1667
187 Ga0207678_10082999 3300026067 Bacteria 2741
188 Ga0207708_10005771 3300026075 Bacteria 9149
189 Ga0207708_10109155 3300026075 Bacteria 2146
190 Ga0207641_10003248 3300026088 Bacteria 14498
191 Ga0207648_10000749 3300026089 Bacteria 36501
192 Ga0207648_10408822 3300026089 Bacteria 1231
193 Ga0207676_10057654 3300026095 Bacteria 3060
194 Ga0207676_10633504 3300026095 Bacteria 1030
195 Ga0207675_100036146 3300026118 Bacteria 4607
196 Ga0207675_100056380 3300026118 Bacteria 3665
197 Ga0207675_100080004 3300026118 Bacteria 3063
198 Ga0207675_100143504 3300026118 Unclassified 2269
199 Ga0207683_10041948 3300026121 Bacteria 3996
200 Ga0207683_10070142 3300026121 Bacteria 3096
201 Ga0207683_10119058 3300026121 Bacteria 2369
202 Ga0209971_1008459 3300027682 Bacteria 2441
203 Ga0209974_10015167 3300027876 Bacteria 2558
204 Ga0207428_10024437 3300027907 Bacteria 5074
205 Ga0207428_10144886 3300027907 Bacteria 1811
206 Ga0268266_10179092 3300028379 Unclassified 1929
207 Ga0268265_10190676 3300028380 Bacteria 1770
208 Ga0268265_10466535 3300028380 Unclassified 1183
209 Ga0268265_10585143 3300028380 Bacteria 1064
210 Ga0268264_10363327 3300028381 Bacteria 1381
211 Ga0307408_100064898 3300031548 Bacteria 2676
212 Ga0307408_100113724 3300031548 Unclassified 2084
213 Ga0307405_10006029 3300031731 Bacteria 5922
214 Ga0307413_10009122 3300031824 Bacteria 4730
215 Ga0307410_10017283 3300031852 Bacteria 4327
216 Ga0307407_10117780 3300031903 Bacteria 1678
217 Ga0307412_10007184 3300031911 Bacteria 6321
218 Ga0307409_100008696 3300031995 Bacteria 6183
219 Ga0307416_100020209 3300032002 Bacteria 4745
220 Ga0307416_100025281 3300032002 Unclassified 4351
221 Ga0307414_10175480 3300032004 Bacteria 1718
222 Ga0307411_10043215 3300032005 Unclassified 2882
223 Ga0307411_10343121 3300032005 Bacteria 1214
224 Ga0307415_100024900 3300032126 Unclassified 3746
225 Ga0307415_100241604 3300032126 Bacteria 1461
226 Ga0395905_0122264 3300037471 Unclassified 2448
227 Ga0439461_0010389 3300041410 Bacteria 1708
228 Ga0451853_0618548 3300041512 Unclassified 1298
229 Ga0439446_0058352 3300042156 Unclassified 1163
230 Ga0439435_0003738 3300042436 Bacteria 3198
231 Ga0451577_0025270 3300042876 Bacteria 5391
232 Ga0495594_0076786 3300046499 Bacteria 1863
233 Ga0495598_0033785 3300046537 Bacteria 1454
234 Ga0495621_0026838 3300046539 Unclassified 1946
235 Ga0495633_0153340 3300046558 Bacteria 1064
236 Ga0495656_0003031 3300046615 Bacteria 5649
237 Ga0495659_0017141 3300046664 Unclassified 2396
238 Ga0496102_0030916 3300048905 Bacteria 4796
239 Ga0496109_0046557 3300048912 Unclassified 3940
240 Ga0496110_0476743 3300048913 Bacteria 1137
241 Ga0501032_0006475 3300049569 Bacteria 8612
242 Ga0501034_0001467 3300049571 Bacteria 31241
243 Ga0501034_0056631 3300049571 Bacteria 3943
244 Ga0501036_0026489 3300049572 Bacteria 4894
245 Ga0501037_0138829 3300049573 Unclassified 1740
