F398481

General Info

Members Datasets Scaffolds Average Seq Length
306 159 306 340

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10033337|Ga0070666_100333373
Length 363
Sequence MGRFTDMKLLVLGGTRFLGRHLVEAALARGHDVTLFTRGVQPVPWAGRVTHLVGNRDPRIAPGLAALETGEWDAAIDTSGYVPRCVKASADAIGERVGNYTFVSSLSVYADSSRPGLDETTPVATLEDPLSEDIAAHYGALKARCEDEVRAAFGRRALVVRPGLIVGPHDPTDRFAYWVARFACPDVLGARPLPAVVPGPPDRAVQFIDARDLGSWMLDMSEREAEGTFDACSPAGTWTMSAFVDVLVAAARASGSPTVPQWIDDDSLLRHDVTPWTGLPLWIPASDQESAGFMHFACARAAAQGLVLRPLAETVADTAAWLRVRDHSNSWRNVLSAEKEREILAAAVPATGASALAPPGMRS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 1.96
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10019035 3300005327 Bacteria 5499
2 Ga0070676_10000460 3300005328 Bacteria 19460
3 Ga0070676_10001967 3300005328 Bacteria 10441
4 Ga0070690_100036184 3300005330 Unclassified 3101
5 Ga0070670_100000274 3300005331 Bacteria 45804
6 Ga0070670_100004589 3300005331 Bacteria 11594
7 Ga0070670_100005261 3300005331 Bacteria 10897
8 Ga0070670_100031478 3300005331 Bacteria 4569
9 Ga0070670_100056887 3300005331 Bacteria 3358
10 Ga0070670_100109178 3300005331 Bacteria 2384
11 Ga0068869_100006271 3300005334 Bacteria 7529
12 Ga0068869_100135563 3300005334 Bacteria 1896
13 Ga0070666_10000439 3300005335 Bacteria 25357
14 Ga0070666_10033337 3300005335 Bacteria 3407
15 Ga0068868_100003210 3300005338 Bacteria 11383
16 Ga0068868_100126081 3300005338 Bacteria 2092
17 Ga0070660_100209394 3300005339 Bacteria 1582
18 Ga0070689_100169725 3300005340 Bacteria 1767
19 Ga0070668_100000714 3300005347 Bacteria 22756
20 Ga0070668_100002119 3300005347 Bacteria 14513
21 Ga0070668_100009250 3300005347 Bacteria 7307
22 Ga0070668_100011940 3300005347 Bacteria 6469
23 Ga0070669_100000685 3300005353 Bacteria 24802
24 Ga0070669_100017368 3300005353 Bacteria 5132
25 Ga0070669_100028749 3300005353 Bacteria 4004
26 Ga0070675_100000769 3300005354 Bacteria 22360
27 Ga0070675_100025730 3300005354 Bacteria 4718
28 Ga0070675_100093245 3300005354 Bacteria 2525
29 Ga0070675_100095338 3300005354 Bacteria 2498
30 Ga0070671_100385701 3300005355 Bacteria 1198
31 Ga0070674_100014496 3300005356 Bacteria 4900
32 Ga0070674_100089249 3300005356 Unclassified 2220
33 Ga0070673_100003310 3300005364 Bacteria 10007
34 Ga0070673_100025105 3300005364 Bacteria 4381
35 Ga0070688_100019153 3300005365 Bacteria 3963
36 Ga0070667_100001175 3300005367 Bacteria 23800
37 Ga0070667_100010075 3300005367 Bacteria 7827
38 Ga0070667_100016205 3300005367 Bacteria 6167
39 Ga0070667_100163791 3300005367 Bacteria 1960
40 Ga0070701_10084733 3300005438 Bacteria 1724
41 Ga0070705_100045632 3300005440 Bacteria 2522
42 Ga0070694_100184971 3300005444 Bacteria 1543
43 Ga0070708_100011930 3300005445 Bacteria 7079
44 Ga0070678_100000294 3300005456 Bacteria 23120
45 Ga0070678_100009782 3300005456 Bacteria 5828
46 Ga0070662_100049185 3300005457 Bacteria 3040
47 Ga0070681_10013140 3300005458 Bacteria 8225
48 Ga0068867_100000643 3300005459 Bacteria 23109
49 Ga0068867_100066305 3300005459 Bacteria 2688
50 Ga0070698_100086230 3300005471 Bacteria 3126
51 Ga0070698_100298601 3300005471 Bacteria 1541
52 Ga0070699_100114075 3300005518 Bacteria 2374
53 Ga0070679_100040455 3300005530 Bacteria 4637
54 Ga0068853_100211601 3300005539 Unclassified 1767
55 Ga0070672_100000358 3300005543 Bacteria 26306
56 Ga0070672_100000479 3300005543 Bacteria 23258
57 Ga0070672_100137560 3300005543 Bacteria 2012
58 Ga0070693_100048162 3300005547 Bacteria 2427
59 Ga0070665_100015133 3300005548 Bacteria 7744
60 Ga0070665_100083573 3300005548 Bacteria 3197
61 Ga0070665_100264940 3300005548 Bacteria 1720
62 Ga0070704_100075083 3300005549 Bacteria 2468
63 Ga0070664_100110507 3300005564 Bacteria 2399
64 Ga0070664_100154176 3300005564 Bacteria 2029
65 Ga0068857_100002902 3300005577 Bacteria 14115
66 Ga0068852_100144804 3300005616 Bacteria 2203
67 Ga0068859_100002792 3300005617 Bacteria 17696
68 Ga0068859_100008631 3300005617 Bacteria 10298
69 Ga0068859_100102020 3300005617 Bacteria 2927
70 Ga0068864_100001326 3300005618 Bacteria 20588
71 Ga0068864_100001522 3300005618 Bacteria 19069
72 Ga0068864_100019447 3300005618 Bacteria 5677
73 Ga0068866_10051153 3300005718 Bacteria 2101
74 Ga0068861_100000686 3300005719 Bacteria 20214
75 Ga0068861_100048469 3300005719 Unclassified 3212
76 Ga0068861_100074629 3300005719 Bacteria 2637
77 Ga0068863_100001375 3300005841 Bacteria 24143
78 Ga0068863_100004977 3300005841 Bacteria 13096
