F398095

General Info

Members Datasets Scaffolds Average Seq Length
305 201 294 275

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10002041|Ga0114129_1000204116
Length 320
Sequence MIFVHYKVNLIIHHCRLTIHELIKIHFLCNSMSLFIASLNSGSNGNCYYVGNDQEAVLVDAGISCRETERRMQRIGLSMEKVKAIFVSHEHTDHISGIPVLAKKYKLPVYITDATLHHGGLQLNKDQILSFKPYEAVQVGNLTVKAFPKFHDAAEPHSFVVSSNNINIGVFTDIGAPCDHVIMHFQKCHAAFLEANYDDHMLEQGSYPHHLKKRIRGGQGHLSNKQALEIFTNHRPSFMSHLFLSHLSRDNNSPALVQELFNAHAGETQIIIASRFEETPVYQIHPAKSEHAQTNLPQQTDIPVKRARKSVPVYIQGRLW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541284 Pedobacter sp. YR016 Isolate Unclassified
3 2738543023 Pedobacter sp. OK628 Isolate Unclassified
4 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
5 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
6 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
7 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
8 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
9 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
188 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
189 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0
Isolates 3.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.98
Nodule 0
Rhizoplane 0.33
Rhizosphere 70.82
Stem 0
Stem Tuber 0