246 Ga0501038_0008173 3300049574 Bacteria 9628
247 Ga0501041_0094697 3300049577 Bacteria 1845
248 Ga0501043_0004014 3300049579 Bacteria 12026
249 Ga0501046_0010553 3300049580 Bacteria 7925
250 Ga0501046_0087053 3300049580 Bacteria 2408
251 Ga0501047_0000437 3300049581 Bacteria 46298
252 Ga0501047_0000784 3300049581 Bacteria 33251
253 Ga0501048_0012687 3300049582 Bacteria 6265
254 Ga0501048_0016559 3300049582 Bacteria 5436
255 Ga0501067_0100045 3300049583 Bacteria 1610
256 Ga0501068_0003503 3300049584 Bacteria 8471
257 Ga0501068_0008535 3300049584 Bacteria 5706
258 Ga0501069_0009950 3300049585 Bacteria 5028
259 Ga0501069_0092521 3300049585 Bacteria 1710
260 Ga0501072_0016330 3300049588 Bacteria 5696
261 Ga0501073_0028605 3300049589 Bacteria 3982
262 Ga0501075_0072798 3300049591 Bacteria 2598
263 Ga0501076_0022264 3300049592 Bacteria 4869
264 Ga0501076_0283325 3300049592 Bacteria 1358
265 Ga0501080_0006932 3300049742 Bacteria 10222
266 Ga0501080_0161622 3300049742 Bacteria 2068
267 Ga0501083_0032591 3300049744 Bacteria 3572
268 Ga0501083_0063433 3300049744 Bacteria 2464
269 Ga0501035_0051623 3300049822 Bacteria 3681
270 Ga0501044_0012191 3300049823 Bacteria 9304
271 nmdc:mga03n38_156651_c1 3300050490 Bacteria 1150
272 nmdc:mga0yw44_8696_c1 3300050492 Bacteria 5077
273 nmdc:mga06z11_102590_c1 3300050494 Unclassified 1572
274 nmdc:mga07m45_77258_c1 3300050496 Bacteria 1899
275 nmdc:mga05p37_23941_c1 3300050507 Bacteria 4596
276 nmdc:mga05p37_25707_c1 3300050507 Bacteria 7160
277 nmdc:mga05p37_300962_c1 3300050507 Bacteria 1905
278 nmdc:mga05p37_36271_c1 3300050507 Bacteria 6051
279 nmdc:mga05p37_388573_c1 3300050507 Bacteria 1633
280 nmdc:mga05p37_53103_c1 3300050507 Bacteria 4984
281 nmdc:mga05p37_6879_c1 3300050507 Bacteria 13405
282 nmdc:mga05p37_89481_c1 3300050507 Unclassified 3794
283 nmdc:mga05p37_91046_c1 3300050507 Bacteria 3759
284 nmdc:mga09592_225310_c1 3300050508 Bacteria 1624
285 nmdc:mga09592_414399_c1 3300050508 Bacteria 1164
286 nmdc:mga09592_6228_c1 3300050508 Bacteria 9712
287 nmdc:mga0qj67_951_c1 3300050509 Bacteria 19931
288 nmdc:mga06r32_2706_c1 3300050510 Bacteria 15857
289 nmdc:mga06r32_50431_c1 3300050510 Bacteria 3981
290 nmdc:mga06r32_78350_c1 3300050510 Unclassified 3212
291 nmdc:mga08y16_108415_c1 3300050511 Bacteria 2891
292 nmdc:mga08y16_273311_c1 3300050511 Unclassified 1744
293 nmdc:mga08y16_280837_c1 3300050511 Unclassified 1718
294 nmdc:mga08y16_34803_c1 3300050511 Bacteria 5292
295 nmdc:mga08y16_42389_c1 3300050511 Bacteria 4767
296 nmdc:mga08y16_4806_c1 3300050511 Bacteria 14094
297 nmdc:mga08y16_664772_c1 3300050511 Bacteria 1045
298 nmdc:mga0n895_322001_c1 3300050512 Bacteria 1567
299 nmdc:mga0a205_128442_c1 3300050515 Bacteria 2435
300 nmdc:mga0a205_304063_c1 3300050515 Bacteria 1467
301 nmdc:mga0a205_462396_c1 3300050515 Bacteria 1128
302 nmdc:mga0a205_70739_c1 3300050515 Bacteria 3369
303 Ga0590071_002290 3300059421 Bacteria 4847
304 Ga0590077_036828 3300059426 Bacteria 1080
305 Ga0501082_0004744 3300060353 Bacteria 11857
306 Ga0501082_0165067 3300060353 Bacteria 1924
307 Ga0070666_10120095
308 rootH2_10042321
309 rootL2_10002661
310 rootL2_10022855
311 rootH1_10038386
312 Ga0065714_10089758
313 Ga0065712_10001185
314 Ga0065712_10005015
315 Ga0065712_10085505
316 Ga0065712_10174937
317 Ga0065707_10171573
318 Ga0070676_10214535
319 Ga0070670_100002830
320 Ga0070670_100144247
321 Ga0070670_100347322
322 Ga0068869_100156947
323 Ga0070666_10183979
324 Ga0070680_100125008
325 Ga0068868_100025284
326 Ga0068868_100293060
327 Ga0070689_100027018
328 Ga0070689_100518689
329 Ga0070661_100066774
330 Ga0070661_100168896
331 Ga0070668_100164320
332 Ga0070669_100017109
333 Ga0070669_100032402
334 Ga0070669_100114917
335 Ga0070675_100009082
336 Ga0070675_100119696
337 Ga0070675_100122679
338 Ga0070675_100126046
339 Ga0070675_100132122
340 Ga0070671_100118931
341 Ga0070674_100016758
342 Ga0070674_100025054
343 Ga0070674_100225646
344 Ga0070673_100076113
345 Ga0070673_100132843
346 Ga0070673_100146785
347 Ga0070673_100178722
348 Ga0070688_100050172
349 Ga0070688_100241361
350 Ga0070659_100240159
351 Ga0070659_100259811
352 Ga0070703_10065823
353 Ga0070701_10010675
354 Ga0070701_10107029
355 Ga0070700_100154436
356 Ga0070694_100101421
357 Ga0070694_100126871
358 Ga0070694_100160534
359 Ga0070708_100364871
360 Ga0070678_100067545
361 Ga0070678_100116977
362 Ga0070662_100266403
363 Ga0068867_100107141
364 Ga0070685_10082909
365 Ga0070707_100047778
366 Ga0070707_100054764
367 Ga0070707_100514601
368 Ga0070684_100134188
369 Ga0070672_100253387
370 Ga0070686_100303636
371 Ga0070695_100069363
372 Ga0070696_100097924
373 Ga0070696_100132625
374 Ga0070665_100225560
375 Ga0070664_100043198
376 Ga0070664_100300726
377 Ga0068859_100043979
378 Ga0068859_100064485
379 Ga0068859_100117556
380 Ga0068859_100161649
381 Ga0068864_100295502
382 Ga0068864_100493995
383 Ga0068861_100008914
384 Ga0068861_100084471
385 Ga0068861_100160779
386 Ga0068870_10236987
387 Ga0068862_100159331
388 Ga0081539_10003097
389 Ga0081539_10003245
390 Ga0075365_10012779
391 Ga0075363_100094322
392 Ga0075364_10078135
393 Ga0097621_100337439
394 Ga0075428_100008642
395 Ga0075428_100030909
396 Ga0075428_100602048
397 Ga0075430_100019702
398 Ga0075430_100025145
399 Ga0075430_100083628
400 Ga0075431_100000577
401 Ga0075431_100027575
402 Ga0075431_100206253
403 Ga0075433_10365286
404 Ga0075433_10473976
405 Ga0075429_100000949
406 Ga0075429_100060217
407 Ga0075429_100223413
408 Ga0075429_100474904
409 Ga0068865_100255460
410 Ga0097620_100043979
411 Ga0097620_100064484
412 Ga0097620_100117556
413 Ga0097620_100161637
414 Ga0111539_10004119
415 Ga0111539_10010561
416 Ga0111539_10044203
417 Ga0111539_10073761
418 Ga0111539_10222604
419 Ga0111539_10288323
420 Ga0111539_10355844
421 Ga0105245_10364166
422 Ga0114129_10003600
423 Ga0114129_10010763