79 Ga0068863_100008601 3300005841 Bacteria 9977
80 Ga0068863_100093538 3300005841 Bacteria 2853
81 Ga0068863_100155343 3300005841 Bacteria 2190
82 Ga0068863_100168462 3300005841 Bacteria 2100
83 Ga0068858_100000345 3300005842 Bacteria 49147
84 Ga0068858_100001028 3300005842 Bacteria 28803
85 Ga0068858_100105247 3300005842 Bacteria 2632
86 Ga0068860_100002739 3300005843 Bacteria 18336
87 Ga0068860_100023629 3300005843 Bacteria 5941
88 Ga0068860_100069163 3300005843 Bacteria 3355
89 Ga0068860_100129185 3300005843 Bacteria 2423
90 Ga0068862_100179781 3300005844 Bacteria 1898
91 Ga0081455_10014924 3300005937 Bacteria 7571
92 Ga0075369_10097937 3300006186 Bacteria 1314
93 Ga0075366_10006062 3300006195 Bacteria 6585
94 Ga0075366_10007783 3300006195 Bacteria 5931
95 Ga0097621_100001008 3300006237 Bacteria 19831
96 Ga0097621_100009211 3300006237 Bacteria 7160
97 Ga0068871_100003407 3300006358 Bacteria 10930
98 Ga0075428_100189212 3300006844 Bacteria 2226
99 Ga0075430_100062735 3300006846 Bacteria 3121
100 Ga0075433_10180164 3300006852 Bacteria 1880
101 Ga0075434_100053461 3300006871 Bacteria 4013
102 Ga0075429_100023836 3300006880 Bacteria 5310
103 Ga0068865_100024751 3300006881 Bacteria 3942
104 Ga0068865_100052701 3300006881 Bacteria 2821
105 Ga0097620_100002792 3300006931 Bacteria 17696
106 Ga0097620_100008631 3300006931 Bacteria 10298
107 Ga0097620_100102014 3300006931 Bacteria 2927
108 Ga0111539_10416202 3300009094 Bacteria 1565
109 Ga0105245_10193650 3300009098 Bacteria 1949
110 Ga0114129_10003593 3300009147 Bacteria 21816
111 Ga0114129_10011427 3300009147 Bacteria 12645
112 Ga0114129_10078508 3300009147 Bacteria 4592
113 Ga0114129_10120622 3300009147 Bacteria 3610
114 Ga0114129_10140100 3300009147 Bacteria 3316
115 Ga0114129_10441751 3300009147 Bacteria 1708
116 Ga0105243_10105526 3300009148 Bacteria 2347
117 Ga0105248_10005650 3300009177 Bacteria 13739
118 Ga0105248_10222464 3300009177 Bacteria 2125
119 Ga0105237_10161158 3300009545 Bacteria 2241
120 Ga0105249_10071752 3300009553 Bacteria 3200
121 Ga0105246_10026252 3300011119 Bacteria 3803
122 Ga0157374_10004024 3300013296 Bacteria 12353
123 Ga0157378_10004335 3300013297 Bacteria 12482
124 Ga0157378_10014612 3300013297 Bacteria 6873
125 Ga0163162_10005922 3300013306 Bacteria 11830
126 Ga0163162_10063654 3300013306 Bacteria 3732
127 Ga0163162_10140605 3300013306 Bacteria 2527
128 Ga0157375_10003067 3300013308 Bacteria 14498
129 Ga0157375_10239088 3300013308 Bacteria 1975
130 Ga0163163_10057927 3300014325 Bacteria 3831
131 Ga0163163_10163064 3300014325 Unclassified 2275
132 Ga0163163_10259921 3300014325 Bacteria 1787
133 Ga0157380_10024480 3300014326 Bacteria 4570
134 Ga0157380_10029119 3300014326 Bacteria 4219
135 Ga0157380_10216392 3300014326 Bacteria 1711
136 Ga0157379_10002317 3300014968 Bacteria 15874
137 Ga0157379_10009742 3300014968 Bacteria 8371
138 Ga0157376_10003531 3300014969 Bacteria 10784
139 Ga0157376_10071260 3300014969 Bacteria 2953
140 Ga0157376_10098160 3300014969 Bacteria 2553
141 Ga0163161_10022259 3300017792 Bacteria 4461
142 Ga0163161_10219000 3300017792 Bacteria 1473
143 Ga0213872_10016882 3300021361 Bacteria 3383
144 Ga0213875_10002373 3300021388 Bacteria 11328
145 Ga0207680_10000461 3300025903 Bacteria 19199
146 Ga0207680_10067529 3300025903 Bacteria 2203
147 Ga0207645_10000534 3300025907 Bacteria 31590
148 Ga0207645_10020801 3300025907 Bacteria 4288
149 Ga0207643_10013990 3300025908 Bacteria 4353
150 Ga0207643_10021893 3300025908 Bacteria 3517
151 Ga0207705_10019058 3300025909 Bacteria 4908
152 Ga0207681_10000530 3300025923 Bacteria 26366
153 Ga0207681_10007720 3300025923 Bacteria 6588
154 Ga0207681_10051572 3300025923 Bacteria 2788
155 Ga0207650_10011449 3300025925 Bacteria 6107
156 Ga0207650_10022216 3300025925 Bacteria 4490
157 Ga0207650_10026261 3300025925 Bacteria 4152
158 Ga0207650_10082995 3300025925 Bacteria 2433
159 Ga0207650_10085931 3300025925 Bacteria 2394
160 Ga0207650_10101901 3300025925 Unclassified 2211
161 Ga0207659_10000248 3300025926 Bacteria 32815
162 Ga0207659_10123468 3300025926 Bacteria 1987
163 Ga0207659_10130172 3300025926 Bacteria 1941
164 Ga0207644_10030794 3300025931 Bacteria 3735
165 Ga0207670_10052308 3300025936 Bacteria 2746
166 Ga0207670_10134326 3300025936 Bacteria 1817
167 Ga0207669_10001990 3300025937 Bacteria 8665
168 Ga0207669_10106919 3300025937 Unclassified 1865
169 Ga0207704_10012718 3300025938 Bacteria 4183
