F398362

General Info

Members Datasets Scaffolds Average Seq Length
305 184 610 366

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_7856_c1|nmdc:mga00v17_7856_c1_3963_5192
Length 409
Sequence MASLRSLLHIYVEIKQSAHPRQRVLPTSSGAADTGRMSAHAIDTRPATAKLLGWDCVEFWVGNARTTAGFLMSAFGFRCTAYGGPETGLTSKASYVLEQGDIRFVVSGALAADSPIADHVRRHGDGVHDLAWLVDDASVAFESAIGRGATAVRPPWREADENGELELAQVAAFGDTVHTFVNRGRYRGTNLEPGYAADNLPNPTVGPPVGLLNIDHVVGNVEKGKLDDWVGFYGDVFGFAAMQHFAEDQIRTEHSALMSTVVWNGASIVMPINEPADGRKKSQIQEYIEHYDGPGVQHIALRTDDIVATVQALRDRGVRFMRVPDTYYEDAKLRLAEFDLPWAELQRLNILADKDHEGYLLQIFTETITDRPAVFFEIIERRGAAGFGEGNFKALFEAIERDQERRGNL

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.9
Nodule 0
Rhizoplane 5.25
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_7856_c1 3300050491 Bacteria 5721
2 SwRhRL2b_contig_3044230 2162886007 Bacteria 1558
3 Ga0065704_10086257 3300005289 Bacteria 3139
4 Ga0070683_100008157 3300005329 Bacteria 8896
5 Ga0070691_10053734 3300005341 Bacteria 1928
6 Ga0070669_100014731 3300005353 Bacteria 5568
7 Ga0070671_100000253 3300005355 Bacteria 35862
8 Ga0070671_100079346 3300005355 Bacteria 2744
9 Ga0070674_100021889 3300005356 Bacteria 4114
10 Ga0070709_10049164 3300005434 Bacteria 2635
11 Ga0070714_100003386 3300005435 Bacteria 11885
12 Ga0070714_100184684 3300005435 Bacteria 1899
13 Ga0070713_100059235 3300005436 Bacteria 3197
14 Ga0070662_100042546 3300005457 Bacteria 3245
15 Ga0070681_10043241 3300005458 Bacteria 4513
16 Ga0070681_10071958 3300005458 Bacteria 3422
17 Ga0070698_100012639 3300005471 Bacteria 8940
18 Ga0070679_100153024 3300005530 Bacteria 2283
19 Ga0070695_100000024 3300005545 Bacteria 60106
20 Ga0070695_100161637 3300005545 Bacteria 1572
21 Ga0068857_100002367 3300005577 Bacteria 15368
22 Ga0068859_100263780 3300005617 Bacteria 1814
23 Ga0068859_100435841 3300005617 Bacteria 1407
24 Ga0068858_100010768 3300005842 Bacteria 8647
25 Ga0068858_100115732 3300005842 Bacteria 2506
26 Ga0081455_10036177 3300005937 Bacteria 4400
27 Ga0070717_10074508 3300006028 Bacteria 2837
28 Ga0075365_10021043 3300006038 Bacteria 4060
29 Ga0075365_10069026 3300006038 Bacteria 2375
30 Ga0075363_100007016 3300006048 Bacteria 5150
31 Ga0075364_10002251 3300006051 Bacteria 10822
32 Ga0075364_10010128 3300006051 Bacteria 5686
33 Ga0075364_10012421 3300006051 Bacteria 5208
34 Ga0075432_10005689 3300006058 Bacteria 4244
35 Ga0075367_10039051 3300006178 Bacteria 2767
36 Ga0075428_100000156 3300006844 Bacteria 62057
37 Ga0075428_100009486 3300006844 Bacteria 10804
38 Ga0075428_100244158 3300006844 Bacteria 1937
39 Ga0075434_100189325 3300006871 Bacteria 2078
40 Ga0068865_100048581 3300006881 Bacteria 2921
41 Ga0075436_100074908 3300006914 Bacteria 2344
42 Ga0097620_100263776 3300006931 Bacteria 1814
43 Ga0097620_100435825 3300006931 Bacteria 1407
44 Ga0105240_10020138 3300009093 Bacteria 8904
45 Ga0105240_10162009 3300009093 Bacteria 2656
46 Ga0111539_10000579 3300009094 Bacteria 47092
47 Ga0111539_10062795 3300009094 Bacteria 4396
48 Ga0105245_10005701 3300009098 Bacteria 10936
49 Ga0105245_10069040 3300009098 Bacteria 3204
50 Ga0105243_10181226 3300009148 Bacteria 1832
51 Ga0105243_10239866 3300009148 Bacteria 1613
52 Ga0105242_10343483 3300009176 Bacteria 1376
53 Ga0105237_10016224 3300009545 Bacteria 7744
54 Ga0105249_10191110 3300009553 Bacteria 1998
55 Ga0105239_10231820 3300010375 Bacteria 2071
56 Ga0157369_10116001 3300013105 Bacteria 2844
57 Ga0157378_10012023 3300013297 Bacteria 7576
58 Ga0163162_10514580 3300013306 Bacteria 1327
59 Ga0157380_10031944 3300014326 Bacteria 4045
60 Ga0182008_10001206 3300014497 Bacteria 17813
61 Ga0182006_1016637 3300015261 Bacteria 3134
62 Ga0182007_10010390 3300015262 Bacteria 3682
63 Ga0197907_10264587 3300020069 Bacteria 2192
64 Ga0197907_11171301 3300020069 Eukaryota 1299
65 Ga0197907_11480829 3300020069 Eukaryota 1346
66 Ga0206350_10145274 3300020080 Bacteria 1512
67 Ga0213876_10031975 3300021384 Bacteria 2776
68 Ga0207642_10079921 3300025899 Bacteria 1584
69 Ga0207707_10061254 3300025912 Bacteria 3274
70 Ga0207707_10086801 3300025912 Bacteria 2734
71 Ga0207707_10108197 3300025912 Bacteria 2430
72 Ga0207695_10084270 3300025913 Bacteria 3210
73 Ga0207695_10139341 3300025913 Bacteria 2376
74 Ga0207660_10135417 3300025917 Bacteria 1879
75 Ga0207646_10206175 3300025922 Bacteria 1776
76 Ga0207687_10000507 3300025927 Bacteria 26224
77 Ga0207664_10000130 3300025929 Bacteria 65679
78 Ga0207664_10065363 3300025929 Bacteria 2912
79 Ga0207664_10183755 3300025929 Bacteria 1796
80 Ga0207664_10309029 3300025929 Bacteria 1392
81 Ga0207706_10052353 3300025933 Bacteria 3604
82 Ga0207704_10102775 3300025938 Bacteria 1910
83 Ga0207704_10277779 3300025938 Bacteria 1272
84 Ga0207661_10013028 3300025944 Bacteria 6068
85 Ga0207661_10073767 3300025944 Bacteria 2796
86 Ga0207667_10433542 3300025949 Bacteria 1337
87 Ga0207668_10130762 3300025972 Bacteria 1917
88 Ga0207658_10416687 3300025986 Bacteria 1184
89 Ga0207703_10025717 3300026035 Bacteria 4631
90 Ga0207708_10047183 3300026075 Bacteria 3280
91 Ga0207702_10187101 3300026078 Bacteria 1910
92 Ga0207648_10064899 3300026089 Bacteria 3183
93 Ga0207676_10150758 3300026095 Bacteria 2002
94 Ga0207674_10001001 3300026116 Bacteria 36849
95 Ga0207674_10027955 3300026116 Bacteria 5960
96 Ga0207675_100147736 3300026118 Bacteria 2236
97 Ga0207698_10239623 3300026142 Bacteria 1652
98 Ga0207428_10018406 3300027907 Bacteria 5969
99 Ga0207428_10061619 3300027907 Bacteria 2969
100 Ga0268264_10018225 3300028381 Bacteria 5742
101 Ga0265336_10002195 3300028666 Bacteria 8214
102 Ga0265336_10042052 3300028666 Bacteria 1395
103 Ga0265338_10019160 3300028800 Bacteria 7281
104 Ga0265338_10026306 3300028800 Bacteria 5873
105 Ga0265325_10037500 3300031241 Bacteria 2562
106 Ga0265339_10007886 3300031249 Bacteria 6832
107 Ga0265327_10054700 3300031251 Bacteria 2065
108 Ga0265316_10006999 3300031344 Bacteria 10687
109 Ga0307408_100022701 3300031548 Bacteria 4267
110 Ga0265313_10035284 3300031595 Bacteria 2521
111 Ga0316579_10049549 3300031691 Bacteria 1963
112 Ga0265342_10019510 3300031712 Bacteria 4367
113 Ga0316576_10024730 3300031727 Bacteria 4196
114 Ga0307413_10003476 3300031824 Bacteria 6634
115 Ga0307410_10001473 3300031852 Bacteria 10649
116 Ga0307406_10017454 3300031901 Bacteria 4178
117 Ga0307406_10064960 3300031901 Bacteria 2370
118 Ga0307407_10049936 3300031903 Bacteria 2390
119 Ga0307412_10029909 3300031911 Bacteria 3423
120 Ga0307409_100001311 3300031995 Bacteria 12073
121 Ga0307414_10040183 3300032004 Bacteria 3157
122 Ga0307415_100050266 3300032126 Bacteria 2824
123 Ga0316574_0044710 3300035398 Bacteria 2741
124 Ga0316584_0082029 3300036712 Bacteria 2415
125 Ga0373925_0003110 3300037068 Bacteria 13025
126 Ga0395900_0074692 3300037418 Bacteria 3485
127 Ga0395900_0109693 3300037418 Bacteria 2835
128 Ga0436364_1457435 3300037853 Bacteria 3953
129 Ga0395901_0027886 3300038443 Bacteria 5806
130 Ga0395901_0073152 3300038443 Bacteria 3574
131 Ga0436365_0595457 3300039437 Bacteria 1455
132 Ga0436365_1018361 3300039437 Bacteria 3585
133 Ga0436365_1149463 3300039437 Bacteria 8946
134 Ga0436365_1238068 3300039437 Bacteria 1370
135 Ga0436360_1165091 3300039438 Bacteria 29560
136 Ga0439451_013002 3300042009 Bacteria 1681
137 Ga0466966_0018450 3300044684 Bacteria 4601
138 Ga0466966_0033383 3300044684 Bacteria 3332
139 Ga0466966_0044961 3300044684 Bacteria 2824
140 Ga0466961_0006328 3300044693 Bacteria 7517
141 Ga0466963_0002976 3300044694 Bacteria 9572
142 Ga0466963_0003955 3300044694 Bacteria 8573
143 Ga0466963_0006014 3300044694 Bacteria 7149
144 Ga0466963_0011725 3300044694 Bacteria 5344
145 Ga0466963_0013751 3300044694 Bacteria 4978
146 Ga0466963_0015140 3300044694 Bacteria 4769
147 Ga0466963_0113938 3300044694 Bacteria 1857
148 Ga0466964_0004916 3300044706 Bacteria 4942
149 Ga0466964_0011001 3300044706 Bacteria 3417
150 Ga0466964_0032344 3300044706 Bacteria 2078
151 Ga0466971_0001397 3300044719 Bacteria 10134
152 Ga0466971_0002092 3300044719 Bacteria 8471
153 Ga0466970_0001753 3300044765 Bacteria 10467
154 Ga0466957_0001842 3300044842 Bacteria 11196
155 Ga0466957_0009915 3300044842 Bacteria 5446
156 Ga0466960_0001020 3300044901 Bacteria 10015
157 Ga0466959_0002212 3300045049 Bacteria 12384
158 Ga0466959_0002632 3300045049 Bacteria 11519
159 Ga0466959_0010168 3300045049 Bacteria 6716
160 Ga0466959_0019061 3300045049 Bacteria 5043
161 Ga0466959_0062566 3300045049 Bacteria 2704
162 Ga0466959_0183593 3300045049 Bacteria 1462
163 Ga0466958_0002651 3300045836 Bacteria 9043
164 Ga0466958_0003553 3300045836 Bacteria 8108
165 Ga0466958_0003799 3300045836 Bacteria 7884
166 Ga0466958_0003816 3300045836 Bacteria 7869
167 Ga0466958_0005635 3300045836 Bacteria 6758
168 Ga0466958_0070138 3300045836 Bacteria 2144
169 Ga0466967_0002492 3300045976 Bacteria 11497
170 Ga0466967_0002571 3300045976 Bacteria 11393
171 Ga0466967_0003462 3300045976 Bacteria 10304
172 Ga0466967_0008590 3300045976 Bacteria 7503
173 Ga0466967_0015146 3300045976 Bacteria 6036
174 Ga0466967_0038285 3300045976 Bacteria 4111
175 Ga0466967_0041823 3300045976 Bacteria 3955
176 Ga0466967_0060632 3300045976 Bacteria 3353
177 Ga0466967_0172739 3300045976 Bacteria 2034
178 Ga0466967_0382582 3300045976 Bacteria 1366
179 Ga0495629_0176560 3300046459 Bacteria 1481
180 Ga0495651_0010163 3300046462 Bacteria 7226
181 Ga0495653_0006377 3300046463 Bacteria 9673
182 Ga0495605_0075235 3300046474 Bacteria 1588
183 Ga0495585_0104375 3300046492 Bacteria 1513
184 Ga0495583_0047604 3300046506 Bacteria 1971
185 Ga0495628_0027040 3300046516 Bacteria 4670
186 Ga0495628_0029066 3300046516 Bacteria 4486
187 Ga0495631_0108105 3300046518 Bacteria 1196
188 Ga0495587_0052020 3300046536 Bacteria 2418
189 Ga0495597_0056002 3300046542 Bacteria 1728
190 Ga0495635_0019168 3300046663 Bacteria 4774
191 Ga0495657_0046322 3300046675 Bacteria 2945
192 Ga0495599_0027482 3300046678 Bacteria 3566
193 Ga0495646_0060380 3300046680 Bacteria 2261
194 Ga0495671_0142906 3300046692 Bacteria 1166
195 Ga0495649_0104401 3300046694 Bacteria 1505
196 Ga0495589_0064708 3300046794 Bacteria 1793
197 Ga0495600_0056793 3300046809 Bacteria 2558
198 Ga0495600_0097516 3300046809 Bacteria 1916
199 Ga0495683_0020249 3300047323 Bacteria 3433
200 Ga0495677_0009045 3300047445 Bacteria 3684
201 Ga0495684_0082274 3300047471 Bacteria 2443
202 Ga0496102_0053741 3300048905 Bacteria 3671
203 Ga0496102_0186447 3300048905 Bacteria 1955
204 Ga0496104_0008123 3300048907 Bacteria 9314
205 Ga0496104_0132137 3300048907 Bacteria 2398
206 Ga0496105_0000765 3300048908 Bacteria 21841
207 Ga0496108_0036368 3300048911 Bacteria 4097
208 Ga0496109_0007140 3300048912 Bacteria 9437
209 Ga0496109_0007221 3300048912 Bacteria 9394
210 Ga0496109_0290679 3300048912 Bacteria 1541
211 Ga0496110_0002921 3300048913 Bacteria 12938
212 Ga0496110_0009969 3300048913 Bacteria 7707
213 Ga0496110_0116591 3300048913 Bacteria 2404
214 Ga0496110_0226477 3300048913 Bacteria 1700
215 Ga0496112_0059016 3300048915 Bacteria 3780
216 Ga0496114_0128318 3300048917 Bacteria 2188
217 Ga0496114_0286039 3300048917 Bacteria 1454
218 Ga0501317_006616 3300049533 Eukaryota 1281
219 Ga0501321_005127 3300049537 Eukaryota 1284
220 Ga0501031_0007581 3300049568 Bacteria 7069
221 Ga0501031_0108924 3300049568 Bacteria 1809
222 Ga0501033_0026226 3300049570 Bacteria 4388
223 Ga0501034_0007296 3300049571 Bacteria 11785
224 Ga0501036_0047475 3300049572 Bacteria 3636
225 Ga0501036_0156467 3300049572 Bacteria 1922
226 Ga0501038_0041159 3300049574 Bacteria 4030
227 Ga0501039_0014184 3300049575 Bacteria 6103
228 Ga0501039_0059955 3300049575 Bacteria 2947
229 Ga0501040_0000510 3300049576 Bacteria 23276
230 Ga0501041_0000717 3300049577 Bacteria 17623
231 Ga0501041_0039469 3300049577 Bacteria 2865
232 Ga0501042_0000504 3300049578 Bacteria 20325
233 Ga0501042_0054490 3300049578 Bacteria 2853
234 Ga0501042_0065157 3300049578 Bacteria 2604
235 Ga0501043_0074219 3300049579 Bacteria 2672
236 Ga0501046_0036807 3300049580 Bacteria 3936
237 Ga0501046_0193540 3300049580 Bacteria 1516
238 Ga0501048_0031770 3300049582 Bacteria 3818
239 Ga0501048_0062337 3300049582 Bacteria 2639
240 Ga0501067_0020163 3300049583 Bacteria 3688
241 Ga0501067_0039539 3300049583 Bacteria 2619
242 Ga0501067_0051013 3300049583 Bacteria 2293
243 Ga0501067_0112855 3300049583 Bacteria 1511
244 Ga0501068_0042537 3300049584 Bacteria 2732
245 Ga0501069_0000010 3300049585 Bacteria 154317
246 Ga0501069_0005317 3300049585 Bacteria 6690
247 Ga0501069_0007813 3300049585 Bacteria 5616
248 Ga0501069_0049159 3300049585 Bacteria 2343
249 Ga0501069_0057379 3300049585 Bacteria 2170
250 Ga0501070_0000005 3300049586 Bacteria 250033
251 Ga0501070_0139949 3300049586 Bacteria 1998
252 Ga0501070_0390860 3300049586 Bacteria 1126
253 Ga0501071_0005551 3300049587 Bacteria 8124
254 Ga0501071_0015168 3300049587 Bacteria 5285
255 Ga0501072_0001139 3300049588 Bacteria 19734
256 Ga0501072_0030992 3300049588 Bacteria 4184
257 Ga0501074_0004493 3300049590 Bacteria 9985
258 Ga0501074_0005582 3300049590 Bacteria 9050
259 Ga0501075_0004485 3300049591 Bacteria 9454
260 Ga0501075_0063254 3300049591 Bacteria 2789
261 Ga0501076_0021555 3300049592 Bacteria 4943
262 Ga0501076_0025628 3300049592 Bacteria 4566
263 Ga0501076_0198924 3300049592 Bacteria 1636
264 Ga0501077_0004196 3300049593 Bacteria 8709
265 Ga0501079_0056172 3300049741 Bacteria 3038
266 Ga0501079_0208604 3300049741 Bacteria 1526
267 Ga0501080_0000352 3300049742 Bacteria 35349
268 Ga0501080_0001292 3300049742 Bacteria 20823
269 Ga0501080_0033113 3300049742 Bacteria 4823
270 Ga0501080_0041813 3300049742 Bacteria 4269
271 Ga0501081_0026629 3300049743 Bacteria 3900
272 Ga0501081_0096826 3300049743 Bacteria 2082
273 Ga0501035_0084389 3300049822 Bacteria 2801
274 Ga0501035_0116575 3300049822 Bacteria 2337
275 Ga0501044_0505295 3300049823 Bacteria 1110
276 Ga0501045_0003654 3300049824 Bacteria 10577
277 Ga0501045_0024011 3300049824 Bacteria 4376
278 Ga0501045_0035519 3300049824 Bacteria 3619
279 Ga0501045_0124896 3300049824 Bacteria 1911
280 nmdc:mga03683_42919_c1 3300050489 Bacteria 1863
281 nmdc:mga03n38_47126_c1 3300050490 Bacteria 1906
282 nmdc:mga00v17_1344_c1 3300050491 Bacteria 12870
283 nmdc:mga00v17_241038_c1 3300050491 Bacteria 1172
284 nmdc:mga00v17_3091_c1 3300050491 Bacteria 8561
285 nmdc:mga0yw44_1011_c1 3300050492 Bacteria 10751
286 nmdc:mga0yw44_26690_c1 3300050492 Bacteria 3302
287 nmdc:mga08y16_33315_c1 3300050511 Bacteria 5411
288 nmdc:mga08y16_5491_c1 3300050511 Bacteria 13254
289 Ga0495612_0110220 3300053078 Bacteria 1177
290 Ga0495595_0001982 3300053084 Bacteria 7956
291 Ga0495619_0012522 3300053085 Bacteria 5343
292 Ga0500566_0046158 3300053094 Bacteria 2504
293 Ga0500568_0007641 3300053139 Bacteria 5282
294 Ga0500616_0000141 3300053153 Bacteria 122164
295 Ga0501084_0002789 3300054114 Bacteria 14103
296 Ga0501084_0007583 3300054114 Bacteria 8948
297 Ga0501082_0007358 3300060353 Bacteria 9500
298 Ga0501082_0035487 3300060353 Bacteria 4298
299 Ga0501082_0079262 3300060353 Bacteria 2833
300 Ga0501082_0145537 3300060353 Bacteria 2057
301 Ga0466962_0001082 3300061719 Bacteria 12498
302 Ga0466962_0010510 3300061719 Bacteria 4451
303 Ga0530510_0003634 3300061734 Bacteria 10612
304 Ga0530510_0095745 3300061734 Bacteria 2169
305 Ga0530510_0219017 3300061734 Bacteria 1415
306 nmdc:mga00v17_7856_c1
307 SwRhRL2b_contig_3044230
308 Ga0065704_10086257
309 Ga0070683_100008157
310 Ga0070691_10053734
311 Ga0070669_100014731
312 Ga0070671_100000253
313 Ga0070671_100079346
314 Ga0070674_100021889
315 Ga0070709_10049164
316 Ga0070714_100003386
317 Ga0070714_100184684
318 Ga0070713_100059235
319 Ga0070662_100042546
320 Ga0070681_10043241
321 Ga0070681_10071958
322 Ga0070698_100012639
323 Ga0070679_100153024
324 Ga0070695_100000024
325 Ga0070695_100161637
326 Ga0068857_100002367
327 Ga0068859_100263780
328 Ga0068859_100435841
329 Ga0068858_100010768
330 Ga0068858_100115732
331 Ga0081455_10036177
332 Ga0070717_10074508
333 Ga0075365_10021043
334 Ga0075365_10069026
335 Ga0075363_100007016
336 Ga0075364_10002251
337 Ga0075364_10010128
338 Ga0075364_10012421
339 Ga0075432_10005689
340 Ga0075367_10039051
341 Ga0075428_100000156
342 Ga0075428_100009486
343 Ga0075428_100244158
344 Ga0075434_100189325
345 Ga0068865_100048581
346 Ga0075436_100074908
347 Ga0097620_100263776
348 Ga0097620_100435825
349 Ga0105240_10020138
350 Ga0105240_10162009
351 Ga0111539_10000579
352 Ga0111539_10062795
353 Ga0105245_10005701
354 Ga0105245_10069040
355 Ga0105243_10181226
356 Ga0105243_10239866
357 Ga0105242_10343483
358 Ga0105237_10016224
359 Ga0105249_10191110
360 Ga0105239_10231820
361 Ga0157369_10116001
362 Ga0157378_10012023
363 Ga0163162_10514580
364 Ga0157380_10031944
365 Ga0182008_10001206
366 Ga0182006_1016637
367 Ga0182007_10010390
368 Ga0197907_10264587
369 Ga0197907_11171301
370 Ga0197907_11480829
371 Ga0206350_10145274
372 Ga0213876_10031975
373 Ga0207642_10079921
374 Ga0207707_10061254
375 Ga0207707_10086801
376 Ga0207707_10108197
377 Ga0207695_10084270
378 Ga0207695_10139341
379 Ga0207660_10135417
380 Ga0207646_10206175
381 Ga0207687_10000507
382 Ga0207664_10000130
383 Ga0207664_10065363
384 Ga0207664_10183755
385 Ga0207664_10309029
386 Ga0207706_10052353
387 Ga0207704_10102775
388 Ga0207704_10277779
389 Ga0207661_10013028
390 Ga0207661_10073767
391 Ga0207667_10433542
392 Ga0207668_10130762
393 Ga0207658_10416687
394 Ga0207703_10025717
395 Ga0207708_10047183
396 Ga0207702_10187101
397 Ga0207648_10064899
398 Ga0207676_10150758
399 Ga0207674_10001001
400 Ga0207674_10027955
401 Ga0207675_100147736
402 Ga0207698_10239623
403 Ga0207428_10018406
404 Ga0207428_10061619
405 Ga0268264_10018225
406 Ga0265336_10002195
407 Ga0265336_10042052
408 Ga0265338_10019160
409 Ga0265338_10026306
410 Ga0265325_10037500
411 Ga0265339_10007886
412 Ga0265327_10054700
413 Ga0265316_10006999
414 Ga0307408_100022701
415 Ga0265313_10035284
416 Ga0316579_10049549
417 Ga0265342_10019510
418 Ga0316576_10024730
419 Ga0307413_10003476
420 Ga0307410_10001473
421 Ga0307406_10017454
422 Ga0307406_10064960
423 Ga0307407_10049936
424 Ga0307412_10029909
425 Ga0307409_100001311
426 Ga0307414_10040183
427 Ga0307415_100050266
428 Ga0316574_0044710
429 Ga0316584_0082029
430 Ga0373925_0003110
431 Ga0395900_0074692
432 Ga0395900_0109693
433 Ga0436364_1457435
434 Ga0395901_0027886
435 Ga0395901_0073152
436 Ga0436365_0595457
437 Ga0436365_1018361
438 Ga0436365_1149463
439 Ga0436365_1238068
440 Ga0436360_1165091
441 Ga0439451_013002
442 Ga0466966_0018450
443 Ga0466966_0033383
444 Ga0466966_0044961
445 Ga0466961_0006328
446 Ga0466963_0002976
447 Ga0466963_0003955
448 Ga0466963_0006014
449 Ga0466963_0011725
450 Ga0466963_0013751
451 Ga0466963_0015140
452 Ga0466963_0113938
453 Ga0466964_0004916
454 Ga0466964_0011001
455 Ga0466964_0032344
456 Ga0466971_0001397
457 Ga0466971_0002092
458 Ga0466970_0001753
459 Ga0466957_0001842
460 Ga0466957_0009915
461 Ga0466960_0001020
462 Ga0466959_0002212
463 Ga0466959_0002632
464 Ga0466959_0010168
465 Ga0466959_0019061
466 Ga0466959_0062566
467 Ga0466959_0183593
468 Ga0466958_0002651
469 Ga0466958_0003553
470 Ga0466958_0003799
471 Ga0466958_0003816
472 Ga0466958_0005635
473 Ga0466958_0070138
474 Ga0466967_0002492
475 Ga0466967_0002571
476 Ga0466967_0003462
477 Ga0466967_0008590
478 Ga0466967_0015146
479 Ga0466967_0038285
480 Ga0466967_0041823
481 Ga0466967_0060632
482 Ga0466967_0172739
483 Ga0466967_0382582
484 Ga0495629_0176560
485 Ga0495651_0010163
486 Ga0495653_0006377
487 Ga0495605_0075235
488 Ga0495585_0104375
489 Ga0495583_0047604
490 Ga0495628_0027040
491 Ga0495628_0029066
492 Ga0495631_0108105
493 Ga0495587_0052020
494 Ga0495597_0056002
495 Ga0495635_0019168
496 Ga0495657_0046322
497 Ga0495599_0027482
498 Ga0495646_0060380
499 Ga0495671_0142906
500 Ga0495649_0104401
501 Ga0495589_0064708
502 Ga0495600_0056793
503 Ga0495600_0097516
504 Ga0495683_0020249
505 Ga0495677_0009045
506 Ga0495684_0082274
507 Ga0496102_0053741
508 Ga0496102_0186447
509 Ga0496104_0008123
510 Ga0496104_0132137
511 Ga0496105_0000765
512 Ga0496108_0036368
513 Ga0496109_0007140
514 Ga0496109_0007221
515 Ga0496109_0290679
516 Ga0496110_0002921
517 Ga0496110_0009969
518 Ga0496110_0116591
519 Ga0496110_0226477
520 Ga0496112_0059016
521 Ga0496114_0128318
522 Ga0496114_0286039
523 Ga0501317_006616
524 Ga0501321_005127
525 Ga0501031_0007581
526 Ga0501031_0108924
527 Ga0501033_0026226
528 Ga0501034_0007296
529 Ga0501036_0047475
530 Ga0501036_0156467
531 Ga0501038_0041159
532 Ga0501039_0014184
533 Ga0501039_0059955
534 Ga0501040_0000510
535 Ga0501041_0000717
536 Ga0501041_0039469
537 Ga0501042_0000504
538 Ga0501042_0054490
539 Ga0501042_0065157
540 Ga0501043_0074219
541 Ga0501046_0036807
542 Ga0501046_0193540
543 Ga0501048_0031770
544 Ga0501048_0062337
545 Ga0501067_0020163
546 Ga0501067_0039539
547 Ga0501067_0051013
548 Ga0501067_0112855
549 Ga0501068_0042537
550 Ga0501069_0000010
551 Ga0501069_0005317
552 Ga0501069_0007813
553 Ga0501069_0049159
554 Ga0501069_0057379
555 Ga0501070_0000005
556 Ga0501070_0139949
557 Ga0501070_0390860
558 Ga0501071_0005551
559 Ga0501071_0015168
560 Ga0501072_0001139
561 Ga0501072_0030992
562 Ga0501074_0004493
563 Ga0501074_0005582
564 Ga0501075_0004485
565 Ga0501075_0063254
566 Ga0501076_0021555
567 Ga0501076_0025628
568 Ga0501076_0198924
569 Ga0501077_0004196
570 Ga0501079_0056172
571 Ga0501079_0208604
572 Ga0501080_0000352
573 Ga0501080_0001292
574 Ga0501080_0033113
575 Ga0501080_0041813
576 Ga0501081_0026629
577 Ga0501081_0096826
578 Ga0501035_0084389
579 Ga0501035_0116575
580 Ga0501044_0505295
581 Ga0501045_0003654
582 Ga0501045_0024011
583 Ga0501045_0035519
584 Ga0501045_0124896
585 nmdc:mga03683_42919_c1
586 nmdc:mga03n38_47126_c1
587 nmdc:mga00v17_1344_c1
588 nmdc:mga00v17_241038_c1
589 nmdc:mga00v17_3091_c1
590 nmdc:mga0yw44_1011_c1
591 nmdc:mga0yw44_26690_c1
592 nmdc:mga08y16_33315_c1
593 nmdc:mga08y16_5491_c1
594 Ga0495612_0110220
595 Ga0495595_0001982
596 Ga0495619_0012522
597 Ga0500566_0046158
598 Ga0500568_0007641
599 Ga0500616_0000141
600 Ga0501084_0002789
601 Ga0501084_0007583
602 Ga0501082_0007358
603 Ga0501082_0035487
604 Ga0501082_0079262
605 Ga0501082_0145537
606 Ga0466962_0001082
607 Ga0466962_0010510
608 Ga0530510_0003634
609 Ga0530510_0095745
610 Ga0530510_0219017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14696

Glyoxalase_5

Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

47

198

0.75

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

213

363

0.74

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

215

335

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r5v-assembly2.cif.gz_B hydroxymandelate synthase crystal structure 0.9487 19 366
1t47-assembly1.cif.gz_B structure of fe2-hppd bound to ntbc 0.9469 15 367
1sqi-assembly1.cif.gz_B structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases 0.9382 17 355
1sqi-assembly1.cif.gz_A structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases 0.9345 16 355
3zgj-assembly2.cif.gz_B s221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor 0.9318 17 366
ID Description Score Start End Superfamily
af_A0A1D8PHL9_249_477_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9817 171 372 3.10.180.10
1t47B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9724 15 170 3.10.180.10
af_Q76NV5_1_156_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9721 17 165 3.10.180.10
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9677 176 366 3.10.180.10
af_K7KBB9_206_354_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9434 172 312 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2W5ZEV0-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9993 16 107 GO:0003868
GO:0006572
GO:0046872
AF-A0A2V5T265-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9951 41 372 GO:0003868
GO:0006572
GO:0046872
AF-A0A2V6LT30-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9941 16 372 GO:0003868
GO:0006572
GO:0046872
AF-A0A2V5L5C8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9931 76 372 GO:0003868
GO:0006572
GO:0046872
AF-A0A661YEM4-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) 0.9931 96 372 GO:0003868
GO:0006572
GO:0046872

Map