424 Ga0114129_10042915
425 Ga0114129_10046079
426 Ga0114129_10046331
427 Ga0114129_10046953
428 Ga0114129_10076562
429 Ga0114129_10430352
430 Ga0105243_10022023
431 Ga0105243_10388803
432 Ga0105249_10594906
433 Ga0105249_10730607
434 Ga0157374_10154730
435 Ga0157375_10242363
436 Ga0163163_10013148
437 Ga0163163_10119320
438 Ga0163163_10186977
439 Ga0163163_10528819
440 Ga0163163_11013949
441 Ga0157380_10020120
442 Ga0157380_10024824
443 Ga0157380_10037707
444 Ga0157380_10175755
445 Ga0157380_10295752
446 Ga0157380_10668885
447 Ga0157377_10008611
448 Ga0207697_10001479
449 Ga0207653_10073519
450 Ga0207642_10027731
451 Ga0207688_10032116
452 Ga0207688_10051481
453 Ga0207680_10090122
454 Ga0207645_10193945
455 Ga0207643_10071261
456 Ga0207643_10085724
457 Ga0207684_10037891
458 Ga0207660_10239853
459 Ga0207646_10038943
460 Ga0207681_10052819
461 Ga0207650_10003579
462 Ga0207659_10014532
463 Ga0207659_10063651
464 Ga0207659_10069967
465 Ga0207659_10075588
466 Ga0207659_10205974
467 Ga0207659_10255288
468 Ga0207659_10470702
469 Ga0207687_10311208
470 Ga0207644_10103051
471 Ga0207644_10446506
472 Ga0207686_10042316
473 Ga0207709_10110403
474 Ga0207670_10029221
475 Ga0207670_10201518
476 Ga0207670_10403799
477 Ga0207669_10046073
478 Ga0207704_10114391
479 Ga0207691_10007390
480 Ga0207691_10011101
481 Ga0207691_10056004
482 Ga0207691_10064832
483 Ga0207691_10308683
484 Ga0207691_10403226
485 Ga0207689_10011227
486 Ga0207689_10090383
487 Ga0207679_10402915
488 Ga0207651_10045296
489 Ga0207651_10104643
490 Ga0207668_10109327
491 Ga0207677_10087097
492 Ga0207703_10228475
493 Ga0207678_10082999
494 Ga0207708_10005771
495 Ga0207708_10109155
496 Ga0207641_10003248
497 Ga0207648_10000749
498 Ga0207648_10408822
499 Ga0207676_10057654
500 Ga0207676_10633504
501 Ga0207675_100036146
502 Ga0207675_100056380
503 Ga0207675_100080004
504 Ga0207675_100143504
505 Ga0207683_10041948
506 Ga0207683_10070142
507 Ga0207683_10119058
508 Ga0209971_1008459
509 Ga0209974_10015167
510 Ga0207428_10024437
511 Ga0207428_10144886
512 Ga0268266_10179092
513 Ga0268265_10190676
514 Ga0268265_10466535
515 Ga0268265_10585143
516 Ga0268264_10363327
517 Ga0307408_100064898
518 Ga0307408_100113724
519 Ga0307405_10006029
520 Ga0307413_10009122
521 Ga0307410_10017283
522 Ga0307407_10117780
523 Ga0307412_10007184
524 Ga0307409_100008696
525 Ga0307416_100020209
526 Ga0307416_100025281
527 Ga0307414_10175480
528 Ga0307411_10043215
529 Ga0307411_10343121
530 Ga0307415_100024900
531 Ga0307415_100241604
532 Ga0395905_0122264
533 Ga0439461_0010389
534 Ga0451853_0618548
535 Ga0439446_0058352
536 Ga0439435_0003738
537 Ga0451577_0025270
538 Ga0495594_0076786
539 Ga0495598_0033785
540 Ga0495621_0026838
541 Ga0495633_0153340
542 Ga0495656_0003031
543 Ga0495659_0017141
544 Ga0496102_0030916
545 Ga0496109_0046557
546 Ga0496110_0476743
547 Ga0501032_0006475
548 Ga0501034_0001467
549 Ga0501034_0056631
550 Ga0501036_0026489