170 Ga0207691_10000022 3300025940 Bacteria 132936
171 Ga0207691_10019311 3300025940 Bacteria 6450
172 Ga0207691_10079113 3300025940 Bacteria 2959
173 Ga0207691_10091684 3300025940 Bacteria 2722
174 Ga0207711_10004355 3300025941 Bacteria 12080
175 Ga0207711_10038104 3300025941 Bacteria 4087
176 Ga0207711_10177870 3300025941 Unclassified 1933
177 Ga0207689_10001287 3300025942 Bacteria 24173
178 Ga0207689_10003720 3300025942 Bacteria 13903
179 Ga0207689_10011029 3300025942 Bacteria 7767
180 Ga0207679_10162806 3300025945 Bacteria 1828
181 Ga0207667_10020290 3300025949 Bacteria 7396
182 Ga0207651_10001953 3300025960 Bacteria 9692
183 Ga0207651_10005471 3300025960 Bacteria 6526
184 Ga0207651_10015597 3300025960 Bacteria 4422
185 Ga0207712_10067631 3300025961 Bacteria 2558
186 Ga0207712_10068922 3300025961 Bacteria 2536
187 Ga0207668_10016669 3300025972 Bacteria 4590
188 Ga0207668_10053891 3300025972 Bacteria 2789
189 Ga0207668_10116707 3300025972 Bacteria 2013
190 Ga0207658_10000311 3300025986 Bacteria 49445
191 Ga0207658_10013198 3300025986 Bacteria 5642
192 Ga0207658_10144801 3300025986 Bacteria 1928
193 Ga0207658_10154291 3300025986 Bacteria 1875
194 Ga0207677_10004754 3300026023 Bacteria 7324
195 Ga0207677_10138235 3300026023 Bacteria 1861
196 Ga0207677_10177057 3300026023 Bacteria 1674
197 Ga0207703_10002140 3300026035 Bacteria 17359
198 Ga0207703_10074933 3300026035 Bacteria 2803
199 Ga0207703_10112935 3300026035 Bacteria 2322
200 Ga0207639_10319847 3300026041 Bacteria 1377
201 Ga0207708_10153898 3300026075 Bacteria 1812
202 Ga0207641_10001378 3300026088 Bacteria 23986
203 Ga0207641_10022242 3300026088 Bacteria 5218
204 Ga0207641_10064182 3300026088 Bacteria 3138
205 Ga0207641_10068207 3300026088 Bacteria 3049
206 Ga0207648_10001109 3300026089 Bacteria 30196
207 Ga0207648_10003044 3300026089 Bacteria 17714
208 Ga0207648_10032977 3300026089 Bacteria 4570
209 Ga0207648_10038927 3300026089 Bacteria 4183
210 Ga0207648_10076640 3300026089 Bacteria 2914
211 Ga0207648_10247057 3300026089 Bacteria 1590
212 Ga0207676_10003105 3300026095 Bacteria 11852
213 Ga0207676_10015480 3300026095 Bacteria 5502
214 Ga0207676_10051319 3300026095 Unclassified 3220
215 Ga0207676_10071967 3300026095 Bacteria 2777
216 Ga0207676_10096016 3300026095 Bacteria 2446
217 Ga0207676_10207526 3300026095 Bacteria 1735
218 Ga0207676_10301913 3300026095 Unclassified 1462
219 Ga0207674_10006183 3300026116 Bacteria 14125
220 Ga0207674_10361744 3300026116 Unclassified 1402
221 Ga0207675_100014447 3300026118 Bacteria 7361
222 Ga0207675_100047503 3300026118 Bacteria 4008
223 Ga0207683_10000108 3300026121 Bacteria 66917
224 Ga0207683_10055912 3300026121 Bacteria 3461
225 Ga0207698_10230870 3300026142 Bacteria 1680
226 Ga0268266_10014018 3300028379 Bacteria 6901
227 Ga0268266_10026733 3300028379 Bacteria 4911
228 Ga0268266_10157893 3300028379 Bacteria 2050
229 Ga0268266_10223432 3300028379 Bacteria 1732
230 Ga0268265_10259810 3300028380 Bacteria 1543
231 Ga0268264_10002130 3300028381 Bacteria 17661
232 Ga0268264_10087937 3300028381 Bacteria 2673
233 Ga0307408_100017902 3300031548 Bacteria 4749
234 Ga0307408_100172217 3300031548 Bacteria 1729
235 Ga0265313_10075415 3300031595 Bacteria 1543
236 Ga0307405_10001957 3300031731 Bacteria 8897
237 Ga0307413_10034206 3300031824 Bacteria 2902
238 Ga0307413_10081436 3300031824 Bacteria 2075
239 Ga0307410_10002110 3300031852 Bacteria 9439
240 Ga0307406_10053200 3300031901 Bacteria 2578
241 Ga0307407_10059170 3300031903 Bacteria 2230
242 Ga0307412_10075051 3300031911 Bacteria 2318
243 Ga0307412_10300561 3300031911 Bacteria 1268
244 Ga0307409_100228274 3300031995 Bacteria 1685
245 Ga0307416_100018148 3300032002 Bacteria 4949
246 Ga0307416_100045622 3300032002 Bacteria 3452
247 Ga0307416_100120492 3300032002 Bacteria 2336
248 Ga0307414_10210916 3300032004 Bacteria 1587
249 Ga0307411_10008327 3300032005 Bacteria 5363
250 Ga0307415_100000768 3300032126 Bacteria 14498
251 Ga0307415_100082828 3300032126 Bacteria 2296
252 Ga0316574_0213965 3300035398 Bacteria 1236
253 Ga0373937_0037367 3300036401 Bacteria 4425
254 Ga0395899_0009525 3300037312 Bacteria 7456
255 Ga0395900_0090692 3300037418 Bacteria 3141
256 Ga0395900_0452067 3300037418 Bacteria 1241
257 Ga0395898_0078333 3300037466 Bacteria 3189
258 Ga0395905_0130913 3300037471 Bacteria 2359
259 Ga0436364_0293059 3300037853 Bacteria 3216
260 Ga0436364_1185577 3300037853 Bacteria 27424
