F398445

General Info

Members Datasets Scaffolds Average Seq Length
306 217 612 296

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10192394|rootH1_101923943
Length 325
Sequence MDIETSSVRGGTSSAIEIVPTGRAIGAEVRNVDLKRLDDATFAALLRAFHDHSVLLVRGQTLSDQDLIAFSRRFGELDWAPVQENGRRFVEGLPEIYIVSNVKQNGEPIGSLGAGEAVWHTDMSYLEAPPIASALYALEIPPVGGNTSFCSMYAIHDALAPELKRRIAGLEIKHDGTYNSGGFLRQGVMPTDDPRTSPGAIHPLVCTHPDTGREMLYLGRRRNAYLVGLELAESEALLNELWAHVERPEFAWEHVWQVGDLVIWDNRCTMHRRDPFDNATRRVMHRTQIKGDQGQRQADCLRGLAKETSCVVRRSSMPGATPTRT

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
204 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
208 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
212 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
216 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
217 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.48
Nodule 0.33
Rhizoplane 7.52
Rhizosphere 79.08
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10192394 3300003323 Bacteria 2117
2 Ga0055539_1006582 3300003752 Bacteria 1484
3 Ga0070658_10051337 3300005327 Bacteria 3342
4 Ga0070658_10242446 3300005327 Unclassified 1528
5 Ga0070683_100049194 3300005329 Bacteria 3899
6 Ga0070677_10055904 3300005333 Unclassified 1612
7 Ga0068869_100017676 3300005334 Bacteria 4839
8 Ga0070666_10075760 3300005335 Unclassified 2294
9 Ga0070689_100006674 3300005340 Bacteria 8020
10 Ga0070691_10061337 3300005341 Bacteria 1809
11 Ga0070661_100014124 3300005344 Bacteria 5625
12 Ga0070661_100260120 3300005344 Unclassified 1342
13 Ga0070692_10124457 3300005345 Unclassified 1442
14 Ga0070669_100105656 3300005353 Unclassified 2130
15 Ga0070675_100383886 3300005354 Bacteria 1251
16 Ga0070671_100584213 3300005355 Bacteria 965
17 Ga0070674_100033409 3300005356 Bacteria 3424
18 Ga0070673_100475177 3300005364 Unclassified 1127
19 Ga0070709_10013575 3300005434 Bacteria 4584
20 Ga0070709_10050980 3300005434 Bacteria 2596
21 Ga0070713_100087703 3300005436 Bacteria 2669
22 Ga0070710_10040508 3300005437 Bacteria 2568
23 Ga0070701_10156237 3300005438 Unclassified 1318
24 Ga0070711_100046240 3300005439 Bacteria 2964
25 Ga0070711_100060251 3300005439 Bacteria 2638
26 Ga0070711_100097239 3300005439 Bacteria 2134
27 Ga0070700_100123531 3300005441 Unclassified 1738
28 Ga0070708_100091809 3300005445 Bacteria 2766
29 Ga0070663_100003543 3300005455 Bacteria 9015
30 Ga0070681_10037135 3300005458 Bacteria 4889
31 Ga0068867_100297969 3300005459 Unclassified 1328
32 Ga0070706_100021236 3300005467 Bacteria 5980
33 Ga0070706_100081162 3300005467 Bacteria 3003
34 Ga0070706_100144187 3300005467 Bacteria 2224
35 Ga0070706_100460915 3300005467 Bacteria 1183
36 Ga0070707_100012305 3300005468 Bacteria 7988
37 Ga0070698_100049668 3300005471 Bacteria 4280
38 Ga0070699_100015971 3300005518 Bacteria 6446
39 Ga0070679_100056651 3300005530 Bacteria 3905
40 Ga0070684_100002372 3300005535 Bacteria 13884
41 Ga0070684_100140479 3300005535 Unclassified 2184
42 Ga0070697_100014241 3300005536 Bacteria 6249
43 Ga0068853_100153300 3300005539 Unclassified 2075
