F398298

General Info

Members Datasets Scaffolds Average Seq Length
305 183 610 272

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0229498|Ga0495680_0229498_156_1061
Length 301
Sequence MRKLVFTKMHGCGNDYIYIVADRMRPANPGALAQRLSDRRFGIGGDGLIMLCPSKTADVRMEMYNADGSRGEMCGNGIRCVARLHYELAGAPKNPLVVDTDCGPKTIAIKLDDAGRVAAATVDMGAPILDGREIPVDRDGRVIDFPLEVAGREYRITAVSMGNPHCVVFVDDDRIFTLDDAEFARLGRNFEHHPFFPRRVNTEFILPLARNRLKMRVWERGSGETLACGTGACAAQVAAVLTNRADRFATVELRGGNLEIEWRERGPAADHVFMTGEAIEVFKGEVEVADSELVSVDGAGG

Samples

Sample ID Description Type Environment
1 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.64
Rhizosphere 98.03
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495680_0229498 3300047322 Bacteria 1322
2 JGI25406J46586_10013378 3300003203 Bacteria 3526
3 JGI25405J52794_10003484 3300003911 Bacteria 2761
4 Ga0058859_11558127 3300004798 Bacteria 1289
5 Ga0065714_10109978 3300005288 Bacteria 1492
6 Ga0065704_10021825 3300005289 Bacteria 1338
7 Ga0065712_10000347 3300005290 Bacteria 16116
8 Ga0065712_10005299 3300005290 Bacteria 3081
9 Ga0065715_10000293 3300005293 Bacteria 17439
10 Ga0065707_10085136 3300005295 Bacteria 6411
11 Ga0065707_10116939 3300005295 Bacteria 2218
12 Ga0070658_10227519 3300005327 Bacteria 1579
13 Ga0070676_10062525 3300005328 Bacteria 2215
14 Ga0070690_100227911 3300005330 Bacteria 1309
15 Ga0070690_100292973 3300005330 Bacteria 1164
16 Ga0070670_100098247 3300005331 Bacteria 2519
17 Ga0070670_100209701 3300005331 Bacteria 1694
18 Ga0070666_10012634 3300005335 Bacteria 5333
19 Ga0070666_10124866 3300005335 Bacteria 1786
20 Ga0070680_100042500 3300005336 Bacteria 3688
21 Ga0070689_100338638 3300005340 Bacteria 1259
22 Ga0070661_100033939 3300005344 Bacteria 3699
23 Ga0070668_100477015 3300005347 Bacteria 1077
24 Ga0070675_100064668 3300005354 Bacteria 3024
25 Ga0070674_100343239 3300005356 Bacteria 1204
26 Ga0070667_100077463 3300005367 Bacteria 2839
27 Ga0070667_100095980 3300005367 Bacteria 2557
28 Ga0070694_100034999 3300005444 Bacteria 3316
29 Ga0070708_100618587 3300005445 Bacteria 1021
30 Ga0070678_100116125 3300005456 Bacteria 2102
31 Ga0070662_100380082 3300005457 Bacteria 1162
32 Ga0070662_100504385 3300005457 Bacteria 1010
33 Ga0070681_10236938 3300005458 Bacteria 1738
34 Ga0070685_10105406 3300005466 Bacteria 1728
35 Ga0070706_100183721 3300005467 Bacteria 1953
36 Ga0070706_100602010 3300005467 Bacteria 1021
37 Ga0070698_100189115 3300005471 Bacteria 1997
38 Ga0070698_100245670 3300005471 Bacteria 1723
39 Ga0070699_100002599 3300005518 Bacteria 16166
40 Ga0070699_100032635 3300005518 Bacteria 4496
41 Ga0070697_100046658 3300005536 Bacteria 3512
42 Ga0070697_100107548 3300005536 Unclassified 2321
43 Ga0070697_100196805 3300005536 Bacteria 1712
44 Ga0070697_100392798 3300005536 Bacteria 1203
45 Ga0070672_100025097 3300005543 Bacteria 4416
46 Ga0070686_100104961 3300005544 Bacteria 1915
47 Ga0070695_100075440 3300005545 Bacteria 2218
48 Ga0070695_100331178 3300005545 Bacteria 1135
49 Ga0070695_100399576 3300005545 Bacteria 1041
