F398481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 159 | 306 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10033337|Ga0070666_100333373 |
| Length | 363 |
| Sequence | MGRFTDMKLLVLGGTRFLGRHLVEAALARGHDVTLFTRGVQPVPWAGRVTHLVGNRDPRIAPGLAALETGEWDAAIDTSGYVPRCVKASADAIGERVGNYTFVSSLSVYADSSRPGLDETTPVATLEDPLSEDIAAHYGALKARCEDEVRAAFGRRALVVRPGLIVGPHDPTDRFAYWVARFACPDVLGARPLPAVVPGPPDRAVQFIDARDLGSWMLDMSEREAEGTFDACSPAGTWTMSAFVDVLVAAARASGSPTVPQWIDDDSLLRHDVTPWTGLPLWIPASDQESAGFMHFACARAAAQGLVLRPLAETVADTAAWLRVRDHSNSWRNVLSAEKEREILAAAVPATGASALAPPGMRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 124 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 126 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 127 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 128 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 135 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 136 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 137 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 140 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 141 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 145 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 146 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 147 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.31 |
| Nodule | 0 |
| Rhizoplane | 1.96 |
| Rhizosphere | 95.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10019035 | 3300005327 | Bacteria | 5499 |
| 2 | Ga0070676_10000460 | 3300005328 | Bacteria | 19460 |
| 3 | Ga0070676_10001967 | 3300005328 | Bacteria | 10441 |
| 4 | Ga0070690_100036184 | 3300005330 | Unclassified | 3101 |
| 5 | Ga0070670_100000274 | 3300005331 | Bacteria | 45804 |
| 6 | Ga0070670_100004589 | 3300005331 | Bacteria | 11594 |
| 7 | Ga0070670_100005261 | 3300005331 | Bacteria | 10897 |
| 8 | Ga0070670_100031478 | 3300005331 | Bacteria | 4569 |
| 9 | Ga0070670_100056887 | 3300005331 | Bacteria | 3358 |
| 10 | Ga0070670_100109178 | 3300005331 | Bacteria | 2384 |
| 11 | Ga0068869_100006271 | 3300005334 | Bacteria | 7529 |
| 12 | Ga0068869_100135563 | 3300005334 | Bacteria | 1896 |
| 13 | Ga0070666_10000439 | 3300005335 | Bacteria | 25357 |
| 14 | Ga0070666_10033337 | 3300005335 | Bacteria | 3407 |
| 15 | Ga0068868_100003210 | 3300005338 | Bacteria | 11383 |
| 16 | Ga0068868_100126081 | 3300005338 | Bacteria | 2092 |
| 17 | Ga0070660_100209394 | 3300005339 | Bacteria | 1582 |
| 18 | Ga0070689_100169725 | 3300005340 | Bacteria | 1767 |
| 19 | Ga0070668_100000714 | 3300005347 | Bacteria | 22756 |
| 20 | Ga0070668_100002119 | 3300005347 | Bacteria | 14513 |
| 21 | Ga0070668_100009250 | 3300005347 | Bacteria | 7307 |
| 22 | Ga0070668_100011940 | 3300005347 | Bacteria | 6469 |
| 23 | Ga0070669_100000685 | 3300005353 | Bacteria | 24802 |
| 24 | Ga0070669_100017368 | 3300005353 | Bacteria | 5132 |
| 25 | Ga0070669_100028749 | 3300005353 | Bacteria | 4004 |
| 26 | Ga0070675_100000769 | 3300005354 | Bacteria | 22360 |
| 27 | Ga0070675_100025730 | 3300005354 | Bacteria | 4718 |
| 28 | Ga0070675_100093245 | 3300005354 | Bacteria | 2525 |
| 29 | Ga0070675_100095338 | 3300005354 | Bacteria | 2498 |
| 30 | Ga0070671_100385701 | 3300005355 | Bacteria | 1198 |
| 31 | Ga0070674_100014496 | 3300005356 | Bacteria | 4900 |
| 32 | Ga0070674_100089249 | 3300005356 | Unclassified | 2220 |
| 33 | Ga0070673_100003310 | 3300005364 | Bacteria | 10007 |
| 34 | Ga0070673_100025105 | 3300005364 | Bacteria | 4381 |
| 35 | Ga0070688_100019153 | 3300005365 | Bacteria | 3963 |
| 36 | Ga0070667_100001175 | 3300005367 | Bacteria | 23800 |
| 37 | Ga0070667_100010075 | 3300005367 | Bacteria | 7827 |
| 38 | Ga0070667_100016205 | 3300005367 | Bacteria | 6167 |
| 39 | Ga0070667_100163791 | 3300005367 | Bacteria | 1960 |
| 40 | Ga0070701_10084733 | 3300005438 | Bacteria | 1724 |
| 41 | Ga0070705_100045632 | 3300005440 | Bacteria | 2522 |
| 42 | Ga0070694_100184971 | 3300005444 | Bacteria | 1543 |
| 43 | Ga0070708_100011930 | 3300005445 | Bacteria | 7079 |
| 44 | Ga0070678_100000294 | 3300005456 | Bacteria | 23120 |
| 45 | Ga0070678_100009782 | 3300005456 | Bacteria | 5828 |
| 46 | Ga0070662_100049185 | 3300005457 | Bacteria | 3040 |
| 47 | Ga0070681_10013140 | 3300005458 | Bacteria | 8225 |
| 48 | Ga0068867_100000643 | 3300005459 | Bacteria | 23109 |
| 49 | Ga0068867_100066305 | 3300005459 | Bacteria | 2688 |
| 50 | Ga0070698_100086230 | 3300005471 | Bacteria | 3126 |
| 51 | Ga0070698_100298601 | 3300005471 | Bacteria | 1541 |
| 52 | Ga0070699_100114075 | 3300005518 | Bacteria | 2374 |
| 53 | Ga0070679_100040455 | 3300005530 | Bacteria | 4637 |
| 54 | Ga0068853_100211601 | 3300005539 | Unclassified | 1767 |
| 55 | Ga0070672_100000358 | 3300005543 | Bacteria | 26306 |
| 56 | Ga0070672_100000479 | 3300005543 | Bacteria | 23258 |
| 57 | Ga0070672_100137560 | 3300005543 | Bacteria | 2012 |
| 58 | Ga0070693_100048162 | 3300005547 | Bacteria | 2427 |
| 59 | Ga0070665_100015133 | 3300005548 | Bacteria | 7744 |
| 60 | Ga0070665_100083573 | 3300005548 | Bacteria | 3197 |
| 61 | Ga0070665_100264940 | 3300005548 | Bacteria | 1720 |
| 62 | Ga0070704_100075083 | 3300005549 | Bacteria | 2468 |
| 63 | Ga0070664_100110507 | 3300005564 | Bacteria | 2399 |
| 64 | Ga0070664_100154176 | 3300005564 | Bacteria | 2029 |
| 65 | Ga0068857_100002902 | 3300005577 | Bacteria | 14115 |
| 66 | Ga0068852_100144804 | 3300005616 | Bacteria | 2203 |
| 67 | Ga0068859_100002792 | 3300005617 | Bacteria | 17696 |
