F398095
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 201 | 294 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10002041|Ga0114129_1000204116 |
| Length | 320 |
| Sequence | MIFVHYKVNLIIHHCRLTIHELIKIHFLCNSMSLFIASLNSGSNGNCYYVGNDQEAVLVDAGISCRETERRMQRIGLSMEKVKAIFVSHEHTDHISGIPVLAKKYKLPVYITDATLHHGGLQLNKDQILSFKPYEAVQVGNLTVKAFPKFHDAAEPHSFVVSSNNINIGVFTDIGAPCDHVIMHFQKCHAAFLEANYDDHMLEQGSYPHHLKKRIRGGQGHLSNKQALEIFTNHRPSFMSHLFLSHLSRDNNSPALVQELFNAHAGETQIIIASRFEETPVYQIHPAKSEHAQTNLPQQTDIPVKRARKSVPVYIQGRLW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 3 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 4 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 5 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 6 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 7 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 8 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 9 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 10 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 11 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 15 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 16 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 125 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 126 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 129 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 141 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 144 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 145 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 151 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 177 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 178 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 184 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 185 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 186 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 187 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 188 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 189 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 190 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 192 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 195 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 196 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 197 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 198 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 199 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 200 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 201 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.39 |
| Metatranscriptomes | 0 |
| Isolates | 3.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.98 |
| Nodule | 0 |
| Rhizoplane | 0.33 |
| Rhizosphere | 70.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_830297 | 2162886007 | Bacteria | 3410 |
| 2 | JGI24740J21852_10005923 | 3300001979 | Bacteria | 5122 |
| 3 | JGI24739J22299_10005969 | 3300001989 | Bacteria | 4608 |
| 4 | JGI25154J39366_1000080 | 3300002738 | Bacteria | 89374 |
| 5 | JGI25157J39369_1008278 | 3300002741 | Bacteria | 1452 |
| 6 | JGI25164J39214_1002355 | 3300002772 | Bacteria | 2970 |
| 7 | JGI25406J46586_10001359 | 3300003203 | Bacteria | 11519 |
| 8 | JGI25165J46597_1001347 | 3300003214 | Bacteria | 13703 |
| 9 | JGI25153J46596_10010738 | 3300003215 | Bacteria | 4113 |
| 10 | JGI25153J46596_10073243 | 3300003215 | Bacteria | 878 |
| 11 | rootH2_10077389 | 3300003320 | Bacteria | 2048 |
| 12 | rootL2_10032084 | 3300003322 | Bacteria | 14316 |
| 13 | rootL2_10155532 | 3300003322 | Bacteria | 3142 |
| 14 | rootL2_10225494 | 3300003322 | Bacteria | 1405 |
| 15 | rootH1_10099612 | 3300003323 | Bacteria | 14680 |
| 16 | JGI25160J50197_1034595 | 3300003354 | Bacteria | 1252 |
| 17 | JGI25160J50197_1044919 | 3300003354 | Bacteria | 981 |
| 18 | Ga0055535_1006809 | 3300003761 | Unclassified | 2262 |
| 19 | Ga0055526_1004966 | 3300003771 | Bacteria | 7809 |
| 20 | Ga0055526_1013443 | 3300003771 | Bacteria | 3463 |
| 21 | Ga0055528_1000595 | 3300003790 | Bacteria | 27213 |
| 22 | Ga0055530_10002678 | 3300003791 | Bacteria | 11104 |
| 23 | Ga0065165_1000280 | 3300005262 | Bacteria | 87088 |
| 24 | Ga0065165_1027777 | 3300005262 | Bacteria | 1838 |
| 25 | Ga0065714_10002355 | 3300005288 | Bacteria | 26928 |
| 26 | Ga0065714_10003298 | 3300005288 | Bacteria | 17303 |
| 27 | Ga0065714_10007419 | 3300005288 | Bacteria | 4429 |
| 28 | Ga0065704_10070217 | 3300005289 | Bacteria | 69033 |
| 29 | Ga0065704_10078365 | 3300005289 | Bacteria | 4451 |
| 30 | Ga0070658_10203456 | 3300005327 | Bacteria | 1671 |
| 31 | Ga0070683_100006169 | 3300005329 | Bacteria | 10050 |
| 32 | Ga0070683_100093068 | 3300005329 | Bacteria | 2831 |
| 33 | Ga0070690_100090947 | 3300005330 | Bacteria | 2010 |
| 34 | Ga0070670_100093101 | 3300005331 | Bacteria | 2592 |
| 35 | Ga0068869_100174702 | 3300005334 | Bacteria | 1680 |
| 36 | Ga0070666_10282197 | 3300005335 | Bacteria | 1181 |
| 37 | Ga0068868_100061812 | 3300005338 | Bacteria | 2967 |
| 38 | Ga0070689_100628269 | 3300005340 | Unclassified | 932 |
| 39 | Ga0070661_100082729 | 3300005344 | Unclassified | 2371 |
| 40 | Ga0070661_100178759 | 3300005344 | Bacteria | 1614 |
| 41 | Ga0070671_100101711 | 3300005355 | Bacteria | 2411 |
| 42 | Ga0070671_100230607 | 3300005355 | Bacteria | 1571 |
| 43 | Ga0070673_100273345 | 3300005364 | Bacteria | 1480 |
| 44 | Ga0070659_100003758 | 3300005366 | Bacteria | 10828 |
| 45 | Ga0070700_100132970 | 3300005441 | Bacteria | 1681 |