261 Ga0395901_0309200 3300038443 Bacteria 1637
262 Ga0395901_0312030 3300038443 Bacteria 1628
263 Ga0436365_0478204 3300039437 Bacteria 982
264 Ga0436360_0192500 3300039438 Bacteria 3808
265 Ga0436360_0511791 3300039438 Bacteria 2872
266 Ga0436361_0201120 3300039447 Bacteria 7535
267 Ga0436361_0685742 3300039447 Bacteria 3920
268 Ga0436361_0751327 3300039447 Bacteria 9387
269 Ga0436363_1185025 3300039450 Bacteria 9523
270 Ga0439435_0035801 3300042436 Bacteria 1370
271 Ga0451577_0241316 3300042876 Unclassified 1635
272 Ga0453683_0086366 3300044673 Bacteria 1966
273 Ga0466963_0123710 3300044694 Bacteria 1782
274 Ga0453684_0017308 3300044712 Bacteria 11179
275 Ga0453684_0018295 3300044712 Bacteria 10768
276 Ga0453684_0031791 3300044712 Bacteria 7404
277 Ga0453684_0064476 3300044712 Bacteria 4680
278 Ga0453684_0096282 3300044712 Bacteria 3637
279 Ga0453684_0132661 3300044712 Bacteria 2987
280 Ga0453684_0213632 3300044712 Bacteria 2240
281 Ga0453684_0294952 3300044712 Bacteria 1845
282 Ga0453684_0437510 3300044712 Bacteria 1458
283 Ga0453684_0499609 3300044712 Unclassified 1347
284 Ga0451576_0031011 3300045051 Bacteria 5703
285 Ga0495604_0233687 3300047317 Bacteria 1260
286 Ga0495674_0019982 3300047319 Bacteria 6208
287 Ga0495680_0040372 3300047322 Bacteria 3719
288 Ga0496102_0013980 3300048905 Bacteria 6969
289 Ga0496103_0098190 3300048906 Bacteria 1852
290 Ga0496107_0031048 3300048910 Bacteria 3810
291 Ga0496108_0054599 3300048911 Bacteria 3353
292 Ga0496109_0068130 3300048912 Bacteria 3262
293 Ga0496111_0257749 3300048914 Bacteria 1294
294 Ga0501041_0069196 3300049577 Bacteria 2165
295 Ga0501048_0155316 3300049582 Bacteria 1619
296 Ga0501076_0063553 3300049592 Bacteria 2941
297 Ga0501077_0043952 3300049593 Bacteria 2839
298 nmdc:mga05p37_161779_c1 3300050507 Bacteria 2733
299 nmdc:mga05p37_215264_c1 3300050507 Bacteria 2321
300 nmdc:mga05p37_296482_c1 3300050507 Bacteria 1923
301 nmdc:mga05p37_3498_c1 3300050507 Bacteria 18362
302 nmdc:mga09592_70557_c1 3300050508 Bacteria 2964
303 nmdc:mga08y16_122130_c1 3300050511 Bacteria 2710
304 nmdc:mga08x19_186310_c1 3300050514 Bacteria 1418
305 nmdc:mga0a205_88171_c1 3300050515 Bacteria 2998
306 Ga0500635_0000247 3300053080 Bacteria 23510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0478204 Ga0436365_0478204_17_823 266
2 3300050514 nmdc:mga08x19_186310_c1 nmdc:mga08x19_186310_c1_452_1396 278
3 3300048906 Ga0496103_0098190 Ga0496103_0098190_922_1818 288
4 3300044694 Ga0466963_0123710 Ga0466963_0123710_652_1569 302
5 3300037418 Ga0395900_0452067 Ga0395900_0452067_70_993 305
6 3300031548 Ga0307408_100172217 Ga0307408_1001722172 307
7 3300031824 Ga0307413_10034206 Ga0307413_100342062 307
8 3300031901 Ga0307406_10053200 Ga0307406_100532002 307
9 3300031911 Ga0307412_10300561 Ga0307412_103005611 307
10 3300031995 Ga0307409_100228274 Ga0307409_1002282742 307
11 3300032002 Ga0307416_100120492 Ga0307416_1001204922 307
12 3300032004 Ga0307414_10210916 Ga0307414_102109162 307
13 3300032126 Ga0307415_100082828 Ga0307415_1000828282 307
14 3300006871 Ga0075434_100053461 Ga0075434_1000534613 309
15 3300037312 Ga0395899_0009525 Ga0395899_0009525_281_1246 309
16 3300037418 Ga0395900_0090692 Ga0395900_0090692_14_979 309
17 3300037471 Ga0395905_0130913 Ga0395905_0130913_1278_2243 309
18 3300038443 Ga0395901_0312030 Ga0395901_0312030_469_1434 309
19 3300031595 Ga0265313_10075415 Ga0265313_100754152 313
20 3300035398 Ga0316574_0213965 Ga0316574_0213965_95_1048 316
21 3300053080 Ga0500635_0000247 Ga0500635_0000247_16746_17714 316
22 3300009094 Ga0111539_10416202 Ga0111539_104162022 319
23 3300009147 Ga0114129_10003593 Ga0114129_100035935 319
24 3300050507 nmdc:mga05p37_161779_c1 nmdc:mga05p37_161779_c1_214_1176 319
25 3300014326 Ga0157380_10216392 Ga0157380_102163921 320
26 3300037466 Ga0395898_0078333 Ga0395898_0078333_1240_2208 320
27 3300038443 Ga0395901_0309200 Ga0395901_0309200_596_1564 320
28 3300005530 Ga0070679_100040455 Ga0070679_1000404552 321
29 3300005841 Ga0068863_100093538 Ga0068863_1000935383 323
30 3300025925 Ga0207650_10082995 Ga0207650_100829952 323
31 3300025937 Ga0207669_10106919 Ga0207669_101069192 323
32 3300039438 Ga0436360_0192500 Ga0436360_0192500_1324_2301 323
33 3300047319 Ga0495674_0019982 Ga0495674_0019982_3869_4855 323
34 3300047322 Ga0495680_0040372 Ga0495680_0040372_1627_2613 323
35 3300039438 Ga0436360_0511791 Ga0436360_0511791_1526_2518 324
36 3300042876 Ga0451577_0241316 Ga0451577_0241316_631_1608 324
37 3300044712 Ga0453684_0018295 Ga0453684_0018295_4345_5322 324
38 3300044712 Ga0453684_0132661 Ga0453684_0132661_47_1027 324
39 3300047317 Ga0495604_0233687 Ga0495604_0233687_202_1191 324
40 3300048914 Ga0496111_0257749 Ga0496111_0257749_166_1155 324
41 3300005548 Ga0070665_100264940 Ga0070665_1002649402 325
42 3300044712 Ga0453684_0017308 Ga0453684_0017308_2366_3346 325
43 3300044712 Ga0453684_0499609 Ga0453684_0499609_241_1221 325
44 3300005354 Ga0070675_100025730 Ga0070675_1000257304 326
45 3300005440 Ga0070705_100045632 Ga0070705_1000456322 326
46 3300005444 Ga0070694_100184971 Ga0070694_1001849712 326
47 3300005458 Ga0070681_10013140 Ga0070681_1001314011 326
48 3300005549 Ga0070704_100075083 Ga0070704_1000750832 326
49 3300032002 Ga0307416_100018148 Ga0307416_1000181484 326
50 3300037853 Ga0436364_0293059 Ga0436364_0293059_879_1871 326
51 3300039450 Ga0436363_1185025 Ga0436363_1185025_577_1569 326
52 3300044712 Ga0453684_0031791 Ga0453684_0031791_1226_2209 326
53 3300044712 Ga0453684_0064476 Ga0453684_0064476_520_1503 326
54 3300044712 Ga0453684_0096282 Ga0453684_0096282_2462_3445 326
55 3300045051 Ga0451576_0031011 Ga0451576_0031011_2301_3284 326
56 3300005471 Ga0070698_100086230 Ga0070698_1000862302 328
57 3300005518 Ga0070699_100114075 Ga0070699_1001140752 328
58 3300009098 Ga0105245_10193650 Ga0105245_101936502 328
59 3300025960 Ga0207651_10015597 Ga0207651_100155973 328
60 3300026095 Ga0207676_10051319 Ga0207676_100513193 328
61 3300036401 Ga0373937_0037367 Ga0373937_0037367_2389_3432 328
62 3300042436 Ga0439435_0035801 Ga0439435_0035801_270_1283 328
63 3300044712 Ga0453684_0294952 Ga0453684_0294952_377_1369 328
64 3300005331 Ga0070670_100004589 Ga0070670_1000045899 329
65 3300005331 Ga0070670_100005261 Ga0070670_1000052617 329
66 3300005331 Ga0070670_100109178 Ga0070670_1001091783 329
67 3300005347 Ga0070668_100002119 Ga0070668_1000021196 329
68 3300005347 Ga0070668_100009250 Ga0070668_1000092505 329
69 3300005353 Ga0070669_100017368 Ga0070669_1000173683 329
70 3300005354 Ga0070675_100093245 Ga0070675_1000932453 329
71 3300005355 Ga0070671_100385701 Ga0070671_1003857011 329
72 3300005364 Ga0070673_100025105 Ga0070673_1000251052 329
73 3300005367 Ga0070667_100016205 Ga0070667_1000162054 329
74 3300005457 Ga0070662_100049185 Ga0070662_1000491852 329
75 3300005459 Ga0068867_100066305 Ga0068867_1000663052 329
76 3300005471 Ga0070698_100298601 Ga0070698_1002986011 329
77 3300005543 Ga0070672_100000358 Ga0070672_10000035810 329
78 3300005543 Ga0070672_100137560 Ga0070672_1001375602 329
79 3300005564 Ga0070664_100110507 Ga0070664_1001105072 329
80 3300005616 Ga0068852_100144804 Ga0068852_1001448042 329
81 3300005618 Ga0068864_100001522 Ga0068864_1000015221 329
82 3300005618 Ga0068864_100019447 Ga0068864_1000194474 329
83 3300005719 Ga0068861_100074629 Ga0068861_1000746293 329
84 3300005841 Ga0068863_100008601 Ga0068863_1000086014 329
85 3300005841 Ga0068863_100168462 Ga0068863_1001684622 329
86 3300005843 Ga0068860_100023629 Ga0068860_1000236294 329
87 3300006846 Ga0075430_100062735 Ga0075430_1000627352 329
88 3300006852 Ga0075433_10180164 Ga0075433_101801642 329
89 3300006880 Ga0075429_100023836 Ga0075429_1000238364 329
90 3300009147 Ga0114129_10011427 Ga0114129_1001142715 329
91 3300009147 Ga0114129_10078508 Ga0114129_100785084 329
92 3300009147 Ga0114129_10120622 Ga0114129_101206222 329
93 3300009147 Ga0114129_10140100 Ga0114129_101401004 329
94 3300009177 Ga0105248_10222464 Ga0105248_102224642 329
95 3300011119 Ga0105246_10026252 Ga0105246_100262523 329
96 3300013306 Ga0163162_10063654 Ga0163162_100636543 329
97 3300014325 Ga0163163_10259921 Ga0163163_102599213 329
98 3300014326 Ga0157380_10024480 Ga0157380_100244803 329
99 3300025923 Ga0207681_10007720 Ga0207681_100077204 329
100 3300025925 Ga0207650_10085931 Ga0207650_100859313 329
101 3300025925 Ga0207650_10101901 Ga0207650_101019012 329
102 3300025926 Ga0207659_10123468 Ga0207659_101234682 329
103 3300025940 Ga0207691_10019311 Ga0207691_100193116 329
104 3300025940 Ga0207691_10079113 Ga0207691_100791133 329
105 3300025941 Ga0207711_10177870 Ga0207711_101778702 329
106 3300025945 Ga0207679_10162806 Ga0207679_101628061 329
107 3300025972 Ga0207668_10016669 Ga0207668_100166692 329
108 3300025972 Ga0207668_10053891 Ga0207668_100538912 329
109 3300025986 Ga0207658_10013198 Ga0207658_100131985 329