44 Ga0070686_100026838 3300005544 Bacteria 3480
45 Ga0070665_100118925 3300005548 Unclassified 2645
46 Ga0068855_100036261 3300005563 Bacteria 5871
47 Ga0070664_100199432 3300005564 Bacteria 1785
48 Ga0070664_100410591 3300005564 Unclassified 1239
49 Ga0068857_100228690 3300005577 Unclassified 1700
50 Ga0068854_100024085 3300005578 Bacteria 4164
51 Ga0068854_100045992 3300005578 Bacteria 3106
52 Ga0068854_100050056 3300005578 Bacteria 2987
53 Ga0068856_100123436 3300005614 Bacteria 2592
54 Ga0068856_100172298 3300005614 Bacteria 2176
55 Ga0070702_100079715 3300005615 Unclassified 1957
56 Ga0068852_100040936 3300005616 Bacteria 3913
57 Ga0068852_100423930 3300005616 Bacteria 1313
58 Ga0068859_100082522 3300005617 Bacteria 3257
59 Ga0068859_100231472 3300005617 Bacteria 1936
60 Ga0068866_10033591 3300005718 Unclassified 2490
61 Ga0068861_100243977 3300005719 Unclassified 1529
62 Ga0068851_10008242 3300005834 Bacteria 4812
63 Ga0068870_10006679 3300005840 Bacteria 5101
64 Ga0068870_10152111 3300005840 Unclassified 1364
65 Ga0068863_100096497 3300005841 Bacteria 2806
66 Ga0068863_100177798 3300005841 Unclassified 2042
67 Ga0068863_100178273 3300005841 Bacteria 2040
68 Ga0068858_100113635 3300005842 Bacteria 2529
69 Ga0068858_100169319 3300005842 Unclassified 2059
70 Ga0068860_100307560 3300005843 Bacteria 1554
71 Ga0068862_100035530 3300005844 Bacteria 4221
72 Ga0081455_10031150 3300005937 Bacteria 4831
73 Ga0081455_10324295 3300005937 Bacteria 1096
74 Ga0081540_1006292 3300005983 Bacteria 8690
75 Ga0081540_1021504 3300005983 Bacteria 3838
76 Ga0070717_10019442 3300006028 Bacteria 5326
77 Ga0070717_10040559 3300006028 Unclassified 3792
78 Ga0075365_10007530 3300006038 Bacteria 6109
79 Ga0070716_100004392 3300006173 Bacteria 6739
80 Ga0068871_100037850 3300006358 Bacteria 3850
81 Ga0075428_100005811 3300006844 Bacteria 13704
82 Ga0075428_100022309 3300006844 Bacteria 7010
83 Ga0075430_100027142 3300006846 Bacteria 4867
84 Ga0075430_100050728 3300006846 Bacteria 3498
85 Ga0075431_100000033 3300006847 Bacteria 72175
86 Ga0075431_100031399 3300006847 Bacteria 5471
87 Ga0075434_100011039 3300006871 Bacteria 8498
88 Ga0075434_100036198 3300006871 Bacteria 4883
89 Ga0075434_100154001 3300006871 Bacteria 2319
90 Ga0068865_100036422 3300006881 Bacteria 3317
91 Ga0097620_100082519 3300006931 Bacteria 3257
92 Ga0097620_100231469 3300006931 Bacteria 1936
93 Ga0075435_100177757 3300007076 Bacteria 1798
94 Ga0099795_10000626 3300007788 Bacteria 6787
95 Ga0105240_10067749 3300009093 Bacteria 4424
96 Ga0111539_10003315 3300009094 Bacteria 21246
97 Ga0114129_10000413 3300009147 Bacteria 50468
98 Ga0114129_10008487 3300009147 Bacteria 14639
99 Ga0114129_10032204 3300009147 Bacteria 7410
100 Ga0114129_10135333 3300009147 Bacteria 3381
101 Ga0114129_10234185 3300009147 Bacteria 2472
102 Ga0114129_10235123 3300009147 Bacteria 2466
103 Ga0105243_10029548 3300009148 Bacteria 4215
104 Ga0105241_10001556 3300009174 Bacteria 17570
105 Ga0105248_10055482 3300009177 Bacteria 4444
106 Ga0105237_10025608 3300009545 Bacteria 6030