| 46 | Ga0070663_100004419 | 3300005455 | Bacteria | 8268 |
| 47 | Ga0070681_10011469 | 3300005458 | Bacteria | 8773 |
| 48 | Ga0070681_10216129 | 3300005458 | Bacteria | 1833 |
| 49 | Ga0070698_100314849 | 3300005471 | Bacteria | 1496 |
| 50 | Ga0070679_100020757 | 3300005530 | Bacteria | 6407 |
| 51 | Ga0070684_100009465 | 3300005535 | Bacteria | 7674 |
| 52 | Ga0070684_100016346 | 3300005535 | Bacteria | 6062 |
| 53 | Ga0070665_100000845 | 3300005548 | Bacteria | 39974 |
| 54 | Ga0068855_100000302 | 3300005563 | Bacteria | 61501 |
| 55 | Ga0068855_100295689 | 3300005563 | Bacteria | 1794 |
| 56 | Ga0070664_100002232 | 3300005564 | Bacteria | 15589 |
| 57 | Ga0068857_100109824 | 3300005577 | Bacteria | 2478 |
| 58 | Ga0068856_100012073 | 3300005614 | Bacteria | 8368 |
| 59 | Ga0068856_100012396 | 3300005614 | Bacteria | 8256 |
| 60 | Ga0068856_100343349 | 3300005614 | Bacteria | 1511 |
| 61 | Ga0070702_100024761 | 3300005615 | Bacteria | 3206 |
| 62 | Ga0070702_100273072 | 3300005615 | Unclassified | 1157 |
| 63 | Ga0068852_100000248 | 3300005616 | Bacteria | 36699 |
| 64 | Ga0068852_100195694 | 3300005616 | Bacteria | 1910 |
| 65 | Ga0068859_100681427 | 3300005617 | Unclassified | 1119 |
| 66 | Ga0068861_100084708 | 3300005719 | Bacteria | 2489 |
| 67 | Ga0068861_100429148 | 3300005719 | Unclassified | 1179 |
| 68 | Ga0068851_10153646 | 3300005834 | Bacteria | 1260 |
| 69 | Ga0068858_100128227 | 3300005842 | Bacteria | 2378 |
| 70 | Ga0068860_100474379 | 3300005843 | Bacteria | 1246 |
| 71 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 72 | Ga0097620_100681523 | 3300006931 | Unclassified | 1119 |
| 73 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 74 | Ga0105240_10004108 | 3300009093 | Bacteria | 22346 |
| 75 | Ga0105240_10043975 | 3300009093 | Bacteria | 5679 |
| 76 | Ga0105240_10069569 | 3300009093 | Bacteria | 4356 |
| 77 | Ga0105240_10184933 | 3300009093 | Bacteria | 2455 |
| 78 | Ga0114129_10002041 | 3300009147 | Bacteria | 27695 |
| 79 | Ga0105241_10007402 | 3300009174 | Bacteria | 8077 |
| 80 | Ga0105241_10067515 | 3300009174 | Bacteria | 2768 |
| 81 | Ga0105241_10067770 | 3300009174 | Bacteria | 2763 |
| 82 | Ga0105237_10002429 | 3300009545 | Bacteria | 23143 |
| 83 | Ga0105237_10004724 | 3300009545 | Bacteria | 15670 |
| 84 | Ga0105237_10011481 | 3300009545 | Bacteria | 9372 |
| 85 | Ga0105237_10045574 | 3300009545 | Bacteria | 4412 |
| 86 | Ga0105237_10077429 | 3300009545 | Bacteria | 3315 |
| 87 | Ga0105237_10226546 | 3300009545 | Bacteria | 1870 |
| 88 | Ga0105238_10058338 | 3300009551 | Bacteria | 3869 |
| 89 | Ga0105239_10000679 | 3300010375 | Bacteria | 48522 |
| 90 | Ga0105239_10001032 | 3300010375 | Bacteria | 38819 |
| 91 | Ga0105239_10002322 | 3300010375 | Bacteria | 24279 |
| 92 | Ga0105239_10010888 | 3300010375 | Bacteria | 10161 |
| 93 | Ga0105239_10015056 | 3300010375 | Bacteria | 8574 |
| 94 | Ga0105239_10019590 | 3300010375 | Bacteria | 7468 |
| 95 | Ga0105239_10170620 | 3300010375 | Unclassified | 2433 |
| 96 | Ga0105239_10382623 | 3300010375 | Bacteria | 1591 |
| 97 | Ga0157373_10000440 | 3300013100 | Bacteria | 32951 |
| 98 | Ga0157373_10004120 | 3300013100 | Bacteria | 10962 |
| 99 | Ga0157373_10059117 | 3300013100 | Bacteria | 2716 |
| 100 | Ga0157371_10002650 | 3300013102 | Bacteria | 16949 |
| 101 | Ga0157371_10026681 | 3300013102 | Bacteria | 4195 |
| 102 | Ga0157371_10076220 | 3300013102 | Bacteria | 2375 |
| 103 | Ga0157371_10094764 | 3300013102 | Bacteria | 2115 |
| 104 | Ga0157371_10127870 | 3300013102 | Bacteria | 1807 |
| 105 | Ga0157370_10027681 | 3300013104 | Bacteria | 5588 |
| 106 | Ga0157370_10129146 | 3300013104 | Bacteria | 2358 |
| 107 | Ga0157374_10104682 | 3300013296 | Bacteria | 2717 |
| 108 | Ga0157374_10253944 | 3300013296 | Unclassified | 1730 |
| 109 | Ga0157374_10324975 | 3300013296 | Bacteria | 1525 |
| 110 | Ga0157378_10344666 | 3300013297 | Bacteria | 1454 |
| 111 | Ga0163162_10011996 | 3300013306 | Bacteria | 8452 |
| 112 | Ga0157372_10007963 | 3300013307 | Bacteria | 11267 |
| 113 | Ga0157372_10013931 | 3300013307 | Bacteria | 8592 |
| 114 | Ga0157372_10103702 | 3300013307 | Bacteria | 3250 |
| 115 | Ga0157372_10130046 | 3300013307 | Bacteria | 2896 |
| 116 | Ga0157372_10500618 | 3300013307 | Bacteria | 1417 |
| 117 | Ga0163163_10124766 | 3300014325 | Bacteria | 2612 |
| 118 | Ga0182008_10000034 | 3300014497 | Bacteria | 138235 |
| 119 | Ga0157377_10005854 | 3300014745 | Bacteria | 5815 |
| 120 | Ga0157377_10094326 | 3300014745 | Bacteria | 1773 |
| 121 | Ga0209436_103456 | 3300025208 | Unclassified | 4200 |
| 122 | Ga0207427_100159 | 3300025231 | Bacteria | 76256 |
| 123 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 124 | Ga0209437_100041 | 3300025233 | Bacteria | 444465 |
| 125 | Ga0209258_100036 | 3300025242 | Bacteria | 428859 |
| 126 | Ga0209646_1000091 | 3300025246 | Bacteria | 188727 |
| 127 | Ga0209026_1000466 | 3300025250 | Bacteria | 31172 |
| 128 | Ga0209026_1001412 | 3300025250 | Bacteria | 10688 |
| 129 | Ga0209148_1000139 | 3300025254 | Bacteria | 167011 |
| 130 | Ga0209233_1000264 | 3300025261 | Bacteria | 78251 |
| 131 | Ga0209673_1000014 | 3300025273 | Bacteria | 537082 |
| 132 | Ga0209673_1000018 | 3300025273 | Bacteria | 458281 |
| 133 | Ga0209130_1002864 | 3300025284 | Bacteria | 7976 |
| 134 | Ga0209675_1028974 | 3300025291 | Bacteria | 1340 |
| 135 | Ga0209564_1000465 | 3300025295 | Bacteria | 67957 |
| 136 | Ga0209564_1002499 | 3300025295 | Bacteria | 14320 |
| 137 | Ga0209758_1001032 | 3300025297 | Bacteria | 36527 |