110 3300025986 Ga0207658_10144801 Ga0207658_101448012 329
111 3300025986 Ga0207658_10154291 Ga0207658_101542912 329
112 3300026023 Ga0207677_10138235 Ga0207677_101382352 329
113 3300026035 Ga0207703_10112935 Ga0207703_101129352 329
114 3300026088 Ga0207641_10022242 Ga0207641_100222422 329
115 3300026089 Ga0207648_10038927 Ga0207648_100389274 329
116 3300026089 Ga0207648_10076640 Ga0207648_100766402 329
117 3300026095 Ga0207676_10071967 Ga0207676_100719672 329
118 3300026095 Ga0207676_10096016 Ga0207676_100960163 329
119 3300026095 Ga0207676_10207526 Ga0207676_102075262 329
120 3300026116 Ga0207674_10361744 Ga0207674_103617442 329
121 3300026118 Ga0207675_100047503 Ga0207675_1000475034 329
122 3300028379 Ga0268266_10026733 Ga0268266_100267335 329
123 3300028379 Ga0268266_10223432 Ga0268266_102234322 329
124 3300028381 Ga0268264_10087937 Ga0268264_100879372 329
125 3300044673 Ga0453683_0086366 Ga0453683_0086366_843_1835 329
126 3300044712 Ga0453684_0213632 Ga0453684_0213632_236_1234 329
127 3300044712 Ga0453684_0437510 Ga0453684_0437510_211_1203 329
128 3300049577 Ga0501041_0069196 Ga0501041_0069196_593_1588 329
129 3300049582 Ga0501048_0155316 Ga0501048_0155316_228_1223 329
130 3300049592 Ga0501076_0063553 Ga0501076_0063553_1157_2152 329
131 3300049593 Ga0501077_0043952 Ga0501077_0043952_1123_2118 329
132 3300050507 nmdc:mga05p37_215264_c1 nmdc:mga05p37_215264_c1_1112_2104 329
133 3300050507 nmdc:mga05p37_296482_c1 nmdc:mga05p37_296482_c1_163_1155 329
134 3300050507 nmdc:mga05p37_3498_c1 nmdc:mga05p37_3498_c1_6912_7904 329
135 3300050508 nmdc:mga09592_70557_c1 nmdc:mga09592_70557_c1_1232_2224 329
136 3300050511 nmdc:mga08y16_122130_c1 nmdc:mga08y16_122130_c1_1555_2577 329
137 3300050515 nmdc:mga0a205_88171_c1 nmdc:mga0a205_88171_c1_1435_2427 329
138 3300006195 Ga0075366_10006062 Ga0075366_100060623 330
139 3300021388 Ga0213875_10002373 Ga0213875_100023735 330
140 3300025923 Ga0207681_10051572 Ga0207681_100515722 330
141 3300025926 Ga0207659_10130172 Ga0207659_101301722 330
142 3300037853 Ga0436364_1185577 Ga0436364_1185577_21776_22789 330
143 3300005445 Ga0070708_100011930 Ga0070708_1000119307 331
144 3300005328 Ga0070676_10001967 Ga0070676_100019679 332
145 3300005331 Ga0070670_100000274 Ga0070670_10000027427 332
146 3300005331 Ga0070670_100031478 Ga0070670_1000314784 332
147 3300005339 Ga0070660_100209394 Ga0070660_1002093942 332
148 3300005367 Ga0070667_100010075 Ga0070667_1000100757 332
149 3300005539 Ga0068853_100211601 Ga0068853_1002116012 332
150 3300005547 Ga0070693_100048162 Ga0070693_1000481622 332
151 3300005564 Ga0070664_100154176 Ga0070664_1001541762 332
152 3300005577 Ga0068857_100002902 Ga0068857_1000029028 332
153 3300005617 Ga0068859_100002792 Ga0068859_1000027922 332
154 3300005719 Ga0068861_100000686 Ga0068861_1000006865 332
155 3300005841 Ga0068863_100004977 Ga0068863_10000497712 332
156 3300005842 Ga0068858_100000345 Ga0068858_10000034545 332
157 3300006844 Ga0075428_100189212 Ga0075428_1001892123 332
158 3300006881 Ga0068865_100052701 Ga0068865_1000527012 332
159 3300006931 Ga0097620_100002792 Ga0097620_10000279218 332
160 3300009147 Ga0114129_10441751 Ga0114129_104417513 332
161 3300013297 Ga0157378_10004335 Ga0157378_100043355 332
162 3300013306 Ga0163162_10140605 Ga0163162_101406052 332
163 3300014325 Ga0163163_10057927 Ga0163163_100579272 332
164 3300014968 Ga0157379_10002317 Ga0157379_1000231716 332
165 3300014969 Ga0157376_10071260 Ga0157376_100712602 332
166 3300017792 Ga0163161_10219000 Ga0163161_102190001 332
167 3300025903 Ga0207680_10067529 Ga0207680_100675292 332
168 3300025907 Ga0207645_10020801 Ga0207645_100208012 332
169 3300025908 Ga0207643_10013990 Ga0207643_100139902 332
170 3300025925 Ga0207650_10011449 Ga0207650_100114496 332
171 3300025925 Ga0207650_10022216 Ga0207650_100222164 332
172 3300025936 Ga0207670_10052308 Ga0207670_100523082 332
173 3300025940 Ga0207691_10091684 Ga0207691_100916843 332
174 3300025941 Ga0207711_10038104 Ga0207711_100381043 332
175 3300025942 Ga0207689_10003720 Ga0207689_100037205 332
176 3300025949 Ga0207667_10020290 Ga0207667_100202906 332
177 3300025960 Ga0207651_10005471 Ga0207651_100054714 332
178 3300025972 Ga0207668_10116707 Ga0207668_101167072 332
179 3300026035 Ga0207703_10074933 Ga0207703_100749333 332
180 3300026041 Ga0207639_10319847 Ga0207639_103198472 332
181 3300026088 Ga0207641_10064182 Ga0207641_100641822 332
182 3300026089 Ga0207648_10003044 Ga0207648_1000304416 332
183 3300026095 Ga0207676_10003105 Ga0207676_1000310511 332
184 3300026116 Ga0207674_10006183 Ga0207674_100061838 332
185 3300048905 Ga0496102_0013980 Ga0496102_0013980_764_1795 332
186 3300048912 Ga0496109_0068130 Ga0496109_0068130_1052_2083 332
187 3300005331 Ga0070670_100056887 Ga0070670_1000568873 333
188 3300005347 Ga0070668_100011940 Ga0070668_1000119408 333
189 3300005353 Ga0070669_100028749 Ga0070669_1000287491 333
190 3300005841 Ga0068863_100155343 Ga0068863_1001553432 333
191 3300005843 Ga0068860_100129185 Ga0068860_1001291852 333
192 3300006186 Ga0075369_10097937 Ga0075369_100979372 333
193 3300006195 Ga0075366_10007783 Ga0075366_100077833 333
194 3300009545 Ga0105237_10161158 Ga0105237_101611581 333
195 3300025925 Ga0207650_10026261 Ga0207650_100262613 333
196 3300026088 Ga0207641_10068207 Ga0207641_100682072 333
197 3300005937 Ga0081455_10014924 Ga0081455_100149243 334
198 3300031548 Ga0307408_100017902 Ga0307408_1000179024 334
199 3300031731 Ga0307405_10001957 Ga0307405_100019575 334
200 3300031824 Ga0307413_10081436 Ga0307413_100814362 334
201 3300031852 Ga0307410_10002110 Ga0307410_100021103 334
202 3300031903 Ga0307407_10059170 Ga0307407_100591702 334
203 3300031911 Ga0307412_10075051 Ga0307412_100750512 334
204 3300032002 Ga0307416_100045622 Ga0307416_1000456222 334
205 3300032005 Ga0307411_10008327 Ga0307411_100083275 334
206 3300032126 Ga0307415_100000768 Ga0307415_1000007686 334
207 3300005328 Ga0070676_10000460 Ga0070676_100004603 335
208 3300005330 Ga0070690_100036184 Ga0070690_1000361843 335
209 3300005334 Ga0068869_100006271 Ga0068869_1000062715 335
210 3300005335 Ga0070666_10000439 Ga0070666_100004398 335
211 3300005338 Ga0068868_100003210 Ga0068868_1000032105 335
212 3300005340 Ga0070689_100169725 Ga0070689_1001697252 335
213 3300005347 Ga0070668_100000714 Ga0070668_1000007147 335
214 3300005353 Ga0070669_100000685 Ga0070669_10000068510 335
215 3300005354 Ga0070675_100000769 Ga0070675_10000076919 335
216 3300005356 Ga0070674_100014496 Ga0070674_1000144962 335
217 3300005364 Ga0070673_100003310 Ga0070673_1000033103 335
218 3300005367 Ga0070667_100001175 Ga0070667_1000011758 335
219 3300005438 Ga0070701_10084733 Ga0070701_100847332 335
220 3300005456 Ga0070678_100000294 Ga0070678_1000002947 335
221 3300005459 Ga0068867_100000643 Ga0068867_1000006439 335
222 3300005543 Ga0070672_100000479 Ga0070672_1000004797 335
223 3300005548 Ga0070665_100083573 Ga0070665_1000835733 335
224 3300005617 Ga0068859_100008631 Ga0068859_10000863112 335
225 3300005618 Ga0068864_100001326 Ga0068864_1000013264 335
226 3300005719 Ga0068861_100048469 Ga0068861_1000484692 335
227 3300005841 Ga0068863_100001375 Ga0068863_1000013759 335
228 3300005842 Ga0068858_100001028 Ga0068858_1000010288 335
229 3300005843 Ga0068860_100002739 Ga0068860_10000273913 335
230 3300006237 Ga0097621_100001008 Ga0097621_10000100817 335
231 3300006358 Ga0068871_100003407 Ga0068871_1000034077 335
232 3300006881 Ga0068865_100024751 Ga0068865_1000247514 335
233 3300006931 Ga0097620_100008631 Ga0097620_10000863112 335
234 3300009177 Ga0105248_10005650 Ga0105248_100056503 335
235 3300009553 Ga0105249_10071752 Ga0105249_100717523 335
236 3300013296 Ga0157374_10004024 Ga0157374_1000402410 335
237 3300013306 Ga0163162_10005922 Ga0163162_100059223 335
238 3300013308 Ga0157375_10003067 Ga0157375_100030679 335
239 3300014968 Ga0157379_10009742 Ga0157379_100097421 335
240 3300014969 Ga0157376_10003531 Ga0157376_100035319 335
241 3300017792 Ga0163161_10022259 Ga0163161_100222593 335
242 3300021361 Ga0213872_10016882 Ga0213872_100168822 335
243 3300025903 Ga0207680_10000461 Ga0207680_100004614 335
244 3300025907 Ga0207645_10000534 Ga0207645_100005343 335
245 3300025923 Ga0207681_10000530 Ga0207681_1000053023 335
246 3300025926 Ga0207659_10000248 Ga0207659_1000024833 335
247 3300025936 Ga0207670_10134326 Ga0207670_101343262 335
248 3300025937 Ga0207669_10001990 Ga0207669_100019902 335
249 3300025938 Ga0207704_10012718 Ga0207704_100127182 335
250 3300025940 Ga0207691_10000022 Ga0207691_1000002264 335
251 3300025941 Ga0207711_10004355 Ga0207711_100043553 335
252 3300025942 Ga0207689_10001287 Ga0207689_1000128716 335
253 3300025960 Ga0207651_10001953 Ga0207651_100019533 335
254 3300025961 Ga0207712_10068922 Ga0207712_100689222 335
255 3300025986 Ga0207658_10000311 Ga0207658_100003117 335
256 3300026023 Ga0207677_10004754 Ga0207677_100047549 335