50 Ga0070696_100313263 3300005546 Bacteria 1205
51 Ga0070665_100074380 3300005548 Bacteria 3403
52 Ga0068855_100121216 3300005563 Bacteria 2993
53 Ga0070664_100071629 3300005564 Bacteria 2970
54 Ga0068854_100150319 3300005578 Bacteria 1795
55 Ga0068856_100315932 3300005614 Bacteria 1579
56 Ga0068859_100613245 3300005617 Bacteria 1181
57 Ga0068863_100036346 3300005841 Bacteria 4692
58 Ga0068862_100496323 3300005844 Bacteria 1158
59 Ga0081455_10000629 3300005937 Bacteria 45748
60 Ga0081538_10006059 3300005981 Bacteria 10744
61 Ga0081539_10000317 3300005985 Bacteria 107746
62 Ga0070715_10020255 3300006163 Bacteria 2563
63 Ga0070716_100013324 3300006173 Bacteria 4189
64 Ga0097621_100648335 3300006237 Bacteria 969
65 Ga0068871_100099888 3300006358 Bacteria 2430
66 Ga0075428_100004966 3300006844 Bacteria 14771
67 Ga0075428_100069743 3300006844 Bacteria 3843
68 Ga0075430_100081424 3300006846 Bacteria 2712
69 Ga0075430_100322087 3300006846 Unclassified 1278
70 Ga0075431_100042765 3300006847 Bacteria 4674
71 Ga0075431_100154042 3300006847 Bacteria 2365
72 Ga0075433_10000786 3300006852 Bacteria 21945
73 Ga0075433_10008784 3300006852 Bacteria 8062
74 Ga0075433_10033528 3300006852 Bacteria 4403
75 Ga0075433_10099677 3300006852 Unclassified 2572
76 Ga0075433_10211191 3300006852 Bacteria 1725
77 Ga0075434_100001619 3300006871 Bacteria 19135
78 Ga0075434_100013518 3300006871 Bacteria 7774
79 Ga0075434_100051748 3300006871 Bacteria 4081
80 Ga0075434_100073592 3300006871 Bacteria 3409
81 Ga0075434_100570057 3300006871 Bacteria 1151
82 Ga0075434_100629304 3300006871 Bacteria 1092
83 Ga0075434_100676192 3300006871 Bacteria 1050
84 Ga0075429_100372272 3300006880 Bacteria 1251
85 Ga0075436_100006006 3300006914 Bacteria 8343
86 Ga0075436_100018508 3300006914 Bacteria 4768
87 Ga0075436_100028702 3300006914 Bacteria 3827
88 Ga0075436_100044133 3300006914 Bacteria 3073
89 Ga0075436_100091315 3300006914 Bacteria 2117
90 Ga0097620_100613330 3300006931 Bacteria 1181
91 Ga0075435_100042895 3300007076 Bacteria 3620
92 Ga0075435_100053303 3300007076 Bacteria 3262
93 Ga0075435_100066106 3300007076 Bacteria 2941
94 Ga0075435_100211278 3300007076 Bacteria 1646
95 Ga0075435_100433509 3300007076 Bacteria 1132
96 Ga0105240_10089831 3300009093 Bacteria 3756
97 Ga0111539_10022581 3300009094 Bacteria 7729
98 Ga0111539_10045973 3300009094 Bacteria 5224
99 Ga0111539_10105237 3300009094 Bacteria 3310
100 Ga0111539_10258218 3300009094 Bacteria 2029
101 Ga0111539_10567630 3300009094 Bacteria 1321
102 Ga0105245_10361074 3300009098 Bacteria 1442
103 Ga0105247_10083410 3300009101 Bacteria 2018
104 Ga0114129_10132396 3300009147 Bacteria 3423
105 Ga0114129_10175317 3300009147 Bacteria 2920
106 Ga0114129_10204100 3300009147 Bacteria 2675
107 Ga0114129_10487310 3300009147 Bacteria 1612
108 Ga0114129_10688853 3300009147 Bacteria 1315
109 Ga0105238_10077836 3300009551 Bacteria 3307
110 Ga0105249_10137533 3300009553 Bacteria 2340
111 Ga0105246_10307708 3300011119 Bacteria 1282
112 Ga0157373_10108315 3300013100 Bacteria 1954
113 Ga0157374_10044677 3300013296 Bacteria 4095
114 Ga0157378_10006859 3300013297 Bacteria 9934
115 Ga0163162_10125863 3300013306 Bacteria 2669
116 Ga0163162_10257396 3300013306 Bacteria 1877
117 Ga0157372_10311441 3300013307 Bacteria 1832
118 Ga0157375_10264803 3300013308 Bacteria 1880
119 Ga0157375_11011813 3300013308 Bacteria 970
120 Ga0163163_10264411 3300014325 Bacteria 1771
121 Ga0157380_10274548 3300014326 Bacteria 1539
122 Ga0157379_10386864 3300014968 Bacteria 1284
123 Ga0157376_10056979 3300014969 Bacteria 3267
124 Ga0197907_11041323 3300020069 Bacteria 3287
125 Ga0206350_10495240 3300020080 Bacteria 4467
126 Ga0224712_10002677 3300022467 Bacteria 4459
127 Ga0228598_1010484 3300024227 Bacteria 1846
128 Ga0207697_10010780 3300025315 Bacteria 3892
129 Ga0207682_10040045 3300025893 Bacteria 1908
130 Ga0207688_10048182 3300025901 Bacteria 2381
131 Ga0207680_10005448 3300025903 Bacteria 6080
132 Ga0207645_10003056 3300025907 Bacteria 12856
133 Ga0207645_10058765 3300025907 Bacteria 2455
134 Ga0207684_10114460 3300025910 Unclassified 2310
135 Ga0207707_10039970 3300025912 Bacteria 4098
136 Ga0207695_10008474 3300025913 Bacteria 12866
137 Ga0207657_10021576 3300025919 Bacteria 6057
138 Ga0207652_10083252 3300025921 Bacteria 2801
139 Ga0207652_10171102 3300025921 Bacteria 1949
140 Ga0207681_10039403 3300025923 Bacteria 3137
141 Ga0207681_10274889 3300025923 Bacteria 1324
142 Ga0207650_10171419 3300025925 Bacteria 1725
143 Ga0207659_10249220 3300025926 Bacteria 1440
144 Ga0207687_10286094 3300025927 Bacteria 1323
145 Ga0207644_10250771 3300025931 Bacteria 1412
146 Ga0207706_10067710 3300025933 Bacteria 3142
147 Ga0207706_10104616 3300025933 Bacteria 2491
148 Ga0207706_10465701 3300025933 Bacteria 1092
149 Ga0207686_10040311 3300025934 Bacteria 2839
150 Ga0207704_10055083 3300025938 Bacteria 2428
151 Ga0207665_10020044 3300025939 Bacteria 4392
152 Ga0207691_10003068 3300025940 Bacteria 16297
153 Ga0207691_10214261 3300025940 Bacteria 1672
154 Ga0207679_10059161 3300025945 Bacteria 2842
155 Ga0207667_10105764 3300025949 Bacteria 2903
156 Ga0207667_10144847 3300025949 Bacteria 2446
157 Ga0207712_10050934 3300025961 Bacteria 2893
158 Ga0207658_10708449 3300025986 Bacteria 910
159 Ga0207708_10218928 3300026075 Bacteria 1525
160 Ga0207708_10387881 3300026075 Bacteria 1153
161 Ga0207641_10040736 3300026088 Bacteria 3891
162 Ga0207648_10082068 3300026089 Bacteria 2811
163 Ga0207676_10229659 3300026095 Bacteria 1658
164 Ga0207683_10004286 3300026121 Bacteria 12322
165 Ga0209983_1037136 3300027665 Bacteria 1048
166 Ga0209974_10051255 3300027876 Bacteria 1388
167 Ga0207428_10019268 3300027907 Bacteria 5818
168 Ga0268265_10456489 3300028380 Bacteria 1195
169 Ga0265760_10025367 3300031090 Bacteria 1730
170 Ga0307408_100063218 3300031548 Bacteria 2707
171 Ga0307405_10343075 3300031731 Bacteria 1149
172 Ga0307413_10205009 3300031824 Bacteria 1427
173 Ga0307410_10204678 3300031852 Unclassified 1509
174 Ga0307406_10151180 3300031901 Unclassified 1656
175 Ga0307407_10020886 3300031903 Unclassified 3365
176 Ga0307412_10302177 3300031911 Bacteria 1265
177 Ga0307416_100004580 3300032002 Bacteria 8356
178 Ga0307411_10026096 3300032005 Bacteria 3512
179 Ga0373929_0041781 3300035085 Bacteria 1021
180 Ga0373934_0138927 3300035086 Bacteria 993
181 Ga0373956_0006739 3300035119 Bacteria 4606
182 Ga0373943_0053477 3300035170 Bacteria 1994
183 Ga0373946_0093082 3300035171 Bacteria 1339
184 Ga0373946_0172277 3300035171 Bacteria 1022
185 Ga0373924_0066832 3300035410 Bacteria 1512
186 Ga0373924_0080581 3300035410 Bacteria 1384
187 Ga0373931_0032307 3300035691 Bacteria 2708
188 Ga0373927_0041064 3300035695 Bacteria 3000
189 Ga0373927_0063780 3300035695 Bacteria 2383
190 Ga0373927_0085183 3300035695 Bacteria 2051
191 Ga0373933_0071976 3300035724 Bacteria 2105
192 Ga0373933_0159497 3300035724 Bacteria 1431
193 Ga0373947_0045079 3300035725 Bacteria 2638
194 Ga0373937_0007776 3300036401 Bacteria 9296
195 Ga0373937_0297713 3300036401 Bacteria 1525
196 Ga0436360_1069735 3300039438 Bacteria 4300
197 Ga0436361_0636492 3300039447 Bacteria 1973
198 Ga0436362_1095356 3300039453 Bacteria 4018
199 Ga0451577_0064124 3300042876 Bacteria 3277
200 Ga0451577_0094789 3300042876 Bacteria 2665
201 Ga0451577_0294910 3300042876 Bacteria 1469
202 Ga0453683_0000960 3300044673 Bacteria 27389
203 Ga0451576_0001079 3300045051 Bacteria 49994
204 Ga0451576_0206373 3300045051 Bacteria 2052
205 Ga0451576_0300863 3300045051 Bacteria 1678
206 Ga0451576_0666103 3300045051 Bacteria 1093
207 Ga0495580_0000680 3300046472 Bacteria 28988
208 Ga0495580_0157427 3300046472 Bacteria 1573
209 Ga0495580_0190673 3300046472 Bacteria 1414
210 Ga0495580_0252670 3300046472 Bacteria 1207
211 Ga0495604_0053985 3300047317 Bacteria 3103
212 Ga0495602_0013178 3300048088 Bacteria 8458
213 Ga0496102_0152780 3300048905 Bacteria 2170
214 Ga0496104_0202489 3300048907 Bacteria 1897
215 Ga0496111_0135647 3300048914 Bacteria 1823
216 Ga0496112_0124272 3300048915 Bacteria 2551
217 Ga0496112_0555883 3300048915 Bacteria 1081
218 Ga0501036_0012415 3300049572 Bacteria 7057
219 Ga0501038_0002311 3300049574 Bacteria 17726
220 Ga0501039_0011290 3300049575 Bacteria 6803
221 Ga0501040_0005777 3300049576 Bacteria 8009
222 Ga0501040_0176695 3300049576 Bacteria 1512
223 Ga0501041_0001148 3300049577 Bacteria 14487
224 Ga0501041_0024237 3300049577 Bacteria 3641
225 Ga0501043_0043225 3300049579 Bacteria 3542
226 Ga0501046_0006127 3300049580 Bacteria 10683
227 Ga0501046_0082156 3300049580 Bacteria 2488
228 Ga0501048_0002314 3300049582 Bacteria 14531
229 Ga0501068_0149858 3300049584 Bacteria 1466
230 Ga0501070_0006052 3300049586 Bacteria 10304
231 Ga0501071_0032618 3300049587 Bacteria 3699
232 Ga0501071_0376892 3300049587 Bacteria 1082
233 Ga0501072_0002000 3300049588 Bacteria 15190
234 Ga0501072_0337522 3300049588 Bacteria 1197
235 Ga0501074_0059115 3300049590 Bacteria 2762
236 Ga0501075_0010221 3300049591 Bacteria 6591
237 Ga0501075_0056788 3300049591 Bacteria 2948
238 Ga0501076_0000646 3300049592 Bacteria 22287
239 Ga0501076_0349966 3300049592 Unclassified 1213
240 Ga0501077_0001209 3300049593 Bacteria 15616
241 Ga0501077_0123956 3300049593 Bacteria 1638
242 Ga0501209_017740 3300049656 Unclassified 1631
243 Ga0501079_0005338 3300049741 Bacteria 9563
244 Ga0501080_0063423 3300049742 Bacteria 3439
245 Ga0501080_0195336 3300049742 Bacteria 1859
246 Ga0501080_0242828 3300049742 Bacteria 1643
247 Ga0501081_0001433 3300049743 Bacteria 14589
248 Ga0501081_0165184 3300049743 Bacteria 1596
249 Ga0501083_0071166 3300049744 Bacteria 2313
250 Ga0501035_0016300 3300049822 Bacteria 6855
251 Ga0501035_0019811 3300049822 Bacteria 6181
252 Ga0501045_0003202 3300049824 Bacteria 11188
253 Ga0501045_0177166 3300049824 Bacteria 1588
254 Ga0501045_0437104 3300049824 Bacteria 973
255 nmdc:mga05p37_23734_c1 3300050507 Bacteria 7447
256 nmdc:mga05p37_276063_c1 3300050507 Bacteria 2006
257 nmdc:mga05p37_3851_c1 3300050507 Bacteria 17550
258 nmdc:mga05p37_48915_c1 3300050507 Bacteria 5200
259 nmdc:mga05p37_53676_c1 3300050507 Bacteria 4957
260 nmdc:mga05p37_53985_c1 3300050507 Bacteria 4944
261 nmdc:mga05p37_649237_c1 3300050507 Bacteria 1182
262 nmdc:mga09592_225248_c1 3300050508 Bacteria 1625
263 nmdc:mga09592_92769_c1 3300050508 Bacteria 2581
264 nmdc:mga0qj67_103542_c1 3300050509 Unclassified 2296
265 nmdc:mga0qj67_169928_c1 3300050509 Bacteria 1770
266 nmdc:mga0qj67_622178_c1 3300050509 Unclassified 863
267 nmdc:mga06r32_229040_c1 3300050510 Bacteria 1846
268 nmdc:mga06r32_277681_c1 3300050510 Bacteria 1662
269 nmdc:mga08y16_179426_c1 3300050511 Bacteria 2199
270 nmdc:mga08y16_202396_c1 3300050511 Bacteria 2057
271 nmdc:mga08y16_31435_c1 3300050511 Bacteria 5583
272 nmdc:mga08y16_8109_c1 3300050511 Bacteria 10981
273 nmdc:mga08y16_854964_c1 3300050511 Bacteria 899
274 nmdc:mga0n895_136966_c1 3300050512 Bacteria 2475
275 nmdc:mga0n895_173630_c1 3300050512 Unclassified 2187
276 nmdc:mga0n895_211240_c1 3300050512 Bacteria 1971
277 nmdc:mga0n895_217383_c1 3300050512 Bacteria 1940
278 nmdc:mga0n895_54329_c1 3300050512 Bacteria 3940
279 nmdc:mga0n895_562739_c1 3300050512 Bacteria 1145
280 nmdc:mga0n895_7104_c1 3300050512 Bacteria 9573
281 nmdc:mga0rr50_133344_c1 3300050513 Bacteria 1991
282 nmdc:mga0rr50_164326_c1 3300050513 Bacteria 1804
283 nmdc:mga0rr50_187528_c1 3300050513 Unclassified 1693
284 nmdc:mga0rr50_39029_c1 3300050513 Bacteria 3441
285 nmdc:mga0rr50_41574_c1 3300050513 Bacteria 3351
286 nmdc:mga0rr50_47138_c1 3300050513 Bacteria 3177
287 nmdc:mga08x19_134028_c1 3300050514 Bacteria 1669
288 nmdc:mga08x19_186748_c1 3300050514 Unclassified 1417
289 nmdc:mga08x19_23880_c1 3300050514 Bacteria 3795
290 nmdc:mga08x19_305056_c1 3300050514 Bacteria 1106
291 nmdc:mga08x19_310942_c1 3300050514 Bacteria 1095
292 nmdc:mga08x19_46668_c1 3300050514 Bacteria 2771
293 nmdc:mga0a205_122555_c1 3300050515 Bacteria 2499
294 nmdc:mga0a205_14513_c1 3300050515 Bacteria 7351
295 nmdc:mga0a205_14707_c1 3300050515 Bacteria 7301
296 nmdc:mga0a205_23444_c1 3300050515 Bacteria 5855
297 nmdc:mga0a205_507815_c1 3300050515 Bacteria 1062
298 nmdc:mga0a205_522478_c1 3300050515 Bacteria 1043
299 Ga0501084_0000817 3300054114 Bacteria 23911
300 Ga0501082_0002694 3300060353 Bacteria 15522
301 Ga0530510_0012913 3300061734 Bacteria 5872
302 Ga0530510_0057662 3300061734 Bacteria 2807
303 Ga0530510_0072651 3300061734 Bacteria 2497
304 Ga0530510_0121002 3300061734 Bacteria 1922
305 Ga0530510_0200867 3300061734 Bacteria 1480
306 Ga0495680_0229498
307 JGI25406J46586_10013378
308 JGI25405J52794_10003484
309 Ga0058859_11558127
310 Ga0065714_10109978
311 Ga0065704_10021825
312 Ga0065712_10000347
313 Ga0065712_10005299
314 Ga0065715_10000293
315 Ga0065707_10085136
316 Ga0065707_10116939
317 Ga0070658_10227519
318 Ga0070676_10062525
319 Ga0070690_100227911
320 Ga0070690_100292973
321 Ga0070670_100098247
322 Ga0070670_100209701
323 Ga0070666_10012634
324 Ga0070666_10124866
325 Ga0070680_100042500
326 Ga0070689_100338638
327 Ga0070661_100033939
328 Ga0070668_100477015
329 Ga0070675_100064668
330 Ga0070674_100343239
331 Ga0070667_100077463
332 Ga0070667_100095980
333 Ga0070694_100034999
334 Ga0070708_100618587
335 Ga0070678_100116125
336 Ga0070662_100380082
337 Ga0070662_100504385
338 Ga0070681_10236938
339 Ga0070685_10105406
340 Ga0070706_100183721
341 Ga0070706_100602010
342 Ga0070698_100189115
343 Ga0070698_100245670
344 Ga0070699_100002599
345 Ga0070699_100032635
346 Ga0070697_100046658
347 Ga0070697_100107548
348 Ga0070697_100196805
349 Ga0070697_100392798
350 Ga0070672_100025097
351 Ga0070686_100104961
352 Ga0070695_100075440
353 Ga0070695_100331178
354 Ga0070695_100399576
355 Ga0070696_100313263
356 Ga0070665_100074380
357 Ga0068855_100121216
358 Ga0070664_100071629
359 Ga0068854_100150319
360 Ga0068856_100315932
361 Ga0068859_100613245
362 Ga0068863_100036346
363 Ga0068862_100496323
364 Ga0081455_10000629
365 Ga0081538_10006059
366 Ga0081539_10000317
367 Ga0070715_10020255
368 Ga0070716_100013324
369 Ga0097621_100648335
370 Ga0068871_100099888
371 Ga0075428_100004966
372 Ga0075428_100069743
373 Ga0075430_100081424
374 Ga0075430_100322087
375 Ga0075431_100042765
376 Ga0075431_100154042
377 Ga0075433_10000786
378 Ga0075433_10008784
379 Ga0075433_10033528
380 Ga0075433_10099677
381 Ga0075433_10211191
382 Ga0075434_100001619
383 Ga0075434_100013518
384 Ga0075434_100051748
385 Ga0075434_100073592
386 Ga0075434_100570057
387 Ga0075434_100629304
388 Ga0075434_100676192
389 Ga0075429_100372272
390 Ga0075436_100006006
391 Ga0075436_100018508
392 Ga0075436_100028702
393 Ga0075436_100044133
394 Ga0075436_100091315
395 Ga0097620_100613330
396 Ga0075435_100042895
397 Ga0075435_100053303
398 Ga0075435_100066106
399 Ga0075435_100211278
400 Ga0075435_100433509
401 Ga0105240_10089831
402 Ga0111539_10022581
403 Ga0111539_10045973
404 Ga0111539_10105237
405 Ga0111539_10258218
406 Ga0111539_10567630
407 Ga0105245_10361074
408 Ga0105247_10083410
409 Ga0114129_10132396
410 Ga0114129_10175317
411 Ga0114129_10204100
412 Ga0114129_10487310
413 Ga0114129_10688853
414 Ga0105238_10077836
415 Ga0105249_10137533
416 Ga0105246_10307708
417 Ga0157373_10108315
418 Ga0157374_10044677
419 Ga0157378_10006859
420 Ga0163162_10125863
421 Ga0163162_10257396
422 Ga0157372_10311441
423 Ga0157375_10264803
424 Ga0157375_11011813
425 Ga0163163_10264411
426 Ga0157380_10274548
427 Ga0157379_10386864
428 Ga0157376_10056979
429 Ga0197907_11041323
430 Ga0206350_10495240
431 Ga0224712_10002677
432 Ga0228598_1010484
433 Ga0207697_10010780
434 Ga0207682_10040045
435 Ga0207688_10048182
436 Ga0207680_10005448
437 Ga0207645_10003056
438 Ga0207645_10058765
439 Ga0207684_10114460
440 Ga0207707_10039970
441 Ga0207695_10008474
442 Ga0207657_10021576
443 Ga0207652_10083252
444 Ga0207652_10171102
445 Ga0207681_10039403
446 Ga0207681_10274889
447 Ga0207650_10171419
448 Ga0207659_10249220
449 Ga0207687_10286094
450 Ga0207644_10250771
451 Ga0207706_10067710
452 Ga0207706_10104616
453 Ga0207706_10465701
454 Ga0207686_10040311
455 Ga0207704_10055083
456 Ga0207665_10020044
457 Ga0207691_10003068
458 Ga0207691_10214261
459 Ga0207679_10059161
460 Ga0207667_10105764
461 Ga0207667_10144847
462 Ga0207712_10050934
463 Ga0207658_10708449
464 Ga0207708_10218928
465 Ga0207708_10387881
466 Ga0207641_10040736
467 Ga0207648_10082068
468 Ga0207676_10229659
469 Ga0207683_10004286
470 Ga0209983_1037136
471 Ga0209974_10051255
472 Ga0207428_10019268
473 Ga0268265_10456489
474 Ga0265760_10025367
475 Ga0307408_100063218
476 Ga0307405_10343075
477 Ga0307413_10205009
478 Ga0307410_10204678
479 Ga0307406_10151180
480 Ga0307407_10020886
481 Ga0307412_10302177
482 Ga0307416_100004580
483 Ga0307411_10026096
484 Ga0373929_0041781
485 Ga0373934_0138927
486 Ga0373956_0006739
487 Ga0373943_0053477
488 Ga0373946_0093082
489 Ga0373946_0172277
490 Ga0373924_0066832
491 Ga0373924_0080581
492 Ga0373931_0032307
493 Ga0373927_0041064
494 Ga0373927_0063780
495 Ga0373927_0085183
496 Ga0373933_0071976
497 Ga0373933_0159497
498 Ga0373947_0045079
499 Ga0373937_0007776
500 Ga0373937_0297713
501 Ga0436360_1069735
502 Ga0436361_0636492
503 Ga0436362_1095356
504 Ga0451577_0064124
505 Ga0451577_0094789
506 Ga0451577_0294910
507 Ga0453683_0000960
508 Ga0451576_0001079
509 Ga0451576_0206373
510 Ga0451576_0300863
511 Ga0451576_0666103
512 Ga0495580_0000680
513 Ga0495580_0157427
514 Ga0495580_0190673
515 Ga0495580_0252670
516 Ga0495604_0053985
517 Ga0495602_0013178
518 Ga0496102_0152780
519 Ga0496104_0202489
520 Ga0496111_0135647
521 Ga0496112_0124272
522 Ga0496112_0555883
523 Ga0501036_0012415
524 Ga0501038_0002311
525 Ga0501039_0011290
526 Ga0501040_0005777
527 Ga0501040_0176695
528 Ga0501041_0001148
529 Ga0501041_0024237
530 Ga0501043_0043225
531 Ga0501046_0006127
532 Ga0501046_0082156
533 Ga0501048_0002314
534 Ga0501068_0149858
535 Ga0501070_0006052
536 Ga0501071_0032618
537 Ga0501071_0376892
538 Ga0501072_0002000
539 Ga0501072_0337522
540 Ga0501074_0059115
541 Ga0501075_0010221
542 Ga0501075_0056788
543 Ga0501076_0000646
544 Ga0501076_0349966
545 Ga0501077_0001209
546 Ga0501077_0123956
547 Ga0501209_017740
548 Ga0501079_0005338
549 Ga0501080_0063423
550 Ga0501080_0195336
551 Ga0501080_0242828
552 Ga0501081_0001433
553 Ga0501081_0165184
554 Ga0501083_0071166
555 Ga0501035_0016300
556 Ga0501035_0019811
557 Ga0501045_0003202
558 Ga0501045_0177166
559 Ga0501045_0437104
560 nmdc:mga05p37_23734_c1
561 nmdc:mga05p37_276063_c1
562 nmdc:mga05p37_3851_c1
563 nmdc:mga05p37_48915_c1
564 nmdc:mga05p37_53676_c1
565 nmdc:mga05p37_53985_c1
566 nmdc:mga05p37_649237_c1
567 nmdc:mga09592_225248_c1
568 nmdc:mga09592_92769_c1
569 nmdc:mga0qj67_103542_c1
570 nmdc:mga0qj67_169928_c1
571 nmdc:mga0qj67_622178_c1
572 nmdc:mga06r32_229040_c1
573 nmdc:mga06r32_277681_c1
574 nmdc:mga08y16_179426_c1
575 nmdc:mga08y16_202396_c1
576 nmdc:mga08y16_31435_c1
577 nmdc:mga08y16_8109_c1
578 nmdc:mga08y16_854964_c1
579 nmdc:mga0n895_136966_c1
580 nmdc:mga0n895_173630_c1
581 nmdc:mga0n895_211240_c1
582 nmdc:mga0n895_217383_c1
583 nmdc:mga0n895_54329_c1
584 nmdc:mga0n895_562739_c1
585 nmdc:mga0n895_7104_c1
586 nmdc:mga0rr50_133344_c1
587 nmdc:mga0rr50_164326_c1
588 nmdc:mga0rr50_187528_c1
589 nmdc:mga0rr50_39029_c1
590 nmdc:mga0rr50_41574_c1
591 nmdc:mga0rr50_47138_c1
592 nmdc:mga08x19_134028_c1
593 nmdc:mga08x19_186748_c1
594 nmdc:mga08x19_23880_c1
595 nmdc:mga08x19_305056_c1
596 nmdc:mga08x19_310942_c1
597 nmdc:mga08x19_46668_c1
598 nmdc:mga0a205_122555_c1
599 nmdc:mga0a205_14513_c1
600 nmdc:mga0a205_14707_c1
601 nmdc:mga0a205_23444_c1
602 nmdc:mga0a205_507815_c1
603 nmdc:mga0a205_522478_c1
604 Ga0501084_0000817
605 Ga0501082_0002694
606 Ga0530510_0012913
607 Ga0530510_0057662
608 Ga0530510_0072651
609 Ga0530510_0121002
610 Ga0530510_0200867

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

157

281

0.91

PF01678

DAP_epimerase

Diaminopimelate epimerase

6

129

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.9251 1 275
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9243 2 276
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.9129 1 275
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9084 2 276
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.8981 3 278
ID Description Score Start End Superfamily
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9949 140 261 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9877 152 264 3.10.310.10
2otnA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9735 1 121 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9542 152 264 3.10.310.10
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9363 5 123 3.10.310.10
ID Description Score Start End GO Terms
AF-T5LJY7-F1-model_v4 deleted 0.9893 5 127
AF-A0A3B8K5Z0-F1-model_v4 deleted 0.9887 1 123
AF-A0A497M8Y6-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9887 121 237 GO:0005829
GO:0008837
GO:0009089
AF-A0A382HQ33-F1-model_v4 Diaminopimelate epimerase 0.9877 154 277 GO:0005829
GO:0008837
GO:0009089
AF-A0A5J4P5Y0-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9872 3 121 GO:0005829
GO:0008837
GO:0009089

Map