551 Ga0501037_0138829
552 Ga0501038_0008173
553 Ga0501041_0094697
554 Ga0501043_0004014
555 Ga0501046_0010553
556 Ga0501046_0087053
557 Ga0501047_0000437
558 Ga0501047_0000784
559 Ga0501048_0012687
560 Ga0501048_0016559
561 Ga0501067_0100045
562 Ga0501068_0003503
563 Ga0501068_0008535
564 Ga0501069_0009950
565 Ga0501069_0092521
566 Ga0501072_0016330
567 Ga0501073_0028605
568 Ga0501075_0072798
569 Ga0501076_0022264
570 Ga0501076_0283325
571 Ga0501080_0006932
572 Ga0501080_0161622
573 Ga0501083_0032591
574 Ga0501083_0063433
575 Ga0501035_0051623
576 Ga0501044_0012191
577 nmdc:mga03n38_156651_c1
578 nmdc:mga0yw44_8696_c1
579 nmdc:mga06z11_102590_c1
580 nmdc:mga07m45_77258_c1
581 nmdc:mga05p37_23941_c1
582 nmdc:mga05p37_25707_c1
583 nmdc:mga05p37_300962_c1
584 nmdc:mga05p37_36271_c1
585 nmdc:mga05p37_388573_c1
586 nmdc:mga05p37_53103_c1
587 nmdc:mga05p37_6879_c1
588 nmdc:mga05p37_89481_c1
589 nmdc:mga05p37_91046_c1
590 nmdc:mga09592_225310_c1
591 nmdc:mga09592_414399_c1
592 nmdc:mga09592_6228_c1
593 nmdc:mga0qj67_951_c1
594 nmdc:mga06r32_2706_c1
595 nmdc:mga06r32_50431_c1
596 nmdc:mga06r32_78350_c1
597 nmdc:mga08y16_108415_c1
598 nmdc:mga08y16_273311_c1
599 nmdc:mga08y16_280837_c1
600 nmdc:mga08y16_34803_c1
601 nmdc:mga08y16_42389_c1
602 nmdc:mga08y16_4806_c1
603 nmdc:mga08y16_664772_c1
604 nmdc:mga0n895_322001_c1
605 nmdc:mga0a205_128442_c1
606 nmdc:mga0a205_304063_c1
607 nmdc:mga0a205_462396_c1
608 nmdc:mga0a205_70739_c1
609 Ga0590071_002290
610 Ga0590077_036828
611 Ga0501082_0004744
612 Ga0501082_0165067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

59

288

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7711 36 252
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.7427 26 257
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.7323 36 252
6r3u-assembly1.cif.gz_A endo-levanase bt1760 mutant e221a from bacteroides thetaiotaomicron complexed with levantetraose 0.7112 40 255
6r3r-assembly1.cif.gz_A first crystal structure of endo-levanase bt1760 from bacteroides thetaiotaomicron 0.7049 40 255
ID Description Score Start End Superfamily
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7711 36 252 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7323 36 252 2.60.120.560
4ffhA02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7093 78 255 2.60.120.560
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6865 26 257 2.60.120.560
3d6eA00 Mainly Beta;Sandwich;Jelly Rolls; 0.6746 25 255 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A1G0LVH3-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9912 76 256 GO:0016787
AF-A0A258LD80-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9901 37 275 GO:0016787
AF-A0A512CHD8-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9898 36 277 GO:0016787
AF-A0A4Q3AYB4-F1-model_v4 deleted 0.9884 115 274
AF-A0A6C0GW18-F1-model_v4 DUF1080 domain-containing protein 0.986 14 277 GO:0016787

Map