257 3300026035 Ga0207703_10002140 Ga0207703_1000214010 335
258 3300026088 Ga0207641_10001378 Ga0207641_100013789 335
259 3300026089 Ga0207648_10001109 Ga0207648_1000110921 335
260 3300026095 Ga0207676_10015480 Ga0207676_100154805 335
261 3300026118 Ga0207675_100014447 Ga0207675_1000144472 335
262 3300026121 Ga0207683_10000108 Ga0207683_1000010851 335
263 3300028379 Ga0268266_10014018 Ga0268266_100140188 335
264 3300028381 Ga0268264_10002130 Ga0268264_100021304 335
265 3300039447 Ga0436361_0201120 Ga0436361_0201120_6353_7405 335
266 3300039447 Ga0436361_0685742 Ga0436361_0685742_116_1168 335
267 3300039447 Ga0436361_0751327 Ga0436361_0751327_7998_9050 335
268 3300048910 Ga0496107_0031048 Ga0496107_0031048_2051_3088 335
269 3300048911 Ga0496108_0054599 Ga0496108_0054599_743_1780 335
270 3300005334 Ga0068869_100135563 Ga0068869_1001355632 336
271 3300005335 Ga0070666_10033337 Ga0070666_100333373 336
272 3300005338 Ga0068868_100126081 Ga0068868_1001260812 336
273 3300005354 Ga0070675_100095338 Ga0070675_1000953382 336
274 3300005356 Ga0070674_100089249 Ga0070674_1000892492 336
275 3300005365 Ga0070688_100019153 Ga0070688_1000191534 336
276 3300005367 Ga0070667_100163791 Ga0070667_1001637912 336
277 3300005456 Ga0070678_100009782 Ga0070678_1000097826 336
278 3300005548 Ga0070665_100015133 Ga0070665_1000151334 336
279 3300005617 Ga0068859_100102020 Ga0068859_1001020202 336
280 3300005718 Ga0068866_10051153 Ga0068866_100511532 336
281 3300005842 Ga0068858_100105247 Ga0068858_1001052473 336
282 3300005843 Ga0068860_100069163 Ga0068860_1000691632 336
283 3300005844 Ga0068862_100179781 Ga0068862_1001797812 336
284 3300006237 Ga0097621_100009211 Ga0097621_1000092119 336
285 3300006931 Ga0097620_100102014 Ga0097620_1001020142 336
286 3300009148 Ga0105243_10105526 Ga0105243_101055262 336
287 3300013297 Ga0157378_10014612 Ga0157378_100146124 336
288 3300013308 Ga0157375_10239088 Ga0157375_102390882 336
289 3300014325 Ga0163163_10163064 Ga0163163_101630641 336
290 3300014969 Ga0157376_10098160 Ga0157376_100981603 336
291 3300025908 Ga0207643_10021893 Ga0207643_100218933 336
292 3300025931 Ga0207644_10030794 Ga0207644_100307943 336
293 3300025942 Ga0207689_10011029 Ga0207689_100110292 336
294 3300025961 Ga0207712_10067631 Ga0207712_100676312 336
295 3300026023 Ga0207677_10177057 Ga0207677_101770572 336
296 3300026075 Ga0207708_10153898 Ga0207708_101538982 336
297 3300026089 Ga0207648_10032977 Ga0207648_100329773 336
298 3300026095 Ga0207676_10301913 Ga0207676_103019132 336
299 3300026121 Ga0207683_10055912 Ga0207683_100559122 336
300 3300028379 Ga0268266_10157893 Ga0268266_101578932 336
301 3300028380 Ga0268265_10259810 Ga0268265_102598102 336
302 3300005327 Ga0070658_10019035 Ga0070658_100190356 338
303 3300014326 Ga0157380_10029119 Ga0157380_100291193 338
304 3300025909 Ga0207705_10019058 Ga0207705_100190582 338
305 3300026089 Ga0207648_10247057 Ga0207648_102470573 338
306 3300026142 Ga0207698_10230870 Ga0207698_102308702 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

9

231

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.8869 2 32
3m2p-assembly3.cif.gz_D the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.7789 1 314
2dwc-assembly1.cif.gz_B crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp 0.7727 1 71
3m2p-assembly3.cif.gz_D the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.7715 1 314
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.7688 1 307
ID Description Score Start End Superfamily
af_A0A1D6IP12_4_87_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9067 1 30 3.40.50.20
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8345 1 51 3.40.50.720
af_K7VJC9_94_197_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8082 2 51 3.40.50.720
af_Q4DI30_3_123_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.783 151 236 3.40.50.720
4ffoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7798 2 72 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D3QAC4-F1-model_v4 Epimerase 0.9784 91 335
AF-X1CVB5-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9718 40 310
AF-A0A6M4GXC1-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.971 1 329 GO:0004029
GO:0005737
AF-A0A7W0W7I5-F1-model_v4 Epimerase 0.9697 1 331
AF-A0A4P5TLT5-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9688 1 330

Feature Viewer

pLDDT pTM Quality
92.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map