| 138 | Ga0209758_1004063 | 3300025297 | Bacteria | 12608 |
| 139 | Ga0209758_1027411 | 3300025297 | Bacteria | 2434 |
| 140 | Ga0209050_1000177 | 3300025298 | Bacteria | 146637 |
| 141 | Ga0209050_1002162 | 3300025298 | Bacteria | 17825 |
| 142 | Ga0209050_1013311 | 3300025298 | Bacteria | 3665 |
| 143 | Ga0207426_1000234 | 3300025302 | Bacteria | 126926 |
| 144 | Ga0207426_1000251 | 3300025302 | Bacteria | 117462 |
| 145 | Ga0207426_1000435 | 3300025302 | Bacteria | 67658 |
| 146 | Ga0209051_1030337 | 3300025303 | Bacteria | 2100 |
| 147 | Ga0209257_1002645 | 3300025304 | Bacteria | 17239 |
| 148 | Ga0207656_10154736 | 3300025321 | Bacteria | 1088 |
| 149 | Ga0207688_10101439 | 3300025901 | Bacteria | 1662 |
| 150 | Ga0207647_10000045 | 3300025904 | Bacteria | 90413 |
| 151 | Ga0207647_10002941 | 3300025904 | Bacteria | 12819 |
| 152 | Ga0207645_10391925 | 3300025907 | Bacteria | 933 |
| 153 | Ga0207705_10282778 | 3300025909 | Bacteria | 1270 |
| 154 | Ga0207705_10391769 | 3300025909 | Bacteria | 1074 |
| 155 | Ga0207707_10199308 | 3300025912 | Unclassified | 1745 |
| 156 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 157 | Ga0207695_10097611 | 3300025913 | Unclassified | 2939 |
| 158 | Ga0207671_10000382 | 3300025914 | Bacteria | 62807 |
| 159 | Ga0207671_10000598 | 3300025914 | Bacteria | 48008 |
| 160 | Ga0207671_10004874 | 3300025914 | Bacteria | 12624 |
| 161 | Ga0207671_10017162 | 3300025914 | Bacteria | 5593 |
| 162 | Ga0207671_10024009 | 3300025914 | Bacteria | 4589 |
| 163 | Ga0207671_10084846 | 3300025914 | Bacteria | 2379 |
| 164 | Ga0207660_10075525 | 3300025917 | Unclassified | 2462 |
| 165 | Ga0207649_10160629 | 3300025920 | Unclassified | 1557 |
| 166 | Ga0207649_10304310 | 3300025920 | Bacteria | 1166 |
| 167 | Ga0207652_10162049 | 3300025921 | Unclassified | 2005 |
| 168 | Ga0207650_10192490 | 3300025925 | Bacteria | 1630 |
| 169 | Ga0207644_10150560 | 3300025931 | Bacteria | 1800 |
| 170 | Ga0207690_10001397 | 3300025932 | Bacteria | 15167 |
| 171 | Ga0207670_10448754 | 3300025936 | Bacteria | 1039 |
| 172 | Ga0207669_10202791 | 3300025937 | Bacteria | 1441 |
| 173 | Ga0207691_10133987 | 3300025940 | Bacteria | 2187 |
| 174 | Ga0207661_10004657 | 3300025944 | Bacteria | 9608 |
| 175 | Ga0207679_10010129 | 3300025945 | Bacteria | 6063 |
| 176 | Ga0207667_10005555 | 3300025949 | Bacteria | 15386 |
| 177 | Ga0207667_10024059 | 3300025949 | Bacteria | 6697 |
| 178 | Ga0207677_10049654 | 3300026023 | Bacteria | 2833 |
| 179 | Ga0207639_10047788 | 3300026041 | Bacteria | 3236 |
| 180 | Ga0207639_10220954 | 3300026041 | Bacteria | 1636 |
| 181 | Ga0207678_10094349 | 3300026067 | Bacteria | 2557 |
| 182 | Ga0207702_10030201 | 3300026078 | Bacteria | 4515 |
| 183 | Ga0207702_10261530 | 3300026078 | Bacteria | 1630 |
| 184 | Ga0207674_10057736 | 3300026116 | Bacteria | 3934 |
| 185 | Ga0207674_10062838 | 3300026116 | Bacteria | 3750 |
| 186 | Ga0207674_10108655 | 3300026116 | Bacteria | 2750 |
| 187 | Ga0207698_10010662 | 3300026142 | Bacteria | 5924 |
| 188 | Ga0207698_10155273 | 3300026142 | Bacteria | 1993 |
| 189 | Ga0207698_10372222 | 3300026142 | Unclassified | 1356 |
| 190 | Ga0207698_10565184 | 3300026142 | Bacteria | 1117 |
| 191 | Ga0268266_10004662 | 3300028379 | Bacteria | 13064 |
| 192 | Ga0268264_10463684 | 3300028381 | Bacteria | 1229 |
| 193 | Ga0307515_10000223 | 3300028794 | Bacteria | 140434 |
| 194 | Ga0316181_1067118 | 3300030744 | Bacteria | 1311 |
| 195 | Ga0316182_1285095 | 3300030745 | Bacteria | 1079 |
| 196 | Ga0265327_10051130 | 3300031251 | Bacteria | 2158 |
| 197 | Ga0307513_10097703 | 3300031456 | Bacteria | 2971 |
| 198 | Ga0307509_10203885 | 3300031507 | Bacteria | 1811 |
| 199 | Ga0307405_10014964 | 3300031731 | Unclassified | 4188 |
| 200 | Ga0307410_10109450 | 3300031852 | Bacteria | 1997 |
| 201 | Ga0307412_10000049 | 3300031911 | Bacteria | 151588 |
| 202 | Ga0307414_10000142 | 3300032004 | Bacteria | 48979 |
| 203 | Ga0307414_10007128 | 3300032004 | Bacteria | 6274 |
| 204 | Ga0307414_10010924 | 3300032004 | Bacteria | 5300 |
| 205 | Ga0307414_10400100 | 3300032004 | Bacteria | 1192 |
| 206 | Ga0307411_10460455 | 3300032005 | Bacteria | 1066 |
| 207 | Ga0307507_10000010 | 3300033179 | Bacteria | 265208 |
| 208 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 209 | Ga0395899_0157890 | 3300037312 | Unclassified | 1604 |
| 210 | Ga0395900_0374870 | 3300037418 | Bacteria | 1392 |
| 211 | Ga0395900_0582952 | 3300037418 | Unclassified | 1060 |
| 212 | Ga0395905_0000565 | 3300037471 | Bacteria | 50339 |
| 213 | Ga0395905_0319212 | 3300037471 | Bacteria | 1443 |
| 214 | Ga0395901_0579173 | 3300038443 | Bacteria | 1134 |
| 215 | Ga0439436_0017383 | 3300041404 | Bacteria | 2152 |
| 216 | Ga0439465_0012191 | 3300041413 | Bacteria | 2691 |
| 217 | Ga0451853_2388852 | 3300041512 | Bacteria | 2660 |
| 218 | Ga0451853_3622070 | 3300041512 | Bacteria | 3294 |
| 219 | Ga0439431_0001090 | 3300041997 | Bacteria | 5880 |
| 220 | Ga0439445_0006705 | 3300042004 | Bacteria | 2653 |
| 221 | Ga0439457_009194 | 3300042014 | Bacteria | 2305 |
| 222 | Ga0466969_0000050 | 3300044656 | Bacteria | 63194 |
| 223 | Ga0466969_0087958 | 3300044656 | Bacteria | 1475 |
| 224 | Ga0466965_0056730 | 3300044683 | Bacteria | 1951 |
| 225 | Ga0466966_0004558 | 3300044684 | Bacteria | 9130 |
| 226 | Ga0466966_0022052 | 3300044684 | Bacteria | 4181 |
| 227 | Ga0466961_0344799 | 3300044693 | Unclassified | 907 |
| 228 | Ga0466968_0035523 | 3300044735 | Bacteria | 2086 |
| 229 | Ga0466970_0000371 | 3300044765 | Bacteria | 21819 |
| 230 | Ga0466957_0000137 | 3300044842 | Bacteria | 31195 |
| 231 | Ga0466957_0016656 | 3300044842 | Bacteria | 4300 |
| 232 | Ga0466960_0111342 | 3300044901 | Bacteria | 1423 |
| 233 | Ga0466959_0000034 | 3300045049 | Bacteria | 108946 |
| 234 | Ga0466959_0066904 | 3300045049 | Bacteria | 2606 |
| 235 | Ga0466959_0154206 | 3300045049 | Bacteria | 1617 |
| 236 | Ga0466958_0111944 | 3300045836 | Bacteria | 1704 |
| 237 | Ga0495638_0000121 | 3300046460 | Bacteria | 126440 |
| 238 | Ga0495651_0272358 | 3300046462 | Bacteria | 1147 |
| 239 | Ga0495585_0001889 | 3300046492 | Bacteria | 15797 |
| 240 | Ga0495606_0102704 | 3300046507 | Bacteria | 1738 |
| 241 | Ga0495648_0001649 | 3300046524 | Bacteria | 21669 |
| 242 | Ga0495648_0029041 | 3300046524 | Bacteria | 3675 |
| 243 | Ga0495652_0423091 | 3300046529 | Bacteria | 938 |
| 244 | Ga0495609_0005985 | 3300046538 | Bacteria | 6284 |
| 245 | Ga0495622_0063222 | 3300046557 | Bacteria | 1713 |
| 246 | Ga0495633_0000081 | 3300046558 | Bacteria | 125903 |
| 247 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 248 | Ga0495668_0004316 | 3300046616 | Bacteria | 10164 |
| 249 | Ga0495625_0001508 | 3300046660 | Bacteria | 27981 |
| 250 | Ga0495625_0091117 | 3300046660 | Bacteria | 2107 |
| 251 | Ga0495672_0045175 | 3300047320 | Bacteria | 2638 |
| 252 | Ga0495687_070171 | 3300047443 | Bacteria | 1408 |
| 253 | Ga0495686_0000454 | 3300047472 | Bacteria | 61738 |
| 254 | Ga0495686_0000748 | 3300047472 | Bacteria | 43100 |
| 255 | Ga0495686_0032896 | 3300047472 | Bacteria | 3352 |
| 256 | Ga0496115_0294272 | 3300048918 | Bacteria | 1331 |
| 257 | Ga0496121_0000043 | 3300048924 | Bacteria | 341882 |
| 258 | Ga0495682_0017257 | 3300049460 | Bacteria | 2727 |
| 259 | Ga0501043_0208300 | 3300049579 | Bacteria | 1516 |
| 260 | Ga0501047_0075397 | 3300049581 | Bacteria | 3246 |
| 261 | Ga0501047_0134042 | 3300049581 | Bacteria | 2357 |
| 262 | Ga0501223_000353 | 3300049663 | Bacteria | 11314 |
| 263 | Ga0501225_0000315 | 3300049705 | Bacteria | 15102 |
| 264 | Ga0501241_002936 | 3300049758 | Bacteria | 3266 |
| 265 | Ga0501035_0351964 | 3300049822 | Bacteria | 1232 |
| 266 | Ga0501044_0010027 | 3300049823 | Bacteria | 10294 |
| 267 | nmdc:mga0k408_222270_c1 | 3300050493 | Bacteria | 1127 |
| 268 | nmdc:mga0k408_511_c1 | 3300050493 | Bacteria | 21337 |
| 269 | nmdc:mga07m45_91775_c1 | 3300050496 | Bacteria | 1740 |
| 270 | nmdc:mga05p37_3508_c1 | 3300050507 | Bacteria | 18329 |
| 271 | Ga0500578_0000017 | 3300053086 | Bacteria | 178494 |
| 272 | Ga0500578_0056924 | 3300053086 | Bacteria | 2500 |
| 273 | Ga0500644_0000332 | 3300053088 | Bacteria | 24138 |
| 274 | Ga0500646_0022652 | 3300053090 | Bacteria | 1681 |
| 275 | Ga0500583_0000139 | 3300053092 | Bacteria | 30587 |
| 276 | Ga0500583_0006314 | 3300053092 | Bacteria | 4065 |
| 277 | Ga0500583_0026295 | 3300053092 | Bacteria | 2497 |
| 278 | Ga0500651_0000202 | 3300053093 | Bacteria | 37847 |
| 279 | Ga0500651_0197258 | 3300053093 | Unclassified | 1189 |
| 280 | Ga0500569_000892 | 3300053109 | Bacteria | 5328 |
| 281 | Ga0500607_053192 | 3300053121 | Bacteria | 2147 |
| 282 | Ga0500618_000061 | 3300053125 | Bacteria | 96180 |
| 283 | Ga0500652_110408 | 3300053131 | Bacteria | 1149 |
| 284 | Ga0500658_0006478 | 3300053134 | Bacteria | 4341 |
| 285 | Ga0500658_0122498 | 3300053134 | Bacteria | 1154 |
| 286 | Ga0500568_0051529 | 3300053139 | Bacteria | 1619 |
| 287 | Ga0500577_0000782 | 3300053142 | Bacteria | 8190 |
| 288 | Ga0500589_003640 | 3300053147 | Bacteria | 5605 |
| 289 | Ga0500616_0000004 | 3300053153 | Bacteria | 1002714 |
| 290 | Ga0500616_0018085 | 3300053153 | Bacteria | 3988 |
| 291 | Ga0500622_0056125 | 3300053156 | Bacteria | 2016 |
| 292 | Ga0500636_0011690 | 3300053177 | Bacteria | 5139 |
| 293 | Ga0500611_000072 | 3300053727 | Bacteria | 41204 |
| 294 | Ga0500645_054977 | 3300053730 | Bacteria | 1157 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005617 | Ga0068859_100681427 | Ga0068859_1006814271 | 230 |
| 2 | 3300006931 | Ga0097620_100681523 | Ga0097620_1006815231 | 230 |
| 3 | 3300013296 | Ga0157374_10324975 | Ga0157374_103249752 | 239 |
| 4 | 3300031507 | Ga0307509_10203885 | Ga0307509_102038852 | 239 |
| 5 | 3300053086 | Ga0500578_0056924 | Ga0500578_0056924_1344_2144 | 239 |
| 6 | iso_pu_bacteria | 2929239360 | 2929244143 | 253 |
| 7 | iso_pu_bacteria | 8003151029 | 8003157700 | 253 |
| 8 | 3300013296 | Ga0157374_10253944 | Ga0157374_102539441 | 254 |
| 9 | iso_pu_bacteria | 2818991460 | 2819679962 | 254 |
| 10 | 3300003761 | Ga0055535_1006809 | Ga0055535_10068092 | 255 |
| 11 | 3300005577 | Ga0068857_100109824 | Ga0068857_1001098243 | 255 |
| 12 | 3300005614 | Ga0068856_100012396 | Ga0068856_1000123967 | 255 |
| 13 | 3300010375 | Ga0105239_10015056 | Ga0105239_100150566 | 255 |
| 14 | 3300025242 | Ga0209258_100036 | Ga0209258_100036285 | 255 |
| 15 | 3300025254 | Ga0209148_1000139 | Ga0209148_100013911 | 255 |
| 16 | 3300026116 | Ga0207674_10062838 | Ga0207674_100628381 | 255 |
| 17 | 3300044656 | Ga0466969_0000050 | Ga0466969_0000050_15101_15934 | 255 |
| 18 | 3300044684 | Ga0466966_0004558 | Ga0466966_0004558_6195_7028 | 255 |
| 19 | 3300044693 | Ga0466961_0344799 | Ga0466961_0344799_37_870 | 255 |
| 20 | 3300044735 | Ga0466968_0035523 | Ga0466968_0035523_477_1310 | 255 |
| 21 | 3300045049 | Ga0466959_0000034 | Ga0466959_0000034_64508_65341 | 255 |
| 22 | 3300048918 | Ga0496115_0294272 | Ga0496115_0294272_327_1124 | 255 |
| 23 | 3300053088 | Ga0500644_0000332 | Ga0500644_0000332_1130_1948 | 255 |
| 24 | 3300053090 | Ga0500646_0022652 | Ga0500646_0022652_291_1112 | 255 |
| 25 | 3300053092 | Ga0500583_0026295 | Ga0500583_0026295_785_1603 | 255 |
| 26 | 3300053093 | Ga0500651_0197258 | Ga0500651_0197258_258_1079 | 255 |
| 27 | 3300053109 | Ga0500569_000892 | Ga0500569_000892_2087_2908 | 255 |
| 28 | 3300053121 | Ga0500607_053192 | Ga0500607_053192_161_979 | 255 |
| 29 | 3300053134 | Ga0500658_0006478 | Ga0500658_0006478_1863_2684 | 255 |
| 30 | 3300053142 | Ga0500577_0000782 | Ga0500577_0000782_566_1387 | 255 |
| 31 | 3300053153 | Ga0500616_0018085 | Ga0500616_0018085_267_1088 | 255 |
| 32 | 3300053177 | Ga0500636_0011690 | Ga0500636_0011690_1700_2518 | 255 |
| 33 | iso_pu_bacteria | 2839989709 | 2839991024 | 255 |
| 34 | 3300041997 | Ga0439431_0001090 | Ga0439431_0001090_1502_2332 | 256 |
| 35 | 3300042004 | Ga0439445_0006705 | Ga0439445_0006705_514_1344 | 256 |
| 36 | 3300001979 | JGI24740J21852_10005923 | JGI24740J21852_100059235 | 257 |
| 37 | 3300002738 | JGI25154J39366_1000080 | JGI25154J39366_100008064 | 257 |
| 38 | 3300003215 | JGI25153J46596_10010738 | JGI25153J46596_100107384 | 257 |
| 39 | 3300005262 | Ga0065165_1027777 | Ga0065165_10277773 | 257 |
| 40 | 3300005471 | Ga0070698_100314849 | Ga0070698_1003148491 | 257 |
| 41 | 3300005614 | Ga0068856_100012073 | Ga0068856_1000120736 | 257 |
| 42 | 3300009093 | Ga0105240_10004108 | Ga0105240_100041089 | 257 |
| 43 | 3300009093 | Ga0105240_10043975 | Ga0105240_100439755 | 257 |
| 44 | 3300009093 | Ga0105240_10184933 | Ga0105240_101849333 | 257 |
| 45 | 3300009174 | Ga0105241_10067515 | Ga0105241_100675152 | 257 |
| 46 | 3300009545 | Ga0105237_10011481 | Ga0105237_100114818 | 257 |
| 47 | 3300009551 | Ga0105238_10058338 | Ga0105238_100583383 | 257 |
| 48 | 3300010375 | Ga0105239_10001032 | Ga0105239_1000103226 | 257 |
| 49 | 3300010375 | Ga0105239_10010888 | Ga0105239_100108886 | 257 |
| 50 | 3300025246 | Ga0209646_1000091 | Ga0209646_10000912 | 257 |
| 51 | 3300025250 | Ga0209026_1000466 | Ga0209026_10004667 | 257 |
| 52 | 3300025297 | Ga0209758_1004063 | Ga0209758_10040632 | 257 |
| 53 | 3300025302 | Ga0207426_1000251 | Ga0207426_100025155 | 257 |
| 54 | 3300025914 | Ga0207671_10017162 | Ga0207671_100171626 | 257 |
| 55 | 3300025937 | Ga0207669_10202791 | Ga0207669_102027912 | 257 |
| 56 | 3300026041 | Ga0207639_10220954 | Ga0207639_102209542 | 257 |
| 57 | 3300026078 | Ga0207702_10030201 | Ga0207702_100302014 | 257 |
| 58 | 3300026116 | Ga0207674_10057736 | Ga0207674_100577362 | 257 |
| 59 | 3300026116 | Ga0207674_10108655 | Ga0207674_101086553 | 257 |
| 60 | 3300041404 | Ga0439436_0017383 | Ga0439436_0017383_368_1222 | 257 |
| 61 | 3300041512 | Ga0451853_2388852 | Ga0451853_2388852_46_900 | 257 |
| 62 | 3300041512 | Ga0451853_3622070 | Ga0451853_3622070_629_1483 | 257 |
| 63 | 3300042014 | Ga0439457_009194 | Ga0439457_009194_1157_2011 | 257 |
| 64 | 3300044842 | Ga0466957_0016656 | Ga0466957_0016656_2225_3079 | 257 |
| 65 | 3300046462 | Ga0495651_0272358 | Ga0495651_0272358_26_862 | 257 |
| 66 | 3300046529 | Ga0495652_0423091 | Ga0495652_0423091_25_861 | 257 |
| 67 | 3300047472 | Ga0495686_0032896 | Ga0495686_0032896_2399_3235 | 257 |
| 68 | 3300049579 | Ga0501043_0208300 | Ga0501043_0208300_144_998 | 257 |
| 69 | 3300049581 | Ga0501047_0075397 | Ga0501047_0075397_997_1851 | 257 |
| 70 | 3300049581 | Ga0501047_0134042 | Ga0501047_0134042_1471_2262 | 257 |
| 71 | 3300049705 | Ga0501225_0000315 | Ga0501225_0000315_390_1244 | 257 |
| 72 | 3300049822 | Ga0501035_0351964 | Ga0501035_0351964_124_915 | 257 |
| 73 | 3300049823 | Ga0501044_0010027 | Ga0501044_0010027_6161_7015 | 257 |
| 74 | 3300053086 | Ga0500578_0000017 | Ga0500578_0000017_32547_33401 | 257 |
| 75 | 3300053092 | Ga0500583_0006314 | Ga0500583_0006314_1838_2692 | 257 |
| 76 | 3300053131 | Ga0500652_110408 | Ga0500652_110408_141_923 | 257 |
| 77 | 3300053134 | Ga0500658_0122498 | Ga0500658_0122498_31_885 | 257 |
| 78 | 3300053139 | Ga0500568_0051529 | Ga0500568_0051529_611_1393 | 257 |
| 79 | 3300053147 | Ga0500589_003640 | Ga0500589_003640_3072_3926 | 257 |
| 80 | 3300053156 | Ga0500622_0056125 | Ga0500622_0056125_862_1716 | 257 |
| 81 | 3300025208 | Ga0209436_103456 | Ga0209436_1034564 | 258 |
| 82 | 3300025284 | Ga0209130_1002864 | Ga0209130_10028645 | 258 |
| 83 | 3300025302 | Ga0207426_1000234 | Ga0207426_100023440 | 258 |
| 84 | 3300025914 | Ga0207671_10024009 | Ga0207671_100240091 | 258 |
| 85 | 3300025949 | Ga0207667_10024059 | Ga0207667_100240595 | 258 |
| 86 | 3300026078 | Ga0207702_10261530 | Ga0207702_102615301 | 258 |
| 87 | 3300050507 | nmdc:mga05p37_3508_c1 | nmdc:mga05p37_3508_c1_7494_8363 | 258 |
| 88 | 3300001989 | JGI24739J22299_10005969 | JGI24739J22299_100059695 | 259 |
| 89 | 3300002741 | JGI25157J39369_1008278 | JGI25157J39369_10082782 | 259 |
| 90 | 3300002772 | JGI25164J39214_1002355 | JGI25164J39214_10023551 | 259 |
| 91 | 3300003203 | JGI25406J46586_10001359 | JGI25406J46586_100013597 | 259 |
| 92 | 3300003214 | JGI25165J46597_1001347 | JGI25165J46597_10013473 | 259 |
| 93 | 3300003215 | JGI25153J46596_10073243 | JGI25153J46596_100732431 | 259 |
| 94 | 3300003320 | rootH2_10077389 | rootH2_100773891 | 259 |
| 95 | 3300003322 | rootL2_10032084 | rootL2_100320843 | 259 |
| 96 | 3300003354 | JGI25160J50197_1034595 | JGI25160J50197_10345952 | 259 |
| 97 | 3300003354 | JGI25160J50197_1044919 | JGI25160J50197_10449191 | 259 |
| 98 | 3300003771 | Ga0055526_1004966 | Ga0055526_10049664 | 259 |
| 99 | 3300003771 | Ga0055526_1013443 | Ga0055526_10134431 | 259 |
| 100 | 3300003790 | Ga0055528_1000595 | Ga0055528_100059519 | 259 |
| 101 | 3300003791 | Ga0055530_10002678 | Ga0055530_100026785 | 259 |
| 102 | 3300005262 | Ga0065165_1000280 | Ga0065165_100028068 | 259 |
| 103 | 3300005329 | Ga0070683_100006169 | Ga0070683_1000061693 | 259 |
| 104 | 3300005329 | Ga0070683_100093068 | Ga0070683_1000930682 | 259 |
| 105 | 3300005330 | Ga0070690_100090947 | Ga0070690_1000909472 | 259 |
| 106 | 3300005331 | Ga0070670_100093101 | Ga0070670_1000931012 | 259 |
| 107 | 3300005334 | Ga0068869_100174702 | Ga0068869_1001747022 | 259 |
| 108 | 3300005335 | Ga0070666_10282197 | Ga0070666_102821971 | 259 |
| 109 | 3300005338 | Ga0068868_100061812 | Ga0068868_1000618121 | 259 |
| 110 | 3300005340 | Ga0070689_100628269 | Ga0070689_1006282691 | 259 |
| 111 | 3300005344 | Ga0070661_100082729 | Ga0070661_1000827293 | 259 |
| 112 | 3300005344 | Ga0070661_100178759 | Ga0070661_1001787591 | 259 |
| 113 | 3300005355 | Ga0070671_100101711 | Ga0070671_1001017113 | 259 |
| 114 | 3300005355 | Ga0070671_100230607 | Ga0070671_1002306072 | 259 |
| 115 | 3300005364 | Ga0070673_100273345 | Ga0070673_1002733451 | 259 |
| 116 | 3300005441 | Ga0070700_100132970 | Ga0070700_1001329701 | 259 |
| 117 | 3300005455 | Ga0070663_100004419 | Ga0070663_1000044196 | 259 |
| 118 | 3300005458 | Ga0070681_10216129 | Ga0070681_102161292 | 259 |
| 119 | 3300005535 | Ga0070684_100009465 | Ga0070684_10000946511 | 259 |
| 120 | 3300005535 | Ga0070684_100016346 | Ga0070684_1000163462 | 259 |
| 121 | 3300005548 | Ga0070665_100000845 | Ga0070665_1000008458 | 259 |
| 122 | 3300005563 | Ga0068855_100000302 | Ga0068855_10000030237 | 259 |
| 123 | 3300005564 | Ga0070664_100002232 | Ga0070664_10000223210 | 259 |
| 124 | 3300005614 | Ga0068856_100343349 | Ga0068856_1003433491 | 259 |
| 125 | 3300005615 | Ga0070702_100024761 | Ga0070702_1000247613 | 259 |
| 126 | 3300005615 | Ga0070702_100273072 | Ga0070702_1002730722 | 259 |
| 127 | 3300005616 | Ga0068852_100195694 | Ga0068852_1001956941 | 259 |
| 128 | 3300005719 | Ga0068861_100084708 | Ga0068861_1000847082 | 259 |
| 129 | 3300005719 | Ga0068861_100429148 | Ga0068861_1004291482 | 259 |
| 130 | 3300005842 | Ga0068858_100128227 | Ga0068858_1001282273 | 259 |
| 131 | 3300005843 | Ga0068860_100474379 | Ga0068860_1004743792 | 259 |
| 132 | 3300005985 | Ga0081539_10000037 | Ga0081539_10000037261 | 259 |
| 133 | 3300009093 | Ga0105240_10000010 | Ga0105240_1000001073 | 259 |
| 134 | 3300009093 | Ga0105240_10069569 | Ga0105240_100695693 | 259 |
| 135 | 3300009174 | Ga0105241_10007402 | Ga0105241_100074024 | 259 |
| 136 | 3300009174 | Ga0105241_10067770 | Ga0105241_100677702 | 259 |
| 137 | 3300009545 | Ga0105237_10002429 | Ga0105237_1000242911 | 259 |
| 138 | 3300009545 | Ga0105237_10004724 | Ga0105237_100047248 | 259 |
| 139 | 3300009545 | Ga0105237_10045574 | Ga0105237_100455743 | 259 |
| 140 | 3300009545 | Ga0105237_10226546 | Ga0105237_102265462 | 259 |
| 141 | 3300010375 | Ga0105239_10019590 | Ga0105239_100195904 | 259 |
| 142 | 3300010375 | Ga0105239_10170620 | Ga0105239_101706203 | 259 |
| 143 | 3300010375 | Ga0105239_10382623 | Ga0105239_103826232 | 259 |
| 144 | 3300013100 | Ga0157373_10004120 | Ga0157373_1000412010 | 259 |
| 145 | 3300013102 | Ga0157371_10076220 | Ga0157371_100762202 | 259 |
| 146 | 3300013102 | Ga0157371_10094764 | Ga0157371_100947642 | 259 |
| 147 | 3300013102 | Ga0157371_10127870 | Ga0157371_101278703 | 259 |
| 148 | 3300013296 | Ga0157374_10104682 | Ga0157374_101046821 | 259 |
| 149 | 3300013297 | Ga0157378_10344666 | Ga0157378_103446662 | 259 |
| 150 | 3300013306 | Ga0163162_10011996 | Ga0163162_1001199610 | 259 |
| 151 | 3300013307 | Ga0157372_10007963 | Ga0157372_1000796310 | 259 |
| 152 | 3300013307 | Ga0157372_10103702 | Ga0157372_101037021 | 259 |
| 153 | 3300013307 | Ga0157372_10130046 | Ga0157372_101300462 | 259 |
| 154 | 3300013307 | Ga0157372_10500618 | Ga0157372_105006182 | 259 |
| 155 | 3300014325 | Ga0163163_10124766 | Ga0163163_101247663 | 259 |
| 156 | 3300014745 | Ga0157377_10005854 | Ga0157377_100058544 | 259 |
| 157 | 3300014745 | Ga0157377_10094326 | Ga0157377_100943262 | 259 |
| 158 | 3300025231 | Ga0207427_100159 | Ga0207427_10015912 | 259 |
| 159 | 3300025233 | Ga0209437_100021 | Ga0209437_10002132 | 259 |
| 160 | 3300025250 | Ga0209026_1001412 | Ga0209026_10014122 | 259 |
| 161 | 3300025261 | Ga0209233_1000264 | Ga0209233_100026432 | 259 |
| 162 | 3300025273 | Ga0209673_1000014 | Ga0209673_1000014192 | 259 |
| 163 | 3300025273 | Ga0209673_1000018 | Ga0209673_1000018140 | 259 |
| 164 | 3300025291 | Ga0209675_1028974 | Ga0209675_10289742 | 259 |
| 165 | 3300025295 | Ga0209564_1000465 | Ga0209564_100046561 | 259 |
| 166 | 3300025295 | Ga0209564_1002499 | Ga0209564_100249915 | 259 |
| 167 | 3300025297 | Ga0209758_1001032 | Ga0209758_10010329 | 259 |
| 168 | 3300025297 | Ga0209758_1027411 | Ga0209758_10274112 | 259 |
| 169 | 3300025298 | Ga0209050_1000177 | Ga0209050_100017722 | 259 |
| 170 | 3300025298 | Ga0209050_1002162 | Ga0209050_100216214 | 259 |
| 171 | 3300025298 | Ga0209050_1013311 | Ga0209050_10133112 | 259 |
| 172 | 3300025302 | Ga0207426_1000435 | Ga0207426_100043565 | 259 |
| 173 | 3300025303 | Ga0209051_1030337 | Ga0209051_10303372 | 259 |
| 174 | 3300025304 | Ga0209257_1002645 | Ga0209257_10026455 | 259 |
| 175 | 3300025321 | Ga0207656_10154736 | Ga0207656_101547361 | 259 |
| 176 | 3300025901 | Ga0207688_10101439 | Ga0207688_101014392 | 259 |
| 177 | 3300025904 | Ga0207647_10002941 | Ga0207647_1000294114 | 259 |
| 178 | 3300025907 | Ga0207645_10391925 | Ga0207645_103919251 | 259 |
| 179 | 3300025909 | Ga0207705_10282778 | Ga0207705_102827782 | 259 |
| 180 | 3300025913 | Ga0207695_10000019 | Ga0207695_10000019378 | 259 |
| 181 | 3300025913 | Ga0207695_10097611 | Ga0207695_100976113 | 259 |
| 182 | 3300025914 | Ga0207671_10000382 | Ga0207671_100003823 | 259 |
| 183 | 3300025914 | Ga0207671_10000598 | Ga0207671_1000059846 | 259 |
| 184 | 3300025914 | Ga0207671_10084846 | Ga0207671_100848461 | 259 |
| 185 | 3300025920 | Ga0207649_10160629 | Ga0207649_101606292 | 259 |
| 186 | 3300025920 | Ga0207649_10304310 | Ga0207649_103043102 | 259 |
| 187 | 3300025925 | Ga0207650_10192490 | Ga0207650_101924902 | 259 |
| 188 | 3300025931 | Ga0207644_10150560 | Ga0207644_101505602 | 259 |
| 189 | 3300025936 | Ga0207670_10448754 | Ga0207670_104487541 | 259 |
| 190 | 3300025940 | Ga0207691_10133987 | Ga0207691_101339872 | 259 |
| 191 | 3300025944 | Ga0207661_10004657 | Ga0207661_1000465710 | 259 |
| 192 | 3300025945 | Ga0207679_10010129 | Ga0207679_1001012910 | 259 |
| 193 | 3300025949 | Ga0207667_10005555 | Ga0207667_100055556 | 259 |
| 194 | 3300026023 | Ga0207677_10049654 | Ga0207677_100496543 | 259 |
| 195 | 3300026041 | Ga0207639_10047788 | Ga0207639_100477882 | 259 |
| 196 | 3300026067 | Ga0207678_10094349 | Ga0207678_100943492 | 259 |
| 197 | 3300026142 | Ga0207698_10155273 | Ga0207698_101552732 | 259 |
| 198 | 3300026142 | Ga0207698_10372222 | Ga0207698_103722223 | 259 |
| 199 | 3300026142 | Ga0207698_10565184 | Ga0207698_105651842 | 259 |
| 200 | 3300028379 | Ga0268266_10004662 | Ga0268266_100046626 | 259 |
| 201 | 3300028381 | Ga0268264_10463684 | Ga0268264_104636842 | 259 |
| 202 | 3300030745 | Ga0316182_1285095 | Ga0316182_12850951 | 259 |
| 203 | 3300031251 | Ga0265327_10051130 | Ga0265327_100511301 | 259 |
| 204 | 3300031731 | Ga0307405_10014964 | Ga0307405_100149642 | 259 |
| 205 | 3300031852 | Ga0307410_10109450 | Ga0307410_101094502 | 259 |
| 206 | 3300032004 | Ga0307414_10010924 | Ga0307414_100109242 | 259 |
| 207 | 3300032004 | Ga0307414_10400100 | Ga0307414_104001001 | 259 |
| 208 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_629187_629999 | 259 |
| 209 | 3300037312 | Ga0395899_0157890 | Ga0395899_0157890_224_1042 | 259 |
| 210 | 3300037418 | Ga0395900_0374870 | Ga0395900_0374870_42_878 | 259 |
| 211 | 3300037418 | Ga0395900_0582952 | Ga0395900_0582952_86_988 | 259 |
| 212 | 3300037471 | Ga0395905_0000565 | Ga0395905_0000565_17941_18777 | 259 |
| 213 | 3300037471 | Ga0395905_0319212 | Ga0395905_0319212_593_1417 | 259 |
| 214 | 3300038443 | Ga0395901_0579173 | Ga0395901_0579173_132_968 | 259 |
| 215 | 3300041413 | Ga0439465_0012191 | Ga0439465_0012191_448_1275 | 259 |
| 216 | 3300044656 | Ga0466969_0087958 | Ga0466969_0087958_105_938 | 259 |
| 217 | 3300044683 | Ga0466965_0056730 | Ga0466965_0056730_644_1438 | 259 |
| 218 | 3300044684 | Ga0466966_0022052 | Ga0466966_0022052_437_1270 | 259 |
| 219 | 3300044842 | Ga0466957_0000137 | Ga0466957_0000137_9900_10754 | 259 |
| 220 | 3300045049 | Ga0466959_0066904 | Ga0466959_0066904_185_1009 | 259 |
| 221 | 3300045049 | Ga0466959_0154206 | Ga0466959_0154206_639_1472 | 259 |
| 222 | 3300045836 | Ga0466958_0111944 | Ga0466958_0111944_499_1332 | 259 |
| 223 | 3300046460 | Ga0495638_0000121 | Ga0495638_0000121_19248_20078 | 259 |
| 224 | 3300046507 | Ga0495606_0102704 | Ga0495606_0102704_813_1649 | 259 |
| 225 | 3300046616 | Ga0495668_0004316 | Ga0495668_0004316_407_1261 | 259 |
| 226 | 3300047472 | Ga0495686_0000748 | Ga0495686_0000748_40278_41096 | 259 |
| 227 | 3300048924 | Ga0496121_0000043 | Ga0496121_0000043_321312_322124 | 259 |
| 228 | 3300049663 | Ga0501223_000353 | Ga0501223_000353_1594_2427 | 259 |
| 229 | 3300050493 | nmdc:mga0k408_222270_c1 | nmdc:mga0k408_222270_c1_243_1037 | 259 |
| 230 | 3300053153 | Ga0500616_0000004 | Ga0500616_0000004_635545_636375 | 259 |
| 231 | 3300053727 | Ga0500611_000072 | Ga0500611_000072_27790_28626 | 259 |
| 232 | iso_pu_bacteria | 2919437846 | 2919439164 | 259 |
| 233 | 3300047320 | Ga0495672_0045175 | Ga0495672_0045175_1087_2001 | 260 |
| 234 | 3300053092 | Ga0500583_0000139 | Ga0500583_0000139_27163_28065 | 260 |
| 235 | 3300005327 | Ga0070658_10203456 | Ga0070658_102034562 | 261 |
| 236 | 3300005458 | Ga0070681_10011469 | Ga0070681_100114698 | 261 |
| 237 | 3300005530 | Ga0070679_100020757 | Ga0070679_1000207577 | 261 |
| 238 | 3300009147 | Ga0114129_10002041 | Ga0114129_1000204116 | 261 |
| 239 | 3300013100 | Ga0157373_10059117 | Ga0157373_100591172 | 261 |
| 240 | 3300025909 | Ga0207705_10391769 | Ga0207705_103917691 | 261 |
| 241 | 3300025912 | Ga0207707_10199308 | Ga0207707_101993082 | 261 |
| 242 | 3300025917 | Ga0207660_10075525 | Ga0207660_100755252 | 261 |
| 243 | 3300025921 | Ga0207652_10162049 | Ga0207652_101620492 | 261 |
| 244 | 3300044765 | Ga0466970_0000371 | Ga0466970_0000371_16914_17759 | 261 |
| 245 | 3300044901 | Ga0466960_0111342 | Ga0466960_0111342_343_1188 | 261 |
| 246 | iso_pu_bacteria | 2738543023 | 2739303519 | 261 |
| 247 | iso_pu_bacteria | 2852627209 | 2852631587 | 261 |
| 248 | iso_pu_bacteria | 2919186247 | 2919190514 | 261 |
| 249 | iso_pu_bacteria | 2939664404 | 2939668795 | 261 |
| 250 | 3300003322 | rootL2_10225494 | rootL2_102254942 | 262 |
| 251 | 3300005366 | Ga0070659_100003758 | Ga0070659_10000375815 | 262 |
| 252 | 3300005563 | Ga0068855_100295689 | Ga0068855_1002956892 | 262 |
| 253 | 3300005616 | Ga0068852_100000248 | Ga0068852_10000024829 | 262 |
| 254 | 3300005834 | Ga0068851_10153646 | Ga0068851_101536461 | 262 |
| 255 | 3300013307 | Ga0157372_10013931 | Ga0157372_100139319 | 262 |
| 256 | 3300025904 | Ga0207647_10000045 | Ga0207647_1000004527 | 262 |
| 257 | 3300025932 | Ga0207690_10001397 | Ga0207690_1000139711 | 262 |
| 258 | 3300026142 | Ga0207698_10010662 | Ga0207698_100106622 | 262 |
| 259 | 3300031456 | Ga0307513_10097703 | Ga0307513_100977032 | 262 |
| 260 | 3300046492 | Ga0495585_0001889 | Ga0495585_0001889_14116_14913 | 262 |
| 261 | 3300046524 | Ga0495648_0001649 | Ga0495648_0001649_16847_17644 | 262 |
| 262 | 3300046557 | Ga0495622_0063222 | Ga0495622_0063222_726_1523 | 262 |
| 263 | 3300046660 | Ga0495625_0001508 | Ga0495625_0001508_1021_1818 | 262 |
| 264 | 3300049460 | Ga0495682_0017257 | Ga0495682_0017257_325_1122 | 262 |
| 265 | iso_pu_bacteria | 2738541284 | 2738762208 | 262 |
| 266 | iso_pu_bacteria | 2775506987 | 2776615169 | 262 |
| 267 | 3300003322 | rootL2_10155532 | rootL2_101555323 | 263 |
| 268 | 3300009545 | Ga0105237_10077429 | Ga0105237_100774291 | 263 |
| 269 | 3300010375 | Ga0105239_10000679 | Ga0105239_100006792 | 263 |
| 270 | 3300010375 | Ga0105239_10002322 | Ga0105239_1000232215 | 263 |
| 271 | 3300025233 | Ga0209437_100041 | Ga0209437_10004192 | 263 |
| 272 | 3300025914 | Ga0207671_10004874 | Ga0207671_1000487410 | 263 |
| 273 | 3300028794 | Ga0307515_10000223 | Ga0307515_1000022374 | 263 |
| 274 | 3300033179 | Ga0307507_10000010 | Ga0307507_10000010156 | 263 |
| 275 | 3300046524 | Ga0495648_0029041 | Ga0495648_0029041_955_1773 | 263 |
| 276 | 3300046538 | Ga0495609_0005985 | Ga0495609_0005985_463_1281 | 263 |
| 277 | 3300046558 | Ga0495633_0000081 | Ga0495633_0000081_93398_94216 | 263 |
| 278 | 3300046616 | Ga0495668_0000003 | Ga0495668_0000003_404278_405096 | 263 |
| 279 | 3300047443 | Ga0495687_070171 | Ga0495687_070171_522_1340 | 263 |
| 280 | 3300050493 | nmdc:mga0k408_511_c1 | nmdc:mga0k408_511_c1_12649_13464 | 263 |
| 281 | 3300050496 | nmdc:mga07m45_91775_c1 | nmdc:mga07m45_91775_c1_895_1710 | 263 |
| 282 | 3300053125 | Ga0500618_000061 | Ga0500618_000061_82357_83175 | 263 |
| 283 | 3300053730 | Ga0500645_054977 | Ga0500645_054977_224_1138 | 263 |
| 284 | 3300005288 | Ga0065714_10007419 | Ga0065714_100074195 | 265 |
| 285 | 3300013104 | Ga0157370_10129146 | Ga0157370_101291464 | 265 |
| 286 | 3300030744 | Ga0316181_1067118 | Ga0316181_10671181 | 265 |
| 287 | 3300032004 | Ga0307414_10007128 | Ga0307414_100071286 | 265 |
| 288 | 3300032005 | Ga0307411_10460455 | Ga0307411_104604552 | 265 |
| 289 | 2162886007 | SwRhRL2b_contig_830297 | SwRhRL2b_0119.00006050 | 266 |
| 290 | 3300003323 | rootH1_10099612 | rootH1_1009961210 | 266 |
| 291 | 3300005288 | Ga0065714_10002355 | Ga0065714_1000235512 | 266 |
| 292 | 3300005288 | Ga0065714_10003298 | Ga0065714_100032985 | 266 |
| 293 | 3300005289 | Ga0065704_10070217 | Ga0065704_1007021770 | 266 |
| 294 | 3300005289 | Ga0065704_10078365 | Ga0065704_100783654 | 266 |
| 295 | 3300013100 | Ga0157373_10000440 | Ga0157373_100004402 | 266 |
| 296 | 3300013102 | Ga0157371_10002650 | Ga0157371_1000265018 | 266 |
| 297 | 3300013102 | Ga0157371_10026681 | Ga0157371_100266815 | 266 |
| 298 | 3300013104 | Ga0157370_10027681 | Ga0157370_100276816 | 266 |
| 299 | 3300014497 | Ga0182008_10000034 | Ga0182008_10000034111 | 266 |
| 300 | 3300031911 | Ga0307412_10000049 | Ga0307412_1000004990 | 266 |
| 301 | 3300032004 | Ga0307414_10000142 | Ga0307414_1000014219 | 266 |
| 302 | 3300046660 | Ga0495625_0091117 | Ga0495625_0091117_914_1771 | 266 |
| 303 | 3300047472 | Ga0495686_0000454 | Ga0495686_0000454_24878_25732 | 266 |
| 304 | 3300049758 | Ga0501241_002936 | Ga0501241_002936_1212_2012 | 266 |
| 305 | 3300053093 | Ga0500651_0000202 | Ga0500651_0000202_23208_24008 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dqh-assembly1.cif.gz_A | cronobacter sakazakii (enterobacter sakazakii) metallo-beta-lactamse harldq motif | 0.8225 | 11 | 144 |
| 6kns-assembly3.cif.gz_C-2 | crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) | 0.81 | 4 | 255 |
| 6kns-assembly2.cif.gz_B-2 | crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) | 0.8072 | 4 | 255 |
| 1qh5-assembly1.cif.gz_B | human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione | 0.802 | 8 | 145 |
| 6kns-assembly2.cif.gz_B-2 | crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) | 0.8011 | 4 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2U5_10_248_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9566 | 11 | 239 | 3.60.15.10 |
| af_Q2G2U5_10_248_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9139 | 11 | 239 | 3.60.15.10 |
| af_I1ML74_165_350_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8168 | 53 | 153 | 3.60.15.10 |
| af_Q58271_3_207_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8149 | 9 | 146 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8123 | 8 | 145 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352F8W2-F1-model_v4 | MBL fold metallo-hydrolase | 0.9974 | 5 | 256 |
GO:0016787
|
| AF-A0A3B1CPK8-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9951 | 6 | 84 |
|
| AF-A0A4R8DFF8-F1-model_v4 | Phosphoribosyl 1,2-cyclic phosphodiesterase | 0.9938 | 5 | 256 |
|
| AF-A0A562UCG9-F1-model_v4 | Phosphoribosyl 1,2-cyclic phosphodiesterase | 0.9915 | 4 | 266 |
|
| AF-A0A349QVM8-F1-model_v4 | MBL fold metallo-hydrolase | 0.9908 | 7 | 254 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar