F398148

General Info

Members Datasets Scaffolds Average Seq Length
305 154 610 349

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10116356|Ga0207687_101163562
Length 381
Sequence MQLPGITGAACHDPAGHPYRECFNRHTMRIAGAGSAFPKHYYPQAVLLAALREYWKGQIENPRMLDQLHAHAGVDGRHLVLPIERYYGLKNFGEFNQVWIEAAQELGEHAIRCAMSRAGLELSQIGALFFVSVTGVASPSIDARLINRMKLPTNLRRTPIFGLGCVAGAAGVARAADYVRAYPDQVAVLLSVELCSLTLQREDLSLANLVSSGLFGDGAAAVVVAGADVKRREESYDGPEILATGSVFYPDTEEVMGWDISEKGFRIVLSREVPEVVREHLGPDVDALLGDHGFRRSDVGSWVLHTGGPKVLEAAEESLALKNGEIQASWDCLRRVGNLSSASVLCVLEDVMLNRRPEPGTLGVMAALGPGFCSEVVLLRW

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
104 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 2.95
Rhizosphere 93.11
Stem 0
Stem Tuber 0
Unclassified 17.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10116356 3300025927 Bacteria 1993
2 Ga0070658_10006804 3300005327 Bacteria 9247
3 Ga0070676_10008947 3300005328 Bacteria 5416
4 Ga0070690_100086116 3300005330 Bacteria 2062
5 Ga0070670_100200849 3300005331 Bacteria 1732
6 Ga0070666_10002609 3300005335 Bacteria 10882
7 Ga0070666_10005131 3300005335 Bacteria 8018
8 Ga0070660_100020618 3300005339 Bacteria 4848
9 Ga0070671_100064832 3300005355 Bacteria 3043
10 Ga0070709_10012154 3300005434 Bacteria 4813
11 Ga0070709_10024870 3300005434 Bacteria 3531
12 Ga0070714_100001305 3300005435 Bacteria 18015
13 Ga0070714_100013590 3300005435 Bacteria 6526
14 Ga0070714_100031462 3300005435 Bacteria 4427
15 Ga0070714_100056598 3300005435 Unclassified 3355
16 Ga0070714_100311635 3300005435 Bacteria 1469
17 Ga0070713_100017919 3300005436 Bacteria 5373
18 Ga0070713_100074691 3300005436 Bacteria 2873
19 Ga0070713_100094985 3300005436 Bacteria 2571
20 Ga0070713_100113331 3300005436 Unclassified 2367
21 Ga0070710_10049445 3300005437 Bacteria 2352
22 Ga0070710_10100707 3300005437 Bacteria 1720
23 Ga0070710_10176056 3300005437 Bacteria 1336
24 Ga0070681_10007677 3300005458 Bacteria 10549
25 Ga0070681_10063748 3300005458 Bacteria 3657
26 Ga0070681_10123849 3300005458 Bacteria 2518
27 Ga0070707_100024452 3300005468 Bacteria 5722
28 Ga0070699_100081557 3300005518 Bacteria 2820
29 Ga0070699_100128605 3300005518 Bacteria 2232
30 Ga0070697_100134350 3300005536 Bacteria 2077
31 Ga0068853_100102395 3300005539 Bacteria 2534
32 Ga0068853_100180973 3300005539 Bacteria 1912
33 Ga0070672_100286125 3300005543 Bacteria 1395
34 Ga0070695_100280494 3300005545 Bacteria 1224
35 Ga0070665_100040105 3300005548 Bacteria 4707
36 Ga0070665_100062385 3300005548 Bacteria 3737
37 Ga0070665_100194951 3300005548 Unclassified 2026
38 Ga0068855_100013408 3300005563 Bacteria 9884
39 Ga0068855_100082447 3300005563 Bacteria 3727
40 Ga0068855_100265608 3300005563 Bacteria 1910
41 Ga0070664_100161992 3300005564 Unclassified 1980
42 Ga0068857_100008608 3300005577 Bacteria 8830
43 Ga0068857_100293141 3300005577 Unclassified 1498
44 Ga0068852_100058364 3300005616 Bacteria 3343
45 Ga0068864_100025884 3300005618 Bacteria 4944
46 Ga0068864_100357054 3300005618 Bacteria 1380
47 Ga0068863_100060405 3300005841 Bacteria 3585
48 Ga0068863_100185476 3300005841 Unclassified 1998
49 Ga0068860_100106805 3300005843 Bacteria 2674
50 Ga0068862_100001091 3300005844 Bacteria 25837
51 Ga0081540_1002157 3300005983 Bacteria 16345
52 Ga0070717_10011885 3300006028 Bacteria 6625
53 Ga0070717_10012188 3300006028 Bacteria 6555
54 Ga0070717_10026640 3300006028 Bacteria 4614
55 Ga0070717_10404776 3300006028 Bacteria 1226
56 Ga0070715_10047899 3300006163 Unclassified 1824
57 Ga0070716_100053521 3300006173 Bacteria 2302
58 Ga0070712_100000551 3300006175 Bacteria 21697
59 Ga0070712_100072840 3300006175 Unclassified 2462
60 Ga0097621_100103758 3300006237 Bacteria 2395
61 Ga0097621_100146232 3300006237 Bacteria 2024
62 Ga0068871_100023550 3300006358 Bacteria 4765
63 Ga0068871_100051544 3300006358 Bacteria 3332
64 Ga0068871_100088220 3300006358 Bacteria 2580
65 Ga0068871_100181163 3300006358 Unclassified 1810
66 Ga0075436_100001630 3300006914 Bacteria 15346
67 Ga0099795_10021090 3300007788 Bacteria 2132
68 Ga0105240_10001610 3300009093 Bacteria 38284
69 Ga0105240_10001660 3300009093 Bacteria 37767
70 Ga0105240_10003389 3300009093 Bacteria 24780
71 Ga0105240_10030961 3300009093 Bacteria 6947
72 Ga0105240_10127820 3300009093 Unclassified 3052
73 Ga0105240_10139732 3300009093 Bacteria 2897
74 Ga0105245_10025970 3300009098 Bacteria 5153
75 Ga0105245_10137260 3300009098 Unclassified 2299
76 Ga0105241_10024876 3300009174 Bacteria 4449
77 Ga0105241_10144812 3300009174 Bacteria 1938
78 Ga0105241_10247772 3300009174 Bacteria 1509
79 Ga0105242_10006403 3300009176 Bacteria 9067
80 Ga0105242_10257867 3300009176 Unclassified 1574
81 Ga0105248_10000027 3300009177 Bacteria 255822
82 Ga0105248_10020666 3300009177 Bacteria 7296
83 Ga0105248_10024659 3300009177 Bacteria 6688
84 Ga0105248_10312608 3300009177 Bacteria 1769
85 Ga0105237_10001240 3300009545 Bacteria 34022
86 Ga0105237_10013860 3300009545 Bacteria 8436
87 Ga0105237_10179560 3300009545 Unclassified 2117
88 Ga0105238_10094722 3300009551 Bacteria 2974
89 Ga0105238_10224788 3300009551 Bacteria 1854
90 Ga0105239_10041877 3300010375 Bacteria 5019
91 Ga0105239_10223238 3300010375 Bacteria 2113
92 Ga0105239_10426190 3300010375 Bacteria 1503
93 Ga0105246_10049108 3300011119 Bacteria 2888
94 Ga0157370_10013344 3300013104 Bacteria 8463
95 Ga0157370_10072369 3300013104 Bacteria 3253
96 Ga0157370_10186235 3300013104 Bacteria 1927
97 Ga0157369_10052034 3300013105 Bacteria 4431
98 Ga0157369_10139741 3300013105 Unclassified 2563
99 Ga0157369_10179036 3300013105 Bacteria 2231
100 Ga0157369_10225506 3300013105 Bacteria 1960
101 Ga0157374_10018158 3300013296 Bacteria 6204
102 Ga0157378_10040726 3300013297 Bacteria 4121
103 Ga0157378_10054678 3300013297 Bacteria 3554
104 Ga0163162_10000134 3300013306 Bacteria 67221
105 Ga0163162_10003149 3300013306 Bacteria 15759
106 Ga0163162_10237408 3300013306 Bacteria 1953
107 Ga0157372_10136976 3300013307 Unclassified 2820
108 Ga0157372_10577861 3300013307 Unclassified 1310
109 Ga0157375_10005192 3300013308 Bacteria 11300
110 Ga0163163_10008566 3300014325 Bacteria 9092
111 Ga0163163_10014187 3300014325 Bacteria 7318
112 Ga0163163_10029485 3300014325 Bacteria 5278
113 Ga0163163_10052270 3300014325 Bacteria 4031
114 Ga0163163_10062491 3300014325 Unclassified 3690
115 Ga0163163_10066242 3300014325 Bacteria 3587
116 Ga0163163_10180357 3300014325 Bacteria 2159
117 Ga0157380_10343642 3300014326 Bacteria 1393
118 Ga0157379_10042551 3300014968 Bacteria 4056
119 Ga0157379_10066850 3300014968 Bacteria 3214
120 Ga0157379_10090856 3300014968 Bacteria 2739
121 Ga0157379_10221616 3300014968 Bacteria 1714
122 Ga0157376_10008510 3300014969 Bacteria 7409
123 Ga0157376_10128662 3300014969 Unclassified 2256
124 Ga0157376_10237591 3300014969 Bacteria 1696
125 Ga0157376_10437478 3300014969 Unclassified 1273
126 Ga0213872_10002545 3300021361 Bacteria 10627
127 Ga0213872_10006655 3300021361 Bacteria 5762
128 Ga0213872_10007476 3300021361 Bacteria 5373
129 Ga0213876_10112936 3300021384 Bacteria 1442
130 Ga0213871_10012764 3300021441 Unclassified 1960
131 Ga0207680_10021226 3300025903 Bacteria 3511
132 Ga0207680_10026946 3300025903 Bacteria 3192
133 Ga0207647_10006750 3300025904 Bacteria 8330
134 Ga0207699_10021561 3300025906 Bacteria 3475
135 Ga0207699_10091903 3300025906 Unclassified 1907
136 Ga0207645_10019356 3300025907 Bacteria 4464
137 Ga0207654_10017383 3300025911 Unclassified 3758
138 Ga0207654_10052742 3300025911 Bacteria 2345
139 Ga0207654_10174207 3300025911 Unclassified 1399
140 Ga0207707_10012608 3300025912 Bacteria 7346
141 Ga0207707_10015111 3300025912 Bacteria 6721
142 Ga0207707_10054291 3300025912 Bacteria 3488
143 Ga0207695_10000735 3300025913 Bacteria 63549
144 Ga0207695_10004830 3300025913 Bacteria 18196
145 Ga0207695_10006075 3300025913 Bacteria 15761
146 Ga0207695_10057962 3300025913 Bacteria 4022
147 Ga0207695_10078515 3300025913 Bacteria 3349
148 Ga0207695_10309106 3300025913 Unclassified 1471
149 Ga0207693_10001476 3300025915 Bacteria 20785
150 Ga0207693_10013158 3300025915 Bacteria 6675
151 Ga0207693_10016781 3300025915 Bacteria 5845
152 Ga0207693_10060467 3300025915 Bacteria 2968
153 Ga0207663_10068065 3300025916 Bacteria 2286
154 Ga0207657_10000881 3300025919 Bacteria 31750
155 Ga0207646_10030189 3300025922 Bacteria 4917
156 Ga0207694_10034832 3300025924 Bacteria 3861
157 Ga0207694_10100049 3300025924 Bacteria 2297
158 Ga0207650_10088333 3300025925 Bacteria 2364
159 Ga0207687_10015016 3300025927 Bacteria 5072
160 Ga0207700_10001943 3300025928 Bacteria 11761
161 Ga0207700_10003976 3300025928 Bacteria 8652
162 Ga0207700_10098337 3300025928 Bacteria 2328
163 Ga0207700_10463589 3300025928 Bacteria 1118
164 Ga0207664_10003712 3300025929 Bacteria 10241
165 Ga0207664_10041479 3300025929 Bacteria 3585
166 Ga0207664_10054890 3300025929 Unclassified 3159
167 Ga0207664_10174655 3300025929 Bacteria 1841
168 Ga0207664_10195867 3300025929 Bacteria 1742
169 Ga0207664_10256335 3300025929 Bacteria 1528
170 Ga0207644_10042602 3300025931 Bacteria 3218
171 Ga0207704_10036552 3300025938 Unclassified 2827
172 Ga0207665_10003425 3300025939 Bacteria 10611
173 Ga0207665_10160782 3300025939 Unclassified 1615
174 Ga0207665_10169103 3300025939 Bacteria 1577
175 Ga0207691_10226463 3300025940 Bacteria 1620
176 Ga0207711_10000136 3300025941 Bacteria 77691
177 Ga0207711_10039454 3300025941 Bacteria 4017
178 Ga0207661_10091200 3300025944 Bacteria 2539
179 Ga0207679_10050665 3300025945 Bacteria 3035
180 Ga0207667_10006845 3300025949 Bacteria 13774
181 Ga0207667_10051799 3300025949 Unclassified 4326
182 Ga0207667_10136617 3300025949 Bacteria 2524
183 Ga0207677_10052198 3300026023 Bacteria 2776
184 Ga0207677_10130838 3300026023 Unclassified 1905
185 Ga0207703_10092198 3300026035 Bacteria 2549
186 Ga0207641_10026374 3300026088 Bacteria 4795
187 Ga0207676_10016781 3300026095 Bacteria 5301
188 Ga0207674_10014965 3300026116 Bacteria 8546
189 Ga0207698_10047863 3300026142 Bacteria 3243
190 Ga0268266_10043313 3300028379 Bacteria 3847
191 Ga0268266_10115068 3300028379 Bacteria 2387
192 Ga0268265_10000119 3300028380 Bacteria 99097
193 Ga0268265_10383855 3300028380 Bacteria 1293
194 Ga0268264_10059347 3300028381 Bacteria 3205
195 Ga0265338_10000787 3300028800 Bacteria 53693
196 Ga0265338_10019619 3300028800 Bacteria 7159
197 Ga0265338_10039334 3300028800 Bacteria 4463
198 Ga0265338_10088588 3300028800 Unclassified 2567
199 Ga0265338_10140793 3300028800 Unclassified 1890
200 Ga0265338_10220750 3300028800 Bacteria 1416
201 Ga0265770_1003562 3300030878 Bacteria 2116
202 Ga0265760_10025262 3300031090 Unclassified 1734
203 Ga0265325_10002329 3300031241 Bacteria 12877
204 Ga0265325_10005548 3300031241 Bacteria 7785
205 Ga0265325_10006085 3300031241 Bacteria 7381
206 Ga0265325_10015793 3300031241 Bacteria 4236
207 Ga0265340_10001194 3300031247 Bacteria 14838
208 Ga0265340_10079230 3300031247 Bacteria 1548
209 Ga0265331_10013769 3300031250 Bacteria 4336
210 Ga0265316_10067219 3300031344 Bacteria 2772
211 Ga0265313_10005889 3300031595 Bacteria 8884
212 Ga0265313_10024911 3300031595 Bacteria 3184
213 Ga0265313_10059136 3300031595 Bacteria 1804
214 Ga0265314_10000723 3300031711 Bacteria 39953
215 Ga0265314_10161954 3300031711 Bacteria 1360
216 Ga0265342_10072140 3300031712 Unclassified 2011
217 Ga0316215_1002708 3300033544 Bacteria 1679
218 Ga0316212_1006492 3300033547 Unclassified 1694
219 Ga0373944_0031750 3300035089 Unclassified 1592
220 Ga0373923_0061922 3300035111 Bacteria 1591
221 Ga0373954_0009889 3300035118 Bacteria 4200
222 Ga0373954_0101249 3300035118 Unclassified 1390
223 Ga0373956_0008409 3300035119 Bacteria 4178
224 Ga0373946_0018053 3300035171 Bacteria 2704
225 Ga0373935_0020605 3300035692 Bacteria 4030
226 Ga0373935_0049912 3300035692 Bacteria 2654
227 Ga0373935_0062247 3300035692 Bacteria 2390
228 Ga0373935_0096258 3300035692 Unclassified 1945
229 Ga0373927_0008127 3300035695 Bacteria 7079
230 Ga0373927_0023234 3300035695 Bacteria 4062
231 Ga0373927_0044252 3300035695 Bacteria 2881
232 Ga0373933_0000409 3300035724 Bacteria 26953
233 Ga0373933_0083989 3300035724 Bacteria 1956
234 Ga0373947_0000209 3300035725 Bacteria 32873
235 Ga0373947_0012893 3300035725 Bacteria 4792
236 Ga0373947_0022046 3300035725 Bacteria 3691
237 Ga0373937_0000113 3300036401 Bacteria 77152
238 Ga0373937_0061371 3300036401 Bacteria 3456
239 Ga0373937_0062251 3300036401 Bacteria 3430
240 Ga0373937_0336437 3300036401 Bacteria 1429
241 Ga0373925_0000325 3300037068 Bacteria 49853
242 Ga0373925_0022903 3300037068 Bacteria 4558
243 Ga0373925_0096071 3300037068 Bacteria 2271
244 Ga0373925_0146470 3300037068 Bacteria 1851
245 Ga0373925_0148731 3300037068 Bacteria 1837
246 Ga0373925_0225422 3300037068 Unclassified 1497
247 Ga0436365_1399323 3300039437 Bacteria 1649
248 Ga0436365_1792366 3300039437 Bacteria 1476
249 Ga0436365_1930505 3300039437 Bacteria 1220
250 Ga0436360_0282036 3300039438 Unclassified 3414
251 Ga0436360_0418708 3300039438 Bacteria 4393
252 Ga0436360_0696964 3300039438 Bacteria 2235
253 Ga0436361_0171994 3300039447 Unclassified 982
254 Ga0436361_0289151 3300039447 Bacteria 1826
255 Ga0436361_0319150 3300039447 Bacteria 5730
256 Ga0436361_0777493 3300039447 Bacteria 6358
257 Ga0436361_1178670 3300039447 Bacteria 13135
258 Ga0436363_0091158 3300039450 Bacteria 1354
259 Ga0436363_1551903 3300039450 Bacteria 13470
260 Ga0436362_1303269 3300039453 Bacteria 3408
261 Ga0466966_0047297 3300044684 Bacteria 2744
262 Ga0453684_0120012 3300044712 Bacteria 3177
263 Ga0466958_0227359 3300045836 Bacteria 1191
264 Ga0466967_0074226 3300045976 Bacteria 3054
265 Ga0495580_0000671 3300046472 Bacteria 29190
266 Ga0495580_0001300 3300046472 Bacteria 22053
267 Ga0495580_0007635 3300046472 Bacteria 8675
268 Ga0495580_0031418 3300046472 Bacteria 3837
269 Ga0495580_0143555 3300046472 Bacteria 1655
270 Ga0495580_0185523 3300046472 Bacteria 1436
271 Ga0495580_0192000 3300046472 Unclassified 1408
272 Ga0495594_0067499 3300046499 Bacteria 1985
273 Ga0495665_0082156 3300046531 Bacteria 1694
274 Ga0495586_0061762 3300046535 Unclassified 2039
275 Ga0495587_0005977 3300046536 Bacteria 7935
276 Ga0495667_0112756 3300046559 Unclassified 1757
277 Ga0495625_0298659 3300046660 Unclassified 1031
278 Ga0495635_0082159 3300046663 Bacteria 2205
279 Ga0495635_0140686 3300046663 Bacteria 1644
280 Ga0495669_0018951 3300046684 Bacteria 2966
281 Ga0495669_0036029 3300046684 Bacteria 2186
282 Ga0495669_0050481 3300046684 Unclassified 1865
283 Ga0495604_0065912 3300047317 Unclassified 2756
284 Ga0495674_0050472 3300047319 Unclassified 3671
285 Ga0495674_0131481 3300047319 Bacteria 2108
286 Ga0495675_0010208 3300047444 Bacteria 5860
287 Ga0495684_0007338 3300047471 Bacteria 8543
288 Ga0495602_0009171 3300048088 Bacteria 10297
289 Ga0495602_0075304 3300048088 Bacteria 2865
290 Ga0496100_0045818 3300048903 Bacteria 2808
291 Ga0496101_0033687 3300048904 Bacteria 3614
292 Ga0496103_0028265 3300048906 Bacteria 3402
293 Ga0496104_0037341 3300048907 Unclassified 4543
294 Ga0496109_0221407 3300048912 Bacteria 1780
295 Ga0496110_0111599 3300048913 Unclassified 2458
296 Ga0496112_0080755 3300048915 Unclassified 3216
297 Ga0496114_0043547 3300048917 Bacteria 3722
298 Ga0496115_0064415 3300048918 Unclassified 2959
299 Ga0496119_0097423 3300048922 Unclassified 1658
300 Ga0496126_0006917 3300048929 Bacteria 12564
301 Ga0501067_0172274 3300049583 Unclassified 1206
302 Ga0501044_0005180 3300049823 Bacteria 14514
303 nmdc:mga08x19_74861_c1 3300050514 Bacteria 2213
304 Ga0500644_0098313 3300053088 Bacteria 1108
305 Ga0500595_020591 3300053119 Bacteria 2370
306 Ga0207687_10116356
307 Ga0070658_10006804
308 Ga0070676_10008947
309 Ga0070690_100086116
310 Ga0070670_100200849
311 Ga0070666_10002609
312 Ga0070666_10005131
313 Ga0070660_100020618
314 Ga0070671_100064832
315 Ga0070709_10012154
316 Ga0070709_10024870
317 Ga0070714_100001305
318 Ga0070714_100013590
319 Ga0070714_100031462
320 Ga0070714_100056598
321 Ga0070714_100311635
322 Ga0070713_100017919
323 Ga0070713_100074691
324 Ga0070713_100094985
325 Ga0070713_100113331
326 Ga0070710_10049445
327 Ga0070710_10100707
328 Ga0070710_10176056
329 Ga0070681_10007677
330 Ga0070681_10063748
331 Ga0070681_10123849
332 Ga0070707_100024452
333 Ga0070699_100081557
334 Ga0070699_100128605
335 Ga0070697_100134350
336 Ga0068853_100102395
337 Ga0068853_100180973
338 Ga0070672_100286125
339 Ga0070695_100280494
340 Ga0070665_100040105
341 Ga0070665_100062385
342 Ga0070665_100194951
343 Ga0068855_100013408
344 Ga0068855_100082447
345 Ga0068855_100265608
346 Ga0070664_100161992
347 Ga0068857_100008608
348 Ga0068857_100293141
349 Ga0068852_100058364
350 Ga0068864_100025884
351 Ga0068864_100357054
352 Ga0068863_100060405
353 Ga0068863_100185476
354 Ga0068860_100106805
355 Ga0068862_100001091
356 Ga0081540_1002157
357 Ga0070717_10011885
358 Ga0070717_10012188
359 Ga0070717_10026640
360 Ga0070717_10404776
361 Ga0070715_10047899
362 Ga0070716_100053521
363 Ga0070712_100000551
364 Ga0070712_100072840
365 Ga0097621_100103758
366 Ga0097621_100146232
367 Ga0068871_100023550
368 Ga0068871_100051544
369 Ga0068871_100088220
370 Ga0068871_100181163
371 Ga0075436_100001630
372 Ga0099795_10021090
373 Ga0105240_10001610
374 Ga0105240_10001660
375 Ga0105240_10003389
376 Ga0105240_10030961
377 Ga0105240_10127820
378 Ga0105240_10139732
379 Ga0105245_10025970
380 Ga0105245_10137260
381 Ga0105241_10024876
382 Ga0105241_10144812
383 Ga0105241_10247772
384 Ga0105242_10006403
385 Ga0105242_10257867
386 Ga0105248_10000027
387 Ga0105248_10020666
388 Ga0105248_10024659
389 Ga0105248_10312608
390 Ga0105237_10001240
391 Ga0105237_10013860
392 Ga0105237_10179560
393 Ga0105238_10094722
394 Ga0105238_10224788
395 Ga0105239_10041877
396 Ga0105239_10223238
397 Ga0105239_10426190
398 Ga0105246_10049108
399 Ga0157370_10013344
400 Ga0157370_10072369
401 Ga0157370_10186235
402 Ga0157369_10052034
403 Ga0157369_10139741
404 Ga0157369_10179036
405 Ga0157369_10225506
406 Ga0157374_10018158
407 Ga0157378_10040726
408 Ga0157378_10054678
409 Ga0163162_10000134
410 Ga0163162_10003149
411 Ga0163162_10237408
412 Ga0157372_10136976
413 Ga0157372_10577861
414 Ga0157375_10005192
415 Ga0163163_10008566
416 Ga0163163_10014187
417 Ga0163163_10029485
418 Ga0163163_10052270
419 Ga0163163_10062491
420 Ga0163163_10066242
421 Ga0163163_10180357
422 Ga0157380_10343642
423 Ga0157379_10042551
424 Ga0157379_10066850
425 Ga0157379_10090856
426 Ga0157379_10221616
427 Ga0157376_10008510
428 Ga0157376_10128662
429 Ga0157376_10237591
430 Ga0157376_10437478
431 Ga0213872_10002545
432 Ga0213872_10006655
433 Ga0213872_10007476
434 Ga0213876_10112936
435 Ga0213871_10012764
436 Ga0207680_10021226
437 Ga0207680_10026946
438 Ga0207647_10006750
439 Ga0207699_10021561
440 Ga0207699_10091903
441 Ga0207645_10019356
442 Ga0207654_10017383
443 Ga0207654_10052742
444 Ga0207654_10174207
445 Ga0207707_10012608
446 Ga0207707_10015111
447 Ga0207707_10054291
448 Ga0207695_10000735
449 Ga0207695_10004830
450 Ga0207695_10006075
451 Ga0207695_10057962
452 Ga0207695_10078515
453 Ga0207695_10309106
454 Ga0207693_10001476
455 Ga0207693_10013158
456 Ga0207693_10016781
457 Ga0207693_10060467
458 Ga0207663_10068065
459 Ga0207657_10000881
460 Ga0207646_10030189
461 Ga0207694_10034832
462 Ga0207694_10100049
463 Ga0207650_10088333
464 Ga0207687_10015016
465 Ga0207700_10001943
466 Ga0207700_10003976
467 Ga0207700_10098337
468 Ga0207700_10463589
469 Ga0207664_10003712
470 Ga0207664_10041479
471 Ga0207664_10054890
472 Ga0207664_10174655
473 Ga0207664_10195867
474 Ga0207664_10256335
475 Ga0207644_10042602
476 Ga0207704_10036552
477 Ga0207665_10003425
478 Ga0207665_10160782
479 Ga0207665_10169103
480 Ga0207691_10226463
481 Ga0207711_10000136
482 Ga0207711_10039454
483 Ga0207661_10091200
484 Ga0207679_10050665
485 Ga0207667_10006845
486 Ga0207667_10051799
487 Ga0207667_10136617
488 Ga0207677_10052198
489 Ga0207677_10130838
490 Ga0207703_10092198
491 Ga0207641_10026374
492 Ga0207676_10016781
493 Ga0207674_10014965
494 Ga0207698_10047863
495 Ga0268266_10043313
496 Ga0268266_10115068
497 Ga0268265_10000119
498 Ga0268265_10383855
499 Ga0268264_10059347
500 Ga0265338_10000787
501 Ga0265338_10019619
502 Ga0265338_10039334
503 Ga0265338_10088588
504 Ga0265338_10140793
505 Ga0265338_10220750
506 Ga0265770_1003562
507 Ga0265760_10025262
508 Ga0265325_10002329
509 Ga0265325_10005548
510 Ga0265325_10006085
511 Ga0265325_10015793
512 Ga0265340_10001194
513 Ga0265340_10079230
514 Ga0265331_10013769
515 Ga0265316_10067219
516 Ga0265313_10005889
517 Ga0265313_10024911
518 Ga0265313_10059136
519 Ga0265314_10000723
520 Ga0265314_10161954
521 Ga0265342_10072140
522 Ga0316215_1002708
523 Ga0316212_1006492
524 Ga0373944_0031750
525 Ga0373923_0061922
526 Ga0373954_0009889
527 Ga0373954_0101249
528 Ga0373956_0008409
529 Ga0373946_0018053
530 Ga0373935_0020605
531 Ga0373935_0049912
532 Ga0373935_0062247
533 Ga0373935_0096258
534 Ga0373927_0008127
535 Ga0373927_0023234
536 Ga0373927_0044252
537 Ga0373933_0000409
538 Ga0373933_0083989
539 Ga0373947_0000209
540 Ga0373947_0012893
541 Ga0373947_0022046
542 Ga0373937_0000113
543 Ga0373937_0061371
544 Ga0373937_0062251
545 Ga0373937_0336437
546 Ga0373925_0000325
547 Ga0373925_0022903
548 Ga0373925_0096071
549 Ga0373925_0146470
550 Ga0373925_0148731
551 Ga0373925_0225422
552 Ga0436365_1399323
553 Ga0436365_1792366
554 Ga0436365_1930505
555 Ga0436360_0282036
556 Ga0436360_0418708
557 Ga0436360_0696964
558 Ga0436361_0171994
559 Ga0436361_0289151
560 Ga0436361_0319150
561 Ga0436361_0777493
562 Ga0436361_1178670
563 Ga0436363_0091158
564 Ga0436363_1551903
565 Ga0436362_1303269
566 Ga0466966_0047297
567 Ga0453684_0120012
568 Ga0466958_0227359
569 Ga0466967_0074226
570 Ga0495580_0000671
571 Ga0495580_0001300
572 Ga0495580_0007635
573 Ga0495580_0031418
574 Ga0495580_0143555
575 Ga0495580_0185523
576 Ga0495580_0192000
577 Ga0495594_0067499
578 Ga0495665_0082156
579 Ga0495586_0061762
580 Ga0495587_0005977
581 Ga0495667_0112756
582 Ga0495625_0298659
583 Ga0495635_0082159
584 Ga0495635_0140686
585 Ga0495669_0018951
586 Ga0495669_0036029
587 Ga0495669_0050481
588 Ga0495604_0065912
589 Ga0495674_0050472
590 Ga0495674_0131481
591 Ga0495675_0010208
592 Ga0495684_0007338
593 Ga0495602_0009171
594 Ga0495602_0075304
595 Ga0496100_0045818
596 Ga0496101_0033687
597 Ga0496103_0028265
598 Ga0496104_0037341
599 Ga0496109_0221407
600 Ga0496110_0111599
601 Ga0496112_0080755
602 Ga0496114_0043547
603 Ga0496115_0064415
604 Ga0496119_0097423
605 Ga0496126_0006917
606 Ga0501067_0172274
607 Ga0501044_0005180
608 nmdc:mga08x19_74861_c1
609 Ga0500644_0098313
610 Ga0500595_020591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

289

381

0.93

PF00195

Chal_sti_synt_N

Chalcone and stilbene synthases, N-terminal domain

82

229

0.92

PF02797

Chal_sti_synt_C

Chalcone and stilbene synthases, C-terminal domain

240

381

0.92

PF08392

FAE1_CUT1_RppA

FAE1/Type III polyketide synthase-like protein

62

289

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jd3-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9578 1 354
4jd3-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9525 1 354
4jap-assembly2.cif.gz_A crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9519 2 354
1u0m-assembly1.cif.gz_B crystal structure of 1,3,6,8-tetrahydroxynaphthalene synthase (thns) from streptomyces coelicolor a3(2): a bacterial type iii polyketide synthase (pks) provides insights into enzymatic control of reactive polyketide intermediates 0.9451 1 354
4jap-assembly2.cif.gz_A crystal structure of mycobacterium tuberculosis pks11 reveals intermediates in the synthesis of methyl-branched alkylpyrones 0.9413 2 354
ID Description Score Start End Superfamily
4jaoA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9609 212 354 3.40.47.10
af_P9WPF3_1_208_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9544 3 200 3.40.47.10
1u0mB02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9372 211 354 3.40.47.10
4jaoA02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9353 212 354 3.40.47.10
af_A0A0P0V4Z5_2_163_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9203 65 199 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A3N5FWU2-F1-model_v4 Type III polyketide synthase 0.9842 2 354 GO:0016747
GO:0030639
AF-A0A534VY27-F1-model_v4 Type III polyketide synthase 0.9794 2 354 GO:0016747
GO:0030639
AF-A0A3S7UYL1-F1-model_v4 Chalcone/stilbene synthase family protein 0.9792 2 354 GO:0016747
GO:0030639
AF-L7UHP5-F1-model_v4 Chalcone/stilbene synthase family protein 0.9787 2 354 GO:0016747
GO:0030639
AF-A0A6L4ART0-F1-model_v4 Type III polyketide synthase 0.9776 96 354 GO:0016747
GO:0030639

Map