107 Ga0105238_10061518 3300009551 Unclassified 3757
108 Ga0105238_10187260 3300009551 Bacteria 2046
109 Ga0105249_10023405 3300009553 Bacteria 5542
110 Ga0105249_10315706 3300009553 Bacteria 1572
111 Ga0099796_10000969 3300010159 Bacteria 5376
112 Ga0105239_10145178 3300010375 Unclassified 2646
113 Ga0157315_1000420 3300012508 Bacteria 1941
114 Ga0157373_10006085 3300013100 Bacteria 9023
115 Ga0157374_10226331 3300013296 Bacteria 1837
116 Ga0157372_10630696 3300013307 Unclassified 1249
117 Ga0163163_10023611 3300014325 Bacteria 5838
118 Ga0163163_10092417 3300014325 Bacteria 3041
119 Ga0163163_10093502 3300014325 Bacteria 3023
120 Ga0163163_10109879 3300014325 Unclassified 2785
121 Ga0157380_10039538 3300014326 Bacteria 3669
122 Ga0157379_10131619 3300014968 Unclassified 2252
123 Ga0157376_10009788 3300014969 Bacteria 6983
124 Ga0157376_10199988 3300014969 Unclassified 1838
125 Ga0213872_10036786 3300021361 Bacteria 2236
126 Ga0213872_10040483 3300021361 Bacteria 2128
127 Ga0213875_10014538 3300021388 Bacteria 3840
128 Ga0209233_1000867 3300025261 Bacteria 13321
129 Ga0209455_1002017 3300025272 Bacteria 8307
130 Ga0207697_10000319 3300025315 Bacteria 26864
131 Ga0207656_10016811 3300025321 Bacteria 2854
132 Ga0207682_10001247 3300025893 Bacteria 11774
133 Ga0207692_10024502 3300025898 Bacteria 2806
134 Ga0207688_10000328 3300025901 Bacteria 21976
135 Ga0207680_10073842 3300025903 Unclassified 2122
136 Ga0207643_10001524 3300025908 Bacteria 13229
137 Ga0207707_10044142 3300025912 Unclassified 3887
138 Ga0207695_10040016 3300025913 Bacteria 5033
139 Ga0207693_10022650 3300025915 Bacteria 4990
140 Ga0207662_10001255 3300025918 Bacteria 12184
141 Ga0207657_10000093 3300025919 Bacteria 85263
142 Ga0207657_10016706 3300025919 Bacteria 7070
143 Ga0207649_10144774 3300025920 Unclassified 1630
144 Ga0207652_10277011 3300025921 Bacteria 1513
145 Ga0207646_10045753 3300025922 Bacteria 3928
146 Ga0207694_10005715 3300025924 Bacteria 9532
147 Ga0207664_10224029 3300025929 Bacteria 1632
148 Ga0207706_10032576 3300025933 Bacteria 4641
149 Ga0207670_10034559 3300025936 Bacteria 3268
150 Ga0207669_10063464 3300025937 Bacteria 2280
151 Ga0207665_10004895 3300025939 Bacteria 8924
152 Ga0207711_10028660 3300025941 Bacteria 4689
153 Ga0207689_10001097 3300025942 Bacteria 26096
154 Ga0207661_10015070 3300025944 Bacteria 5679
155 Ga0207661_10084924 3300025944 Bacteria 2623
156 Ga0207679_10138065 3300025945 Unclassified 1966
157 Ga0207667_10000410 3300025949 Bacteria 58059
158 Ga0207667_10108801 3300025949 Bacteria 2859
159 Ga0207667_10481585 3300025949 Bacteria 1260
160 Ga0207640_10133960 3300025981 Unclassified 1795
161 Ga0207677_10327631 3300026023 Unclassified 1275
162 Ga0207703_10693373 3300026035 Unclassified 968
163 Ga0207639_10328536 3300026041 Unclassified 1360
164 Ga0207678_10000689 3300026067 Bacteria 30948
165 Ga0207678_10006713 3300026067 Bacteria 10207
166 Ga0207708_10003259 3300026075 Bacteria 11959
167 Ga0207708_10117492 3300026075 Bacteria 2070
168 Ga0207641_10020118 3300026088 Bacteria 5480
169 Ga0207641_10025761 3300026088 Bacteria 4850
170 Ga0207641_10293785 3300026088 Bacteria 1532
171 Ga0207648_10001722 3300026089 Bacteria 23942
172 Ga0207676_10027301 3300026095 Bacteria 4251
173 Ga0207674_10000749 3300026116 Bacteria 42581
174 Ga0207674_10139106 3300026116 Unclassified 2389
175 Ga0207675_100000716 3300026118 Bacteria 32888
176 Ga0207683_10150523 3300026121 Unclassified 2100
177 Ga0207698_10000366 3300026142 Bacteria 26504
178 Ga0209974_10013132 3300027876 Bacteria 2761
179 Ga0207428_10002861 3300027907 Bacteria 17100
180 Ga0207428_10146561 3300027907 Bacteria 1799
181 Ga0268266_10014897 3300028379 Bacteria 6677
182 Ga0265319_1004272 3300028563 Bacteria 7118
183 Ga0265334_10018094 3300028573 Bacteria 2904
184 Ga0265323_10001986 3300028653 Bacteria 9653
185 Ga0265336_10000896 3300028666 Bacteria 15205
186 Ga0265338_10000146 3300028800 Bacteria 129397
187 Ga0265324_10044232 3300029957 Bacteria 1535
188 Ga0265327_10008688 3300031251 Bacteria 7518
189 Ga0307408_100152484 3300031548 Unclassified 1826
190 Ga0307410_10037769 3300031852 Bacteria 3158
191 Ga0307410_10059525 3300031852 Bacteria 2607
192 Ga0307407_10063164 3300031903 Bacteria 2171
193 Ga0307409_100073341 3300031995 Bacteria 2729
194 Ga0307409_100260842 3300031995 Unclassified 1590
195 Ga0307416_100009651 3300032002 Bacteria 6332
196 Ga0307411_10001243 3300032005 Bacteria 10153
197 Ga0307415_100042509 3300032126 Bacteria 3025
198 Ga0373926_0010208 3300035083 Bacteria 3144
199 Ga0373936_0027006 3300035113 Bacteria 2251
200 Ga0373945_0074525 3300035116 Bacteria 1290
201 Ga0373943_0026112 3300035170 Bacteria 2734
202 Ga0373943_0036048 3300035170 Unclassified 2368
203 Ga0373946_0009962 3300035171 Bacteria 3514
204 Ga0373935_0045384 3300035692 Bacteria 2773
205 Ga0373927_0074206 3300035695 Bacteria 2202
206 Ga0373947_0023270 3300035725 Bacteria 3601
207 Ga0373947_0183753 3300035725 Bacteria 1362
208 Ga0373925_0075678 3300037068 Bacteria 2551
209 Ga0373925_0077209 3300037068 Bacteria 2527
210 Ga0373925_0150855 3300037068 Bacteria 1825
211 Ga0373925_0338488 3300037068 Bacteria 1220
212 Ga0436364_0535269 3300037853 Bacteria 4422
213 Ga0436365_1218374 3300039437 Bacteria 2510
214 Ga0436365_1323982 3300039437 Bacteria 2876
215 Ga0436360_1046637 3300039438 Bacteria 1030
216 Ga0436361_0183440 3300039447 Bacteria 1945
217 Ga0436361_0537309 3300039447 Bacteria 4364
218 Ga0436361_0815982 3300039447 Bacteria 1746
219 Ga0436361_0925711 3300039447 Bacteria 3115
220 Ga0451853_3244122 3300041512 Bacteria 1393
221 Ga0495603_0050273 3300046455 Bacteria 2479
222 Ga0495580_0133922 3300046472 Bacteria 1718
223 Ga0495639_0074213 3300046475 Bacteria 1576
224 Ga0495584_0001246 3300046491 Bacteria 15540
225 Ga0495584_0021678 3300046491 Bacteria 3262
226 Ga0495607_0050200 3300046501 Bacteria 2430
227 Ga0495632_0148459 3300046519 Bacteria 1085
228 Ga0495640_0106284 3300046533 Bacteria 1838
229 Ga0495640_0208396 3300046533 Bacteria 1237
230 Ga0495633_0086474 3300046558 Bacteria 1458
231 Ga0495668_0068963 3300046616 Bacteria 1945
232 Ga0495661_0030817 3300046665 Bacteria 3412
233 Ga0495658_0008170 3300046683 Bacteria 5185
234 Ga0495658_0022842 3300046683 Bacteria 3313
235 Ga0495658_0086921 3300046683 Bacteria 1845
236 Ga0495613_0230467 3300046689 Bacteria 1298
237 Ga0495624_0200551 3300046690 Bacteria 1212
238 Ga0495679_030821 3300047446 Bacteria 1737
239 Ga0495593_0028555 3300047673 Bacteria 3064
240 Ga0495614_0133664 3300048089 Bacteria 1099
241 Ga0496100_0116894 3300048903 Bacteria 1861
242 Ga0496100_0125514 3300048903 Unclassified 1801
243 Ga0496100_0214027 3300048903 Bacteria 1411
244 Ga0496101_0194307 3300048904 Bacteria 1567
245 Ga0496102_0064106 3300048905 Bacteria 3365
246 Ga0496103_0047248 3300048906 Bacteria 2659
247 Ga0496104_0027671 3300048907 Bacteria 5249
248 Ga0496104_0065658 3300048907 Bacteria 3444
249 Ga0496105_0065412 3300048908 Bacteria 3001
250 Ga0496106_0062123 3300048909 Bacteria 2835
251 Ga0496106_0306278 3300048909 Unclassified 1274
252 Ga0496107_0241390 3300048910 Bacteria 1344
253 Ga0496108_0001716 3300048911 Bacteria 17374
254 Ga0496108_0412718 3300048911 Unclassified 1179
255 Ga0496109_0058053 3300048912 Bacteria 3534
256 Ga0496109_0084888 3300048912 Bacteria 2922
257 Ga0496110_0052037 3300048913 Bacteria 3599
258 Ga0496110_0064899 3300048913 Bacteria 3228
259 Ga0496111_0097465 3300048914 Bacteria 2158
260 Ga0496111_0104473 3300048914 Bacteria 2084
261 Ga0496112_0058126 3300048915 Bacteria 3808
262 Ga0496112_0078388 3300048915 Bacteria 3267
263 Ga0496112_0431726 3300048915 Bacteria 1256
264 Ga0496117_0033562 3300048920 Bacteria 3879
265 Ga0496118_0011636 3300048921 Bacteria 8558
266 Ga0496121_0020700 3300048924 Bacteria 6490
267 Ga0496121_0075805 3300048924 Bacteria 2685
268 Ga0496124_0069401 3300048927 Bacteria 2926
269 nmdc:mga00v17_76271_c1 3300050491 Bacteria 2085
270 nmdc:mga0yw44_27800_c1 3300050492 Bacteria 3245
271 nmdc:mga06z11_14306_c1 3300050494 Bacteria 3511
272 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
273 nmdc:mga05p37_20823_c1 3300050507 Bacteria 7937
274 nmdc:mga05p37_251461_c1 3300050507 Bacteria 2120
275 nmdc:mga0qj67_47509_c1 3300050509 Bacteria 3391
276 nmdc:mga06r32_31245_c1 3300050510 Bacteria 5000
277 nmdc:mga06r32_317_c1 3300050510 Bacteria 40324
278 nmdc:mga08y16_3140_c1 3300050511 Bacteria 17100
279 nmdc:mga08y16_35289_c1 3300050511 Bacteria 5251
280 nmdc:mga08y16_409092_c1 3300050511 Bacteria 1388
281 nmdc:mga0n895_17401_c1 3300050512 Bacteria 6623
282 nmdc:mga0n895_66872_c1 3300050512 Bacteria 3558
283 nmdc:mga0a205_12164_c1 3300050515 Bacteria 7957
284 Ga0500566_0000047 3300053094 Bacteria 58577
285 Ga0500566_0002955 3300053094 Bacteria 10152
286 Ga0500640_000432 3300053095 Bacteria 10166
287 Ga0500640_041956 3300053095 Bacteria 2009
288 Ga0500554_000447 3300053102 Bacteria 8698
289 Ga0500572_000033 3300053111 Bacteria 43170
290 Ga0500572_000060 3300053111 Bacteria 33826
291 Ga0500595_000282 3300053119 Bacteria 33662
292 Ga0500608_041214 3300053122 Bacteria 2214
293 Ga0500608_046506 3300053122 Unclassified 2085
294 Ga0500614_000509 3300053123 Bacteria 10081
295 Ga0500614_001305 3300053123 Bacteria 6018
296 Ga0500559_0000142 3300053136 Bacteria 55814
297 Ga0500559_0003098 3300053136 Bacteria 8279
298 Ga0500590_054235 3300053148 Bacteria 2030
299 Ga0500630_000804 3300053159 Bacteria 14475
300 Ga0500639_000057 3300053163 Bacteria 50484
301 Ga0500636_0034876 3300053177 Bacteria 2978
302 Ga0500636_0039512 3300053177 Bacteria 2791
303 Ga0500637_0040112 3300053178 Bacteria 2643
304 Ga0500596_000445 3300053735 Bacteria 7674
305 Ga0500601_008559 3300053737 Bacteria 1139
306 2513892633 2513237141 Bacteria 8496279
307 rootH1_10192394
308 Ga0055539_1006582
309 Ga0070658_10051337
310 Ga0070658_10242446
311 Ga0070683_100049194
312 Ga0070677_10055904
313 Ga0068869_100017676
314 Ga0070666_10075760
315 Ga0070689_100006674
316 Ga0070691_10061337
317 Ga0070661_100014124
318 Ga0070661_100260120
319 Ga0070692_10124457
320 Ga0070669_100105656
321 Ga0070675_100383886
322 Ga0070671_100584213
323 Ga0070674_100033409
324 Ga0070673_100475177
325 Ga0070709_10013575
326 Ga0070709_10050980
327 Ga0070713_100087703
328 Ga0070710_10040508
329 Ga0070701_10156237
330 Ga0070711_100046240
331 Ga0070711_100060251
332 Ga0070711_100097239
333 Ga0070700_100123531
334 Ga0070708_100091809
335 Ga0070663_100003543
336 Ga0070681_10037135
337 Ga0068867_100297969
338 Ga0070706_100021236
339 Ga0070706_100081162
340 Ga0070706_100144187
341 Ga0070706_100460915
342 Ga0070707_100012305
343 Ga0070698_100049668
344 Ga0070699_100015971
345 Ga0070679_100056651
346 Ga0070684_100002372
347 Ga0070684_100140479
348 Ga0070697_100014241
349 Ga0068853_100153300
350 Ga0070686_100026838
351 Ga0070665_100118925
352 Ga0068855_100036261
353 Ga0070664_100199432
354 Ga0070664_100410591
355 Ga0068857_100228690
356 Ga0068854_100024085
357 Ga0068854_100045992
358 Ga0068854_100050056
359 Ga0068856_100123436
360 Ga0068856_100172298
361 Ga0070702_100079715
362 Ga0068852_100040936
363 Ga0068852_100423930
364 Ga0068859_100082522
365 Ga0068859_100231472
366 Ga0068866_10033591
367 Ga0068861_100243977
368 Ga0068851_10008242
369 Ga0068870_10006679
370 Ga0068870_10152111
371 Ga0068863_100096497
372 Ga0068863_100177798
373 Ga0068863_100178273
374 Ga0068858_100113635
375 Ga0068858_100169319
376 Ga0068860_100307560
377 Ga0068862_100035530
378 Ga0081455_10031150
379 Ga0081455_10324295
380 Ga0081540_1006292
381 Ga0081540_1021504
382 Ga0070717_10019442
383 Ga0070717_10040559
384 Ga0075365_10007530
385 Ga0070716_100004392
386 Ga0068871_100037850
387 Ga0075428_100005811
388 Ga0075428_100022309
389 Ga0075430_100027142
390 Ga0075430_100050728
391 Ga0075431_100000033
392 Ga0075431_100031399
393 Ga0075434_100011039
394 Ga0075434_100036198
395 Ga0075434_100154001
396 Ga0068865_100036422
397 Ga0097620_100082519
398 Ga0097620_100231469
399 Ga0075435_100177757
400 Ga0099795_10000626
401 Ga0105240_10067749
402 Ga0111539_10003315
403 Ga0114129_10000413
404 Ga0114129_10008487
405 Ga0114129_10032204
406 Ga0114129_10135333
407 Ga0114129_10234185
408 Ga0114129_10235123
409 Ga0105243_10029548
410 Ga0105241_10001556
411 Ga0105248_10055482
412 Ga0105237_10025608
413 Ga0105238_10061518
414 Ga0105238_10187260
415 Ga0105249_10023405
416 Ga0105249_10315706
417 Ga0099796_10000969
418 Ga0105239_10145178
419 Ga0157315_1000420
420 Ga0157373_10006085
421 Ga0157374_10226331
422 Ga0157372_10630696
423 Ga0163163_10023611
424 Ga0163163_10092417
425 Ga0163163_10093502
426 Ga0163163_10109879
427 Ga0157380_10039538
428 Ga0157379_10131619
429 Ga0157376_10009788
430 Ga0157376_10199988
431 Ga0213872_10036786
432 Ga0213872_10040483
433 Ga0213875_10014538
434 Ga0209233_1000867
435 Ga0209455_1002017
436 Ga0207697_10000319
437 Ga0207656_10016811
438 Ga0207682_10001247
439 Ga0207692_10024502
440 Ga0207688_10000328
441 Ga0207680_10073842
442 Ga0207643_10001524
443 Ga0207707_10044142
444 Ga0207695_10040016
445 Ga0207693_10022650
446 Ga0207662_10001255
447 Ga0207657_10000093
448 Ga0207657_10016706
449 Ga0207649_10144774
450 Ga0207652_10277011
451 Ga0207646_10045753
452 Ga0207694_10005715
453 Ga0207664_10224029
454 Ga0207706_10032576
455 Ga0207670_10034559
456 Ga0207669_10063464
457 Ga0207665_10004895
458 Ga0207711_10028660
459 Ga0207689_10001097
460 Ga0207661_10015070
461 Ga0207661_10084924
462 Ga0207679_10138065
463 Ga0207667_10000410
464 Ga0207667_10108801
465 Ga0207667_10481585
466 Ga0207640_10133960
467 Ga0207677_10327631
468 Ga0207703_10693373
469 Ga0207639_10328536
470 Ga0207678_10000689
471 Ga0207678_10006713
472 Ga0207708_10003259
473 Ga0207708_10117492
474 Ga0207641_10020118
475 Ga0207641_10025761
476 Ga0207641_10293785
477 Ga0207648_10001722
478 Ga0207676_10027301
479 Ga0207674_10000749
480 Ga0207674_10139106
481 Ga0207675_100000716
482 Ga0207683_10150523
483 Ga0207698_10000366
484 Ga0209974_10013132
485 Ga0207428_10002861
486 Ga0207428_10146561
487 Ga0268266_10014897
488 Ga0265319_1004272
489 Ga0265334_10018094
490 Ga0265323_10001986
491 Ga0265336_10000896
492 Ga0265338_10000146
493 Ga0265324_10044232
494 Ga0265327_10008688
495 Ga0307408_100152484
496 Ga0307410_10037769
497 Ga0307410_10059525
498 Ga0307407_10063164
499 Ga0307409_100073341
500 Ga0307409_100260842
501 Ga0307416_100009651
502 Ga0307411_10001243
503 Ga0307415_100042509
504 Ga0373926_0010208
505 Ga0373936_0027006
506 Ga0373945_0074525
507 Ga0373943_0026112
508 Ga0373943_0036048
509 Ga0373946_0009962
510 Ga0373935_0045384
511 Ga0373927_0074206
512 Ga0373947_0023270
513 Ga0373947_0183753
514 Ga0373925_0075678
515 Ga0373925_0077209
516 Ga0373925_0150855
517 Ga0373925_0338488
518 Ga0436364_0535269
519 Ga0436365_1218374
520 Ga0436365_1323982
521 Ga0436360_1046637
522 Ga0436361_0183440
523 Ga0436361_0537309
524 Ga0436361_0815982
525 Ga0436361_0925711
526 Ga0451853_3244122
527 Ga0495603_0050273
528 Ga0495580_0133922
529 Ga0495639_0074213
530 Ga0495584_0001246
531 Ga0495584_0021678
532 Ga0495607_0050200
533 Ga0495632_0148459
534 Ga0495640_0106284
535 Ga0495640_0208396
536 Ga0495633_0086474
537 Ga0495668_0068963
538 Ga0495661_0030817
539 Ga0495658_0008170
540 Ga0495658_0022842
541 Ga0495658_0086921
542 Ga0495613_0230467
543 Ga0495624_0200551
544 Ga0495679_030821
545 Ga0495593_0028555
546 Ga0495614_0133664
547 Ga0496100_0116894
548 Ga0496100_0125514
549 Ga0496100_0214027
550 Ga0496101_0194307
551 Ga0496102_0064106
552 Ga0496103_0047248
553 Ga0496104_0027671
554 Ga0496104_0065658
555 Ga0496105_0065412
556 Ga0496106_0062123
557 Ga0496106_0306278
558 Ga0496107_0241390
559 Ga0496108_0001716
560 Ga0496108_0412718
561 Ga0496109_0058053
562 Ga0496109_0084888
563 Ga0496110_0052037
564 Ga0496110_0064899
565 Ga0496111_0097465
566 Ga0496111_0104473
567 Ga0496112_0058126
568 Ga0496112_0078388
569 Ga0496112_0431726
570 Ga0496117_0033562
571 Ga0496118_0011636
572 Ga0496121_0020700
573 Ga0496121_0075805
574 Ga0496124_0069401
575 nmdc:mga00v17_76271_c1
576 nmdc:mga0yw44_27800_c1
577 nmdc:mga06z11_14306_c1
578 nmdc:mga05p37_14_c1
579 nmdc:mga05p37_20823_c1
580 nmdc:mga05p37_251461_c1
581 nmdc:mga0qj67_47509_c1
582 nmdc:mga06r32_31245_c1
583 nmdc:mga06r32_317_c1
584 nmdc:mga08y16_3140_c1
585 nmdc:mga08y16_35289_c1
586 nmdc:mga08y16_409092_c1
587 nmdc:mga0n895_17401_c1
588 nmdc:mga0n895_66872_c1
589 nmdc:mga0a205_12164_c1
590 Ga0500566_0000047
591 Ga0500566_0002955
592 Ga0500640_000432
593 Ga0500640_041956
594 Ga0500554_000447
595 Ga0500572_000033
596 Ga0500572_000060
597 Ga0500595_000282
598 Ga0500608_041214
599 Ga0500608_046506
600 Ga0500614_000509
601 Ga0500614_001305
602 Ga0500559_0000142
603 Ga0500559_0003098
604 Ga0500590_054235
605 Ga0500630_000804
606 Ga0500639_000057
607 Ga0500636_0034876
608 Ga0500636_0039512
609 Ga0500637_0040112
610 Ga0500596_000445
611 Ga0500601_008559
612 2513892633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02668

TauD

Taurine catabolism dioxygenase TauD, TfdA family

17

288

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ffa-assembly1.cif.gz_D sulfatase from mycobacterium tuberculosis 0.9491 16 292
1oij-assembly3.cif.gz_C crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9405 16 292
6d3j-assembly1.cif.gz_A ft_t dioxygenase holoenzyme 0.9377 14 293
1oij-assembly4.cif.gz_D crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.935 16 292
1oij-assembly2.cif.gz_B crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate 0.9342 16 292
ID Description Score Start End Superfamily
1vz4D00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.923 16 292 3.60.130.10
5hsxA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.888 16 292 3.60.130.10
6d0oA00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8743 15 293 3.60.130.10
1gqwB00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8729 16 292 3.60.130.10
4y0eD00 Alpha Beta;4-Layer Sandwich;Double-stranded beta-helix;Clavaminate synthase-like 0.8703 12 292 3.60.130.10
ID Description Score Start End GO Terms
AF-A0A854EF96-F1-model_v4 deleted 0.979 17 292
AF-A0A2D9F788-F1-model_v4 Taurine dioxygenase 0.9783 37 292 GO:0000908
GO:0005737
GO:0006790
AF-A0A815G0U2-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9777 152 292 GO:0005737
GO:0006790
GO:0051213
AF-A0A537NV02-F1-model_v4 TauD/TfdA family dioxygenase 0.9774 23 293 GO:0000908
GO:0005737
GO:0006790
AF-A0A382M409-F1-model_v4 TauD/TfdA-like domain-containing protein 0.9724 17 239 GO:0000908
GO:0005737
GO:0006790

Map