| 68 | Ga0068859_100008631 | 3300005617 | Bacteria | 10298 |
| 69 | Ga0068859_100102020 | 3300005617 | Bacteria | 2927 |
| 70 | Ga0068864_100001326 | 3300005618 | Bacteria | 20588 |
| 71 | Ga0068864_100001522 | 3300005618 | Bacteria | 19069 |
| 72 | Ga0068864_100019447 | 3300005618 | Bacteria | 5677 |
| 73 | Ga0068866_10051153 | 3300005718 | Bacteria | 2101 |
| 74 | Ga0068861_100000686 | 3300005719 | Bacteria | 20214 |
| 75 | Ga0068861_100048469 | 3300005719 | Unclassified | 3212 |
| 76 | Ga0068861_100074629 | 3300005719 | Bacteria | 2637 |
| 77 | Ga0068863_100001375 | 3300005841 | Bacteria | 24143 |
| 78 | Ga0068863_100004977 | 3300005841 | Bacteria | 13096 |
| 79 | Ga0068863_100008601 | 3300005841 | Bacteria | 9977 |
| 80 | Ga0068863_100093538 | 3300005841 | Bacteria | 2853 |
| 81 | Ga0068863_100155343 | 3300005841 | Bacteria | 2190 |
| 82 | Ga0068863_100168462 | 3300005841 | Bacteria | 2100 |
| 83 | Ga0068858_100000345 | 3300005842 | Bacteria | 49147 |
| 84 | Ga0068858_100001028 | 3300005842 | Bacteria | 28803 |
| 85 | Ga0068858_100105247 | 3300005842 | Bacteria | 2632 |
| 86 | Ga0068860_100002739 | 3300005843 | Bacteria | 18336 |
| 87 | Ga0068860_100023629 | 3300005843 | Bacteria | 5941 |
| 88 | Ga0068860_100069163 | 3300005843 | Bacteria | 3355 |
| 89 | Ga0068860_100129185 | 3300005843 | Bacteria | 2423 |
| 90 | Ga0068862_100179781 | 3300005844 | Bacteria | 1898 |
| 91 | Ga0081455_10014924 | 3300005937 | Bacteria | 7571 |
| 92 | Ga0075369_10097937 | 3300006186 | Bacteria | 1314 |
| 93 | Ga0075366_10006062 | 3300006195 | Bacteria | 6585 |
| 94 | Ga0075366_10007783 | 3300006195 | Bacteria | 5931 |
| 95 | Ga0097621_100001008 | 3300006237 | Bacteria | 19831 |
| 96 | Ga0097621_100009211 | 3300006237 | Bacteria | 7160 |
| 97 | Ga0068871_100003407 | 3300006358 | Bacteria | 10930 |
| 98 | Ga0075428_100189212 | 3300006844 | Bacteria | 2226 |
| 99 | Ga0075430_100062735 | 3300006846 | Bacteria | 3121 |
| 100 | Ga0075433_10180164 | 3300006852 | Bacteria | 1880 |
| 101 | Ga0075434_100053461 | 3300006871 | Bacteria | 4013 |
| 102 | Ga0075429_100023836 | 3300006880 | Bacteria | 5310 |
| 103 | Ga0068865_100024751 | 3300006881 | Bacteria | 3942 |
| 104 | Ga0068865_100052701 | 3300006881 | Bacteria | 2821 |
| 105 | Ga0097620_100002792 | 3300006931 | Bacteria | 17696 |
| 106 | Ga0097620_100008631 | 3300006931 | Bacteria | 10298 |
| 107 | Ga0097620_100102014 | 3300006931 | Bacteria | 2927 |
| 108 | Ga0111539_10416202 | 3300009094 | Bacteria | 1565 |
| 109 | Ga0105245_10193650 | 3300009098 | Bacteria | 1949 |
| 110 | Ga0114129_10003593 | 3300009147 | Bacteria | 21816 |
| 111 | Ga0114129_10011427 | 3300009147 | Bacteria | 12645 |
| 112 | Ga0114129_10078508 | 3300009147 | Bacteria | 4592 |
| 113 | Ga0114129_10120622 | 3300009147 | Bacteria | 3610 |
| 114 | Ga0114129_10140100 | 3300009147 | Bacteria | 3316 |
| 115 | Ga0114129_10441751 | 3300009147 | Bacteria | 1708 |
| 116 | Ga0105243_10105526 | 3300009148 | Bacteria | 2347 |
| 117 | Ga0105248_10005650 | 3300009177 | Bacteria | 13739 |
| 118 | Ga0105248_10222464 | 3300009177 | Bacteria | 2125 |
| 119 | Ga0105237_10161158 | 3300009545 | Bacteria | 2241 |
| 120 | Ga0105249_10071752 | 3300009553 | Bacteria | 3200 |
| 121 | Ga0105246_10026252 | 3300011119 | Bacteria | 3803 |
| 122 | Ga0157374_10004024 | 3300013296 | Bacteria | 12353 |
| 123 | Ga0157378_10004335 | 3300013297 | Bacteria | 12482 |
| 124 | Ga0157378_10014612 | 3300013297 | Bacteria | 6873 |
| 125 | Ga0163162_10005922 | 3300013306 | Bacteria | 11830 |
| 126 | Ga0163162_10063654 | 3300013306 | Bacteria | 3732 |
| 127 | Ga0163162_10140605 | 3300013306 | Bacteria | 2527 |
| 128 | Ga0157375_10003067 | 3300013308 | Bacteria | 14498 |
| 129 | Ga0157375_10239088 | 3300013308 | Bacteria | 1975 |
| 130 | Ga0163163_10057927 | 3300014325 | Bacteria | 3831 |
| 131 | Ga0163163_10163064 | 3300014325 | Unclassified | 2275 |
| 132 | Ga0163163_10259921 | 3300014325 | Bacteria | 1787 |
| 133 | Ga0157380_10024480 | 3300014326 | Bacteria | 4570 |
| 134 | Ga0157380_10029119 | 3300014326 | Bacteria | 4219 |
| 135 | Ga0157380_10216392 | 3300014326 | Bacteria | 1711 |
| 136 | Ga0157379_10002317 | 3300014968 | Bacteria | 15874 |
| 137 | Ga0157379_10009742 | 3300014968 | Bacteria | 8371 |
| 138 | Ga0157376_10003531 | 3300014969 | Bacteria | 10784 |
| 139 | Ga0157376_10071260 | 3300014969 | Bacteria | 2953 |
| 140 | Ga0157376_10098160 | 3300014969 | Bacteria | 2553 |
| 141 | Ga0163161_10022259 | 3300017792 | Bacteria | 4461 |
| 142 | Ga0163161_10219000 | 3300017792 | Bacteria | 1473 |
| 143 | Ga0213872_10016882 | 3300021361 | Bacteria | 3383 |
| 144 | Ga0213875_10002373 | 3300021388 | Bacteria | 11328 |
| 145 | Ga0207680_10000461 | 3300025903 | Bacteria | 19199 |
| 146 | Ga0207680_10067529 | 3300025903 | Bacteria | 2203 |
| 147 | Ga0207645_10000534 | 3300025907 | Bacteria | 31590 |
| 148 | Ga0207645_10020801 | 3300025907 | Bacteria | 4288 |
| 149 | Ga0207643_10013990 | 3300025908 | Bacteria | 4353 |
| 150 | Ga0207643_10021893 | 3300025908 | Bacteria | 3517 |
| 151 | Ga0207705_10019058 | 3300025909 | Bacteria | 4908 |
| 152 | Ga0207681_10000530 | 3300025923 | Bacteria | 26366 |
| 153 | Ga0207681_10007720 | 3300025923 | Bacteria | 6588 |
| 154 | Ga0207681_10051572 | 3300025923 | Bacteria | 2788 |
| 155 | Ga0207650_10011449 | 3300025925 | Bacteria | 6107 |
| 156 | Ga0207650_10022216 | 3300025925 | Bacteria | 4490 |
| 157 | Ga0207650_10026261 | 3300025925 | Bacteria | 4152 |
| 158 | Ga0207650_10082995 | 3300025925 | Bacteria | 2433 |
| 159 | Ga0207650_10085931 | 3300025925 | Bacteria | 2394 |
| 160 | Ga0207650_10101901 | 3300025925 | Unclassified | 2211 |
| 161 | Ga0207659_10000248 | 3300025926 | Bacteria | 32815 |
| 162 | Ga0207659_10123468 | 3300025926 | Bacteria | 1987 |
| 163 | Ga0207659_10130172 | 3300025926 | Bacteria | 1941 |
| 164 | Ga0207644_10030794 | 3300025931 | Bacteria | 3735 |
| 165 | Ga0207670_10052308 | 3300025936 | Bacteria | 2746 |
| 166 | Ga0207670_10134326 | 3300025936 | Bacteria | 1817 |
| 167 | Ga0207669_10001990 | 3300025937 | Bacteria | 8665 |
| 168 | Ga0207669_10106919 | 3300025937 | Unclassified | 1865 |
| 169 | Ga0207704_10012718 | 3300025938 | Bacteria | 4183 |
| 170 | Ga0207691_10000022 | 3300025940 | Bacteria | 132936 |
| 171 | Ga0207691_10019311 | 3300025940 | Bacteria | 6450 |
| 172 | Ga0207691_10079113 | 3300025940 | Bacteria | 2959 |
| 173 | Ga0207691_10091684 | 3300025940 | Bacteria | 2722 |
| 174 | Ga0207711_10004355 | 3300025941 | Bacteria | 12080 |
| 175 | Ga0207711_10038104 | 3300025941 | Bacteria | 4087 |
| 176 | Ga0207711_10177870 | 3300025941 | Unclassified | 1933 |
| 177 | Ga0207689_10001287 | 3300025942 | Bacteria | 24173 |
| 178 | Ga0207689_10003720 | 3300025942 | Bacteria | 13903 |
| 179 | Ga0207689_10011029 | 3300025942 | Bacteria | 7767 |
| 180 | Ga0207679_10162806 | 3300025945 | Bacteria | 1828 |
| 181 | Ga0207667_10020290 | 3300025949 | Bacteria | 7396 |
| 182 | Ga0207651_10001953 | 3300025960 | Bacteria | 9692 |
| 183 | Ga0207651_10005471 | 3300025960 | Bacteria | 6526 |
| 184 | Ga0207651_10015597 | 3300025960 | Bacteria | 4422 |
| 185 | Ga0207712_10067631 | 3300025961 | Bacteria | 2558 |
| 186 | Ga0207712_10068922 | 3300025961 | Bacteria | 2536 |
| 187 | Ga0207668_10016669 | 3300025972 | Bacteria | 4590 |
| 188 | Ga0207668_10053891 | 3300025972 | Bacteria | 2789 |
| 189 | Ga0207668_10116707 | 3300025972 | Bacteria | 2013 |
| 190 | Ga0207658_10000311 | 3300025986 | Bacteria | 49445 |
| 191 | Ga0207658_10013198 | 3300025986 | Bacteria | 5642 |
| 192 | Ga0207658_10144801 | 3300025986 | Bacteria | 1928 |
| 193 | Ga0207658_10154291 | 3300025986 | Bacteria | 1875 |
| 194 | Ga0207677_10004754 | 3300026023 | Bacteria | 7324 |
| 195 | Ga0207677_10138235 | 3300026023 | Bacteria | 1861 |
| 196 | Ga0207677_10177057 | 3300026023 | Bacteria | 1674 |
| 197 | Ga0207703_10002140 | 3300026035 | Bacteria | 17359 |
| 198 | Ga0207703_10074933 | 3300026035 | Bacteria | 2803 |
| 199 | Ga0207703_10112935 | 3300026035 | Bacteria | 2322 |
| 200 | Ga0207639_10319847 | 3300026041 | Bacteria | 1377 |
| 201 | Ga0207708_10153898 | 3300026075 | Bacteria | 1812 |
| 202 | Ga0207641_10001378 | 3300026088 | Bacteria | 23986 |
| 203 | Ga0207641_10022242 | 3300026088 | Bacteria | 5218 |
| 204 | Ga0207641_10064182 | 3300026088 | Bacteria | 3138 |
| 205 | Ga0207641_10068207 | 3300026088 | Bacteria | 3049 |
| 206 | Ga0207648_10001109 | 3300026089 | Bacteria | 30196 |
| 207 | Ga0207648_10003044 | 3300026089 | Bacteria | 17714 |
| 208 | Ga0207648_10032977 | 3300026089 | Bacteria | 4570 |
| 209 | Ga0207648_10038927 | 3300026089 | Bacteria | 4183 |
| 210 | Ga0207648_10076640 | 3300026089 | Bacteria | 2914 |
| 211 | Ga0207648_10247057 | 3300026089 | Bacteria | 1590 |
| 212 | Ga0207676_10003105 | 3300026095 | Bacteria | 11852 |
| 213 | Ga0207676_10015480 | 3300026095 | Bacteria | 5502 |
| 214 | Ga0207676_10051319 | 3300026095 | Unclassified | 3220 |
| 215 | Ga0207676_10071967 | 3300026095 | Bacteria | 2777 |
| 216 | Ga0207676_10096016 | 3300026095 | Bacteria | 2446 |
| 217 | Ga0207676_10207526 | 3300026095 | Bacteria | 1735 |
| 218 | Ga0207676_10301913 | 3300026095 | Unclassified | 1462 |
| 219 | Ga0207674_10006183 | 3300026116 | Bacteria | 14125 |
| 220 | Ga0207674_10361744 | 3300026116 | Unclassified | 1402 |
| 221 | Ga0207675_100014447 | 3300026118 | Bacteria | 7361 |
| 222 | Ga0207675_100047503 | 3300026118 | Bacteria | 4008 |
| 223 | Ga0207683_10000108 | 3300026121 | Bacteria | 66917 |
| 224 | Ga0207683_10055912 | 3300026121 | Bacteria | 3461 |
| 225 | Ga0207698_10230870 | 3300026142 | Bacteria | 1680 |
| 226 | Ga0268266_10014018 | 3300028379 | Bacteria | 6901 |
| 227 | Ga0268266_10026733 | 3300028379 | Bacteria | 4911 |
| 228 | Ga0268266_10157893 | 3300028379 | Bacteria | 2050 |
| 229 | Ga0268266_10223432 | 3300028379 | Bacteria | 1732 |
| 230 | Ga0268265_10259810 | 3300028380 | Bacteria | 1543 |
| 231 | Ga0268264_10002130 | 3300028381 | Bacteria | 17661 |
| 232 | Ga0268264_10087937 | 3300028381 | Bacteria | 2673 |
| 233 | Ga0307408_100017902 | 3300031548 | Bacteria | 4749 |
| 234 | Ga0307408_100172217 | 3300031548 | Bacteria | 1729 |
| 235 | Ga0265313_10075415 | 3300031595 | Bacteria | 1543 |
| 236 | Ga0307405_10001957 | 3300031731 | Bacteria | 8897 |
| 237 | Ga0307413_10034206 | 3300031824 | Bacteria | 2902 |
| 238 | Ga0307413_10081436 | 3300031824 | Bacteria | 2075 |
| 239 | Ga0307410_10002110 | 3300031852 | Bacteria | 9439 |
| 240 | Ga0307406_10053200 | 3300031901 | Bacteria | 2578 |
| 241 | Ga0307407_10059170 | 3300031903 | Bacteria | 2230 |
| 242 | Ga0307412_10075051 | 3300031911 | Bacteria | 2318 |
| 243 | Ga0307412_10300561 | 3300031911 | Bacteria | 1268 |
| 244 | Ga0307409_100228274 | 3300031995 | Bacteria | 1685 |
| 245 | Ga0307416_100018148 | 3300032002 | Bacteria | 4949 |
| 246 | Ga0307416_100045622 | 3300032002 | Bacteria | 3452 |
| 247 | Ga0307416_100120492 | 3300032002 | Bacteria | 2336 |
| 248 | Ga0307414_10210916 | 3300032004 | Bacteria | 1587 |
| 249 | Ga0307411_10008327 | 3300032005 | Bacteria | 5363 |
| 250 | Ga0307415_100000768 | 3300032126 | Bacteria | 14498 |
| 251 | Ga0307415_100082828 | 3300032126 | Bacteria | 2296 |
| 252 | Ga0316574_0213965 | 3300035398 | Bacteria | 1236 |
| 253 | Ga0373937_0037367 | 3300036401 | Bacteria | 4425 |
| 254 | Ga0395899_0009525 | 3300037312 | Bacteria | 7456 |
| 255 | Ga0395900_0090692 | 3300037418 | Bacteria | 3141 |
| 256 | Ga0395900_0452067 | 3300037418 | Bacteria | 1241 |
| 257 | Ga0395898_0078333 | 3300037466 | Bacteria | 3189 |
| 258 | Ga0395905_0130913 | 3300037471 | Bacteria | 2359 |
| 259 | Ga0436364_0293059 | 3300037853 | Bacteria | 3216 |
| 260 | Ga0436364_1185577 | 3300037853 | Bacteria | 27424 |
| 261 | Ga0395901_0309200 | 3300038443 | Bacteria | 1637 |
| 262 | Ga0395901_0312030 | 3300038443 | Bacteria | 1628 |
| 263 | Ga0436365_0478204 | 3300039437 | Bacteria | 982 |
| 264 | Ga0436360_0192500 | 3300039438 | Bacteria | 3808 |
| 265 | Ga0436360_0511791 | 3300039438 | Bacteria | 2872 |
| 266 | Ga0436361_0201120 | 3300039447 | Bacteria | 7535 |
| 267 | Ga0436361_0685742 | 3300039447 | Bacteria | 3920 |
| 268 | Ga0436361_0751327 | 3300039447 | Bacteria | 9387 |
| 269 | Ga0436363_1185025 | 3300039450 | Bacteria | 9523 |
| 270 | Ga0439435_0035801 | 3300042436 | Bacteria | 1370 |
| 271 | Ga0451577_0241316 | 3300042876 | Unclassified | 1635 |
| 272 | Ga0453683_0086366 | 3300044673 | Bacteria | 1966 |
| 273 | Ga0466963_0123710 | 3300044694 | Bacteria | 1782 |
| 274 | Ga0453684_0017308 | 3300044712 | Bacteria | 11179 |
| 275 | Ga0453684_0018295 | 3300044712 | Bacteria | 10768 |
| 276 | Ga0453684_0031791 | 3300044712 | Bacteria | 7404 |
| 277 | Ga0453684_0064476 | 3300044712 | Bacteria | 4680 |
| 278 | Ga0453684_0096282 | 3300044712 | Bacteria | 3637 |
| 279 | Ga0453684_0132661 | 3300044712 | Bacteria | 2987 |
| 280 | Ga0453684_0213632 | 3300044712 | Bacteria | 2240 |
| 281 | Ga0453684_0294952 | 3300044712 | Bacteria | 1845 |
| 282 | Ga0453684_0437510 | 3300044712 | Bacteria | 1458 |
| 283 | Ga0453684_0499609 | 3300044712 | Unclassified | 1347 |
| 284 | Ga0451576_0031011 | 3300045051 | Bacteria | 5703 |
| 285 | Ga0495604_0233687 | 3300047317 | Bacteria | 1260 |
| 286 | Ga0495674_0019982 | 3300047319 | Bacteria | 6208 |
| 287 | Ga0495680_0040372 | 3300047322 | Bacteria | 3719 |
| 288 | Ga0496102_0013980 | 3300048905 | Bacteria | 6969 |
| 289 | Ga0496103_0098190 | 3300048906 | Bacteria | 1852 |
| 290 | Ga0496107_0031048 | 3300048910 | Bacteria | 3810 |
| 291 | Ga0496108_0054599 | 3300048911 | Bacteria | 3353 |
| 292 | Ga0496109_0068130 | 3300048912 | Bacteria | 3262 |
| 293 | Ga0496111_0257749 | 3300048914 | Bacteria | 1294 |
| 294 | Ga0501041_0069196 | 3300049577 | Bacteria | 2165 |
| 295 | Ga0501048_0155316 | 3300049582 | Bacteria | 1619 |
| 296 | Ga0501076_0063553 | 3300049592 | Bacteria | 2941 |
| 297 | Ga0501077_0043952 | 3300049593 | Bacteria | 2839 |
| 298 | nmdc:mga05p37_161779_c1 | 3300050507 | Bacteria | 2733 |
| 299 | nmdc:mga05p37_215264_c1 | 3300050507 | Bacteria | 2321 |
| 300 | nmdc:mga05p37_296482_c1 | 3300050507 | Bacteria | 1923 |
| 301 | nmdc:mga05p37_3498_c1 | 3300050507 | Bacteria | 18362 |
| 302 | nmdc:mga09592_70557_c1 | 3300050508 | Bacteria | 2964 |
| 303 | nmdc:mga08y16_122130_c1 | 3300050511 | Bacteria | 2710 |
| 304 | nmdc:mga08x19_186310_c1 | 3300050514 | Bacteria | 1418 |
| 305 | nmdc:mga0a205_88171_c1 | 3300050515 | Bacteria | 2998 |
| 306 | Ga0500635_0000247 | 3300053080 | Bacteria | 23510 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_0478204 | Ga0436365_0478204_17_823 | 266 |
| 2 | 3300050514 | nmdc:mga08x19_186310_c1 | nmdc:mga08x19_186310_c1_452_1396 | 278 |
| 3 | 3300048906 | Ga0496103_0098190 | Ga0496103_0098190_922_1818 | 288 |
| 4 | 3300044694 | Ga0466963_0123710 | Ga0466963_0123710_652_1569 | 302 |
| 5 | 3300037418 | Ga0395900_0452067 | Ga0395900_0452067_70_993 | 305 |
| 6 | 3300031548 | Ga0307408_100172217 | Ga0307408_1001722172 | 307 |
| 7 | 3300031824 | Ga0307413_10034206 | Ga0307413_100342062 | 307 |
| 8 | 3300031901 | Ga0307406_10053200 | Ga0307406_100532002 | 307 |
| 9 | 3300031911 | Ga0307412_10300561 | Ga0307412_103005611 | 307 |
| 10 | 3300031995 | Ga0307409_100228274 | Ga0307409_1002282742 | 307 |
| 11 | 3300032002 | Ga0307416_100120492 | Ga0307416_1001204922 | 307 |
| 12 | 3300032004 | Ga0307414_10210916 | Ga0307414_102109162 | 307 |
| 13 | 3300032126 | Ga0307415_100082828 | Ga0307415_1000828282 | 307 |
| 14 | 3300006871 | Ga0075434_100053461 | Ga0075434_1000534613 | 309 |
| 15 | 3300037312 | Ga0395899_0009525 | Ga0395899_0009525_281_1246 | 309 |
| 16 | 3300037418 | Ga0395900_0090692 | Ga0395900_0090692_14_979 | 309 |
| 17 | 3300037471 | Ga0395905_0130913 | Ga0395905_0130913_1278_2243 | 309 |
| 18 | 3300038443 | Ga0395901_0312030 | Ga0395901_0312030_469_1434 | 309 |
| 19 | 3300031595 | Ga0265313_10075415 | Ga0265313_100754152 | 313 |
| 20 | 3300035398 | Ga0316574_0213965 | Ga0316574_0213965_95_1048 | 316 |
| 21 | 3300053080 | Ga0500635_0000247 | Ga0500635_0000247_16746_17714 | 316 |
| 22 | 3300009094 | Ga0111539_10416202 | Ga0111539_104162022 | 319 |
| 23 | 3300009147 | Ga0114129_10003593 | Ga0114129_100035935 | 319 |
| 24 | 3300050507 | nmdc:mga05p37_161779_c1 | nmdc:mga05p37_161779_c1_214_1176 | 319 |
| 25 | 3300014326 | Ga0157380_10216392 | Ga0157380_102163921 | 320 |
| 26 | 3300037466 | Ga0395898_0078333 | Ga0395898_0078333_1240_2208 | 320 |
| 27 | 3300038443 | Ga0395901_0309200 | Ga0395901_0309200_596_1564 | 320 |
| 28 | 3300005530 | Ga0070679_100040455 | Ga0070679_1000404552 | 321 |
| 29 | 3300005841 | Ga0068863_100093538 | Ga0068863_1000935383 | 323 |
| 30 | 3300025925 | Ga0207650_10082995 | Ga0207650_100829952 | 323 |
| 31 | 3300025937 | Ga0207669_10106919 | Ga0207669_101069192 | 323 |
| 32 | 3300039438 | Ga0436360_0192500 | Ga0436360_0192500_1324_2301 | 323 |
| 33 | 3300047319 | Ga0495674_0019982 | Ga0495674_0019982_3869_4855 | 323 |
| 34 | 3300047322 | Ga0495680_0040372 | Ga0495680_0040372_1627_2613 | 323 |
| 35 | 3300039438 | Ga0436360_0511791 | Ga0436360_0511791_1526_2518 | 324 |
| 36 | 3300042876 | Ga0451577_0241316 | Ga0451577_0241316_631_1608 | 324 |
| 37 | 3300044712 | Ga0453684_0018295 | Ga0453684_0018295_4345_5322 | 324 |
| 38 | 3300044712 | Ga0453684_0132661 | Ga0453684_0132661_47_1027 | 324 |
| 39 | 3300047317 | Ga0495604_0233687 | Ga0495604_0233687_202_1191 | 324 |
| 40 | 3300048914 | Ga0496111_0257749 | Ga0496111_0257749_166_1155 | 324 |
| 41 | 3300005548 | Ga0070665_100264940 | Ga0070665_1002649402 | 325 |
| 42 | 3300044712 | Ga0453684_0017308 | Ga0453684_0017308_2366_3346 | 325 |
| 43 | 3300044712 | Ga0453684_0499609 | Ga0453684_0499609_241_1221 | 325 |
| 44 | 3300005354 | Ga0070675_100025730 | Ga0070675_1000257304 | 326 |
| 45 | 3300005440 | Ga0070705_100045632 | Ga0070705_1000456322 | 326 |
| 46 | 3300005444 | Ga0070694_100184971 | Ga0070694_1001849712 | 326 |
| 47 | 3300005458 | Ga0070681_10013140 | Ga0070681_1001314011 | 326 |
| 48 | 3300005549 | Ga0070704_100075083 | Ga0070704_1000750832 | 326 |
| 49 | 3300032002 | Ga0307416_100018148 | Ga0307416_1000181484 | 326 |
| 50 | 3300037853 | Ga0436364_0293059 | Ga0436364_0293059_879_1871 | 326 |
| 51 | 3300039450 | Ga0436363_1185025 | Ga0436363_1185025_577_1569 | 326 |
| 52 | 3300044712 | Ga0453684_0031791 | Ga0453684_0031791_1226_2209 | 326 |
| 53 | 3300044712 | Ga0453684_0064476 | Ga0453684_0064476_520_1503 | 326 |
| 54 | 3300044712 | Ga0453684_0096282 | Ga0453684_0096282_2462_3445 | 326 |
| 55 | 3300045051 | Ga0451576_0031011 | Ga0451576_0031011_2301_3284 | 326 |
| 56 | 3300005471 | Ga0070698_100086230 | Ga0070698_1000862302 | 328 |
| 57 | 3300005518 | Ga0070699_100114075 | Ga0070699_1001140752 | 328 |
| 58 | 3300009098 | Ga0105245_10193650 | Ga0105245_101936502 | 328 |
| 59 | 3300025960 | Ga0207651_10015597 | Ga0207651_100155973 | 328 |
| 60 | 3300026095 | Ga0207676_10051319 | Ga0207676_100513193 | 328 |
| 61 | 3300036401 | Ga0373937_0037367 | Ga0373937_0037367_2389_3432 | 328 |
| 62 | 3300042436 | Ga0439435_0035801 | Ga0439435_0035801_270_1283 | 328 |
| 63 | 3300044712 | Ga0453684_0294952 | Ga0453684_0294952_377_1369 | 328 |
| 64 | 3300005331 | Ga0070670_100004589 | Ga0070670_1000045899 | 329 |
| 65 | 3300005331 | Ga0070670_100005261 | Ga0070670_1000052617 | 329 |
| 66 | 3300005331 | Ga0070670_100109178 | Ga0070670_1001091783 | 329 |
| 67 | 3300005347 | Ga0070668_100002119 | Ga0070668_1000021196 | 329 |
| 68 | 3300005347 | Ga0070668_100009250 | Ga0070668_1000092505 | 329 |
| 69 | 3300005353 | Ga0070669_100017368 | Ga0070669_1000173683 | 329 |
| 70 | 3300005354 | Ga0070675_100093245 | Ga0070675_1000932453 | 329 |
| 71 | 3300005355 | Ga0070671_100385701 | Ga0070671_1003857011 | 329 |
| 72 | 3300005364 | Ga0070673_100025105 | Ga0070673_1000251052 | 329 |
| 73 | 3300005367 | Ga0070667_100016205 | Ga0070667_1000162054 | 329 |
| 74 | 3300005457 | Ga0070662_100049185 | Ga0070662_1000491852 | 329 |
| 75 | 3300005459 | Ga0068867_100066305 | Ga0068867_1000663052 | 329 |
| 76 | 3300005471 | Ga0070698_100298601 | Ga0070698_1002986011 | 329 |
| 77 | 3300005543 | Ga0070672_100000358 | Ga0070672_10000035810 | 329 |
| 78 | 3300005543 | Ga0070672_100137560 | Ga0070672_1001375602 | 329 |
| 79 | 3300005564 | Ga0070664_100110507 | Ga0070664_1001105072 | 329 |
| 80 | 3300005616 | Ga0068852_100144804 | Ga0068852_1001448042 | 329 |
| 81 | 3300005618 | Ga0068864_100001522 | Ga0068864_1000015221 | 329 |
| 82 | 3300005618 | Ga0068864_100019447 | Ga0068864_1000194474 | 329 |
| 83 | 3300005719 | Ga0068861_100074629 | Ga0068861_1000746293 | 329 |
| 84 | 3300005841 | Ga0068863_100008601 | Ga0068863_1000086014 | 329 |
| 85 | 3300005841 | Ga0068863_100168462 | Ga0068863_1001684622 | 329 |
| 86 | 3300005843 | Ga0068860_100023629 | Ga0068860_1000236294 | 329 |
| 87 | 3300006846 | Ga0075430_100062735 | Ga0075430_1000627352 | 329 |
| 88 | 3300006852 | Ga0075433_10180164 | Ga0075433_101801642 | 329 |
| 89 | 3300006880 | Ga0075429_100023836 | Ga0075429_1000238364 | 329 |
| 90 | 3300009147 | Ga0114129_10011427 | Ga0114129_1001142715 | 329 |
| 91 | 3300009147 | Ga0114129_10078508 | Ga0114129_100785084 | 329 |
| 92 | 3300009147 | Ga0114129_10120622 | Ga0114129_101206222 | 329 |
| 93 | 3300009147 | Ga0114129_10140100 | Ga0114129_101401004 | 329 |
| 94 | 3300009177 | Ga0105248_10222464 | Ga0105248_102224642 | 329 |
| 95 | 3300011119 | Ga0105246_10026252 | Ga0105246_100262523 | 329 |
| 96 | 3300013306 | Ga0163162_10063654 | Ga0163162_100636543 | 329 |
| 97 | 3300014325 | Ga0163163_10259921 | Ga0163163_102599213 | 329 |
| 98 | 3300014326 | Ga0157380_10024480 | Ga0157380_100244803 | 329 |
| 99 | 3300025923 | Ga0207681_10007720 | Ga0207681_100077204 | 329 |
| 100 | 3300025925 | Ga0207650_10085931 | Ga0207650_100859313 | 329 |
| 101 | 3300025925 | Ga0207650_10101901 | Ga0207650_101019012 | 329 |
| 102 | 3300025926 | Ga0207659_10123468 | Ga0207659_101234682 | 329 |
| 103 | 3300025940 | Ga0207691_10019311 | Ga0207691_100193116 | 329 |
| 104 | 3300025940 | Ga0207691_10079113 | Ga0207691_100791133 | 329 |
| 105 | 3300025941 | Ga0207711_10177870 | Ga0207711_101778702 | 329 |
| 106 | 3300025945 | Ga0207679_10162806 | Ga0207679_101628061 | 329 |
| 107 | 3300025972 | Ga0207668_10016669 | Ga0207668_100166692 | 329 |
| 108 | 3300025972 | Ga0207668_10053891 | Ga0207668_100538912 | 329 |
| 109 | 3300025986 | Ga0207658_10013198 | Ga0207658_100131985 | 329 |
| 110 | 3300025986 | Ga0207658_10144801 | Ga0207658_101448012 | 329 |
| 111 | 3300025986 | Ga0207658_10154291 | Ga0207658_101542912 | 329 |
| 112 | 3300026023 | Ga0207677_10138235 | Ga0207677_101382352 | 329 |
| 113 | 3300026035 | Ga0207703_10112935 | Ga0207703_101129352 | 329 |
| 114 | 3300026088 | Ga0207641_10022242 | Ga0207641_100222422 | 329 |
| 115 | 3300026089 | Ga0207648_10038927 | Ga0207648_100389274 | 329 |
| 116 | 3300026089 | Ga0207648_10076640 | Ga0207648_100766402 | 329 |
| 117 | 3300026095 | Ga0207676_10071967 | Ga0207676_100719672 | 329 |
| 118 | 3300026095 | Ga0207676_10096016 | Ga0207676_100960163 | 329 |
| 119 | 3300026095 | Ga0207676_10207526 | Ga0207676_102075262 | 329 |
| 120 | 3300026116 | Ga0207674_10361744 | Ga0207674_103617442 | 329 |
| 121 | 3300026118 | Ga0207675_100047503 | Ga0207675_1000475034 | 329 |
| 122 | 3300028379 | Ga0268266_10026733 | Ga0268266_100267335 | 329 |
| 123 | 3300028379 | Ga0268266_10223432 | Ga0268266_102234322 | 329 |
| 124 | 3300028381 | Ga0268264_10087937 | Ga0268264_100879372 | 329 |
| 125 | 3300044673 | Ga0453683_0086366 | Ga0453683_0086366_843_1835 | 329 |
| 126 | 3300044712 | Ga0453684_0213632 | Ga0453684_0213632_236_1234 | 329 |
| 127 | 3300044712 | Ga0453684_0437510 | Ga0453684_0437510_211_1203 | 329 |
| 128 | 3300049577 | Ga0501041_0069196 | Ga0501041_0069196_593_1588 | 329 |
| 129 | 3300049582 | Ga0501048_0155316 | Ga0501048_0155316_228_1223 | 329 |
| 130 | 3300049592 | Ga0501076_0063553 | Ga0501076_0063553_1157_2152 | 329 |
| 131 | 3300049593 | Ga0501077_0043952 | Ga0501077_0043952_1123_2118 | 329 |
| 132 | 3300050507 | nmdc:mga05p37_215264_c1 | nmdc:mga05p37_215264_c1_1112_2104 | 329 |
| 133 | 3300050507 | nmdc:mga05p37_296482_c1 | nmdc:mga05p37_296482_c1_163_1155 | 329 |
| 134 | 3300050507 | nmdc:mga05p37_3498_c1 | nmdc:mga05p37_3498_c1_6912_7904 | 329 |
| 135 | 3300050508 | nmdc:mga09592_70557_c1 | nmdc:mga09592_70557_c1_1232_2224 | 329 |
| 136 | 3300050511 | nmdc:mga08y16_122130_c1 | nmdc:mga08y16_122130_c1_1555_2577 | 329 |
| 137 | 3300050515 | nmdc:mga0a205_88171_c1 | nmdc:mga0a205_88171_c1_1435_2427 | 329 |
| 138 | 3300006195 | Ga0075366_10006062 | Ga0075366_100060623 | 330 |
| 139 | 3300021388 | Ga0213875_10002373 | Ga0213875_100023735 | 330 |
| 140 | 3300025923 | Ga0207681_10051572 | Ga0207681_100515722 | 330 |
| 141 | 3300025926 | Ga0207659_10130172 | Ga0207659_101301722 | 330 |
| 142 | 3300037853 | Ga0436364_1185577 | Ga0436364_1185577_21776_22789 | 330 |
| 143 | 3300005445 | Ga0070708_100011930 | Ga0070708_1000119307 | 331 |
| 144 | 3300005328 | Ga0070676_10001967 | Ga0070676_100019679 | 332 |
| 145 | 3300005331 | Ga0070670_100000274 | Ga0070670_10000027427 | 332 |
| 146 | 3300005331 | Ga0070670_100031478 | Ga0070670_1000314784 | 332 |
| 147 | 3300005339 | Ga0070660_100209394 | Ga0070660_1002093942 | 332 |
| 148 | 3300005367 | Ga0070667_100010075 | Ga0070667_1000100757 | 332 |
| 149 | 3300005539 | Ga0068853_100211601 | Ga0068853_1002116012 | 332 |
| 150 | 3300005547 | Ga0070693_100048162 | Ga0070693_1000481622 | 332 |
| 151 | 3300005564 | Ga0070664_100154176 | Ga0070664_1001541762 | 332 |
| 152 | 3300005577 | Ga0068857_100002902 | Ga0068857_1000029028 | 332 |
| 153 | 3300005617 | Ga0068859_100002792 | Ga0068859_1000027922 | 332 |
| 154 | 3300005719 | Ga0068861_100000686 | Ga0068861_1000006865 | 332 |
| 155 | 3300005841 | Ga0068863_100004977 | Ga0068863_10000497712 | 332 |
| 156 | 3300005842 | Ga0068858_100000345 | Ga0068858_10000034545 | 332 |
| 157 | 3300006844 | Ga0075428_100189212 | Ga0075428_1001892123 | 332 |
| 158 | 3300006881 | Ga0068865_100052701 | Ga0068865_1000527012 | 332 |
| 159 | 3300006931 | Ga0097620_100002792 | Ga0097620_10000279218 | 332 |
| 160 | 3300009147 | Ga0114129_10441751 | Ga0114129_104417513 | 332 |
| 161 | 3300013297 | Ga0157378_10004335 | Ga0157378_100043355 | 332 |
| 162 | 3300013306 | Ga0163162_10140605 | Ga0163162_101406052 | 332 |
| 163 | 3300014325 | Ga0163163_10057927 | Ga0163163_100579272 | 332 |
| 164 | 3300014968 | Ga0157379_10002317 | Ga0157379_1000231716 | 332 |
| 165 | 3300014969 | Ga0157376_10071260 | Ga0157376_100712602 | 332 |
| 166 | 3300017792 | Ga0163161_10219000 | Ga0163161_102190001 | 332 |
| 167 | 3300025903 | Ga0207680_10067529 | Ga0207680_100675292 | 332 |
| 168 | 3300025907 | Ga0207645_10020801 | Ga0207645_100208012 | 332 |
| 169 | 3300025908 | Ga0207643_10013990 | Ga0207643_100139902 | 332 |
| 170 | 3300025925 | Ga0207650_10011449 | Ga0207650_100114496 | 332 |
| 171 | 3300025925 | Ga0207650_10022216 | Ga0207650_100222164 | 332 |
| 172 | 3300025936 | Ga0207670_10052308 | Ga0207670_100523082 | 332 |
| 173 | 3300025940 | Ga0207691_10091684 | Ga0207691_100916843 | 332 |
| 174 | 3300025941 | Ga0207711_10038104 | Ga0207711_100381043 | 332 |
| 175 | 3300025942 | Ga0207689_10003720 | Ga0207689_100037205 | 332 |
| 176 | 3300025949 | Ga0207667_10020290 | Ga0207667_100202906 | 332 |
| 177 | 3300025960 | Ga0207651_10005471 | Ga0207651_100054714 | 332 |
| 178 | 3300025972 | Ga0207668_10116707 | Ga0207668_101167072 | 332 |
| 179 | 3300026035 | Ga0207703_10074933 | Ga0207703_100749333 | 332 |
| 180 | 3300026041 | Ga0207639_10319847 | Ga0207639_103198472 | 332 |
| 181 | 3300026088 | Ga0207641_10064182 | Ga0207641_100641822 | 332 |
| 182 | 3300026089 | Ga0207648_10003044 | Ga0207648_1000304416 | 332 |
| 183 | 3300026095 | Ga0207676_10003105 | Ga0207676_1000310511 | 332 |
| 184 | 3300026116 | Ga0207674_10006183 | Ga0207674_100061838 | 332 |
| 185 | 3300048905 | Ga0496102_0013980 | Ga0496102_0013980_764_1795 | 332 |
| 186 | 3300048912 | Ga0496109_0068130 | Ga0496109_0068130_1052_2083 | 332 |
| 187 | 3300005331 | Ga0070670_100056887 | Ga0070670_1000568873 | 333 |
| 188 | 3300005347 | Ga0070668_100011940 | Ga0070668_1000119408 | 333 |
| 189 | 3300005353 | Ga0070669_100028749 | Ga0070669_1000287491 | 333 |
| 190 | 3300005841 | Ga0068863_100155343 | Ga0068863_1001553432 | 333 |
| 191 | 3300005843 | Ga0068860_100129185 | Ga0068860_1001291852 | 333 |
| 192 | 3300006186 | Ga0075369_10097937 | Ga0075369_100979372 | 333 |
| 193 | 3300006195 | Ga0075366_10007783 | Ga0075366_100077833 | 333 |
| 194 | 3300009545 | Ga0105237_10161158 | Ga0105237_101611581 | 333 |
| 195 | 3300025925 | Ga0207650_10026261 | Ga0207650_100262613 | 333 |
| 196 | 3300026088 | Ga0207641_10068207 | Ga0207641_100682072 | 333 |
| 197 | 3300005937 | Ga0081455_10014924 | Ga0081455_100149243 | 334 |
| 198 | 3300031548 | Ga0307408_100017902 | Ga0307408_1000179024 | 334 |
| 199 | 3300031731 | Ga0307405_10001957 | Ga0307405_100019575 | 334 |
| 200 | 3300031824 | Ga0307413_10081436 | Ga0307413_100814362 | 334 |
| 201 | 3300031852 | Ga0307410_10002110 | Ga0307410_100021103 | 334 |
| 202 | 3300031903 | Ga0307407_10059170 | Ga0307407_100591702 | 334 |
| 203 | 3300031911 | Ga0307412_10075051 | Ga0307412_100750512 | 334 |
| 204 | 3300032002 | Ga0307416_100045622 | Ga0307416_1000456222 | 334 |
| 205 | 3300032005 | Ga0307411_10008327 | Ga0307411_100083275 | 334 |
| 206 | 3300032126 | Ga0307415_100000768 | Ga0307415_1000007686 | 334 |
| 207 | 3300005328 | Ga0070676_10000460 | Ga0070676_100004603 | 335 |
| 208 | 3300005330 | Ga0070690_100036184 | Ga0070690_1000361843 | 335 |
| 209 | 3300005334 | Ga0068869_100006271 | Ga0068869_1000062715 | 335 |
| 210 | 3300005335 | Ga0070666_10000439 | Ga0070666_100004398 | 335 |
| 211 | 3300005338 | Ga0068868_100003210 | Ga0068868_1000032105 | 335 |
| 212 | 3300005340 | Ga0070689_100169725 | Ga0070689_1001697252 | 335 |
| 213 | 3300005347 | Ga0070668_100000714 | Ga0070668_1000007147 | 335 |
| 214 | 3300005353 | Ga0070669_100000685 | Ga0070669_10000068510 | 335 |
| 215 | 3300005354 | Ga0070675_100000769 | Ga0070675_10000076919 | 335 |
| 216 | 3300005356 | Ga0070674_100014496 | Ga0070674_1000144962 | 335 |
| 217 | 3300005364 | Ga0070673_100003310 | Ga0070673_1000033103 | 335 |
| 218 | 3300005367 | Ga0070667_100001175 | Ga0070667_1000011758 | 335 |
| 219 | 3300005438 | Ga0070701_10084733 | Ga0070701_100847332 | 335 |
| 220 | 3300005456 | Ga0070678_100000294 | Ga0070678_1000002947 | 335 |
| 221 | 3300005459 | Ga0068867_100000643 | Ga0068867_1000006439 | 335 |
| 222 | 3300005543 | Ga0070672_100000479 | Ga0070672_1000004797 | 335 |
| 223 | 3300005548 | Ga0070665_100083573 | Ga0070665_1000835733 | 335 |
| 224 | 3300005617 | Ga0068859_100008631 | Ga0068859_10000863112 | 335 |
| 225 | 3300005618 | Ga0068864_100001326 | Ga0068864_1000013264 | 335 |
| 226 | 3300005719 | Ga0068861_100048469 | Ga0068861_1000484692 | 335 |
| 227 | 3300005841 | Ga0068863_100001375 | Ga0068863_1000013759 | 335 |
| 228 | 3300005842 | Ga0068858_100001028 | Ga0068858_1000010288 | 335 |
| 229 | 3300005843 | Ga0068860_100002739 | Ga0068860_10000273913 | 335 |
| 230 | 3300006237 | Ga0097621_100001008 | Ga0097621_10000100817 | 335 |
| 231 | 3300006358 | Ga0068871_100003407 | Ga0068871_1000034077 | 335 |
| 232 | 3300006881 | Ga0068865_100024751 | Ga0068865_1000247514 | 335 |
| 233 | 3300006931 | Ga0097620_100008631 | Ga0097620_10000863112 | 335 |
| 234 | 3300009177 | Ga0105248_10005650 | Ga0105248_100056503 | 335 |
| 235 | 3300009553 | Ga0105249_10071752 | Ga0105249_100717523 | 335 |
| 236 | 3300013296 | Ga0157374_10004024 | Ga0157374_1000402410 | 335 |
| 237 | 3300013306 | Ga0163162_10005922 | Ga0163162_100059223 | 335 |
| 238 | 3300013308 | Ga0157375_10003067 | Ga0157375_100030679 | 335 |
| 239 | 3300014968 | Ga0157379_10009742 | Ga0157379_100097421 | 335 |
| 240 | 3300014969 | Ga0157376_10003531 | Ga0157376_100035319 | 335 |
| 241 | 3300017792 | Ga0163161_10022259 | Ga0163161_100222593 | 335 |
| 242 | 3300021361 | Ga0213872_10016882 | Ga0213872_100168822 | 335 |
| 243 | 3300025903 | Ga0207680_10000461 | Ga0207680_100004614 | 335 |
| 244 | 3300025907 | Ga0207645_10000534 | Ga0207645_100005343 | 335 |
| 245 | 3300025923 | Ga0207681_10000530 | Ga0207681_1000053023 | 335 |
| 246 | 3300025926 | Ga0207659_10000248 | Ga0207659_1000024833 | 335 |
| 247 | 3300025936 | Ga0207670_10134326 | Ga0207670_101343262 | 335 |
| 248 | 3300025937 | Ga0207669_10001990 | Ga0207669_100019902 | 335 |
| 249 | 3300025938 | Ga0207704_10012718 | Ga0207704_100127182 | 335 |
| 250 | 3300025940 | Ga0207691_10000022 | Ga0207691_1000002264 | 335 |
| 251 | 3300025941 | Ga0207711_10004355 | Ga0207711_100043553 | 335 |
| 252 | 3300025942 | Ga0207689_10001287 | Ga0207689_1000128716 | 335 |
| 253 | 3300025960 | Ga0207651_10001953 | Ga0207651_100019533 | 335 |
| 254 | 3300025961 | Ga0207712_10068922 | Ga0207712_100689222 | 335 |
| 255 | 3300025986 | Ga0207658_10000311 | Ga0207658_100003117 | 335 |
| 256 | 3300026023 | Ga0207677_10004754 | Ga0207677_100047549 | 335 |
| 257 | 3300026035 | Ga0207703_10002140 | Ga0207703_1000214010 | 335 |
| 258 | 3300026088 | Ga0207641_10001378 | Ga0207641_100013789 | 335 |
| 259 | 3300026089 | Ga0207648_10001109 | Ga0207648_1000110921 | 335 |
| 260 | 3300026095 | Ga0207676_10015480 | Ga0207676_100154805 | 335 |
| 261 | 3300026118 | Ga0207675_100014447 | Ga0207675_1000144472 | 335 |
| 262 | 3300026121 | Ga0207683_10000108 | Ga0207683_1000010851 | 335 |
| 263 | 3300028379 | Ga0268266_10014018 | Ga0268266_100140188 | 335 |
| 264 | 3300028381 | Ga0268264_10002130 | Ga0268264_100021304 | 335 |
| 265 | 3300039447 | Ga0436361_0201120 | Ga0436361_0201120_6353_7405 | 335 |
| 266 | 3300039447 | Ga0436361_0685742 | Ga0436361_0685742_116_1168 | 335 |
| 267 | 3300039447 | Ga0436361_0751327 | Ga0436361_0751327_7998_9050 | 335 |
| 268 | 3300048910 | Ga0496107_0031048 | Ga0496107_0031048_2051_3088 | 335 |
| 269 | 3300048911 | Ga0496108_0054599 | Ga0496108_0054599_743_1780 | 335 |
| 270 | 3300005334 | Ga0068869_100135563 | Ga0068869_1001355632 | 336 |
| 271 | 3300005335 | Ga0070666_10033337 | Ga0070666_100333373 | 336 |
| 272 | 3300005338 | Ga0068868_100126081 | Ga0068868_1001260812 | 336 |
| 273 | 3300005354 | Ga0070675_100095338 | Ga0070675_1000953382 | 336 |
| 274 | 3300005356 | Ga0070674_100089249 | Ga0070674_1000892492 | 336 |
| 275 | 3300005365 | Ga0070688_100019153 | Ga0070688_1000191534 | 336 |
| 276 | 3300005367 | Ga0070667_100163791 | Ga0070667_1001637912 | 336 |
| 277 | 3300005456 | Ga0070678_100009782 | Ga0070678_1000097826 | 336 |
| 278 | 3300005548 | Ga0070665_100015133 | Ga0070665_1000151334 | 336 |
| 279 | 3300005617 | Ga0068859_100102020 | Ga0068859_1001020202 | 336 |
| 280 | 3300005718 | Ga0068866_10051153 | Ga0068866_100511532 | 336 |
| 281 | 3300005842 | Ga0068858_100105247 | Ga0068858_1001052473 | 336 |
| 282 | 3300005843 | Ga0068860_100069163 | Ga0068860_1000691632 | 336 |
| 283 | 3300005844 | Ga0068862_100179781 | Ga0068862_1001797812 | 336 |
| 284 | 3300006237 | Ga0097621_100009211 | Ga0097621_1000092119 | 336 |
| 285 | 3300006931 | Ga0097620_100102014 | Ga0097620_1001020142 | 336 |
| 286 | 3300009148 | Ga0105243_10105526 | Ga0105243_101055262 | 336 |
| 287 | 3300013297 | Ga0157378_10014612 | Ga0157378_100146124 | 336 |
| 288 | 3300013308 | Ga0157375_10239088 | Ga0157375_102390882 | 336 |
| 289 | 3300014325 | Ga0163163_10163064 | Ga0163163_101630641 | 336 |
| 290 | 3300014969 | Ga0157376_10098160 | Ga0157376_100981603 | 336 |
| 291 | 3300025908 | Ga0207643_10021893 | Ga0207643_100218933 | 336 |
| 292 | 3300025931 | Ga0207644_10030794 | Ga0207644_100307943 | 336 |
| 293 | 3300025942 | Ga0207689_10011029 | Ga0207689_100110292 | 336 |
| 294 | 3300025961 | Ga0207712_10067631 | Ga0207712_100676312 | 336 |
| 295 | 3300026023 | Ga0207677_10177057 | Ga0207677_101770572 | 336 |
| 296 | 3300026075 | Ga0207708_10153898 | Ga0207708_101538982 | 336 |
| 297 | 3300026089 | Ga0207648_10032977 | Ga0207648_100329773 | 336 |
| 298 | 3300026095 | Ga0207676_10301913 | Ga0207676_103019132 | 336 |
| 299 | 3300026121 | Ga0207683_10055912 | Ga0207683_100559122 | 336 |
| 300 | 3300028379 | Ga0268266_10157893 | Ga0268266_101578932 | 336 |
| 301 | 3300028380 | Ga0268265_10259810 | Ga0268265_102598102 | 336 |
| 302 | 3300005327 | Ga0070658_10019035 | Ga0070658_100190356 | 338 |
| 303 | 3300014326 | Ga0157380_10029119 | Ga0157380_100291193 | 338 |
| 304 | 3300025909 | Ga0207705_10019058 | Ga0207705_100190582 | 338 |
| 305 | 3300026089 | Ga0207648_10247057 | Ga0207648_102470573 | 338 |
| 306 | 3300026142 | Ga0207698_10230870 | Ga0207698_102308702 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pvi-assembly1.cif.gz_A | crystal structure of phqk in complex with paraherquamide l | 0.8869 | 2 | 32 |
| 3m2p-assembly3.cif.gz_D | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.7789 | 1 | 314 |
| 2dwc-assembly1.cif.gz_B | crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp | 0.7727 | 1 | 71 |
| 3m2p-assembly3.cif.gz_D | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.7715 | 1 | 314 |
| 3m2p-assembly2.cif.gz_F | the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus | 0.7688 | 1 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6IP12_4_87_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9067 | 1 | 30 | 3.40.50.20 |
| af_K7MUD1_29_120_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8345 | 1 | 51 | 3.40.50.720 |
| af_K7VJC9_94_197_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8082 | 2 | 51 | 3.40.50.720 |
| af_Q4DI30_3_123_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.783 | 151 | 236 | 3.40.50.720 |
| 4ffoA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7798 | 2 | 72 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D3QAC4-F1-model_v4 | Epimerase | 0.9784 | 91 | 335 |
|
| AF-X1CVB5-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9718 | 40 | 310 |
|
| AF-A0A6M4GXC1-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.971 | 1 | 329 |
GO:0004029
GO:0005737 |
| AF-A0A7W0W7I5-F1-model_v4 | Epimerase | 0.9697 | 1 | 331 |
|
| AF-A0A4P5TLT5-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9688 | 1 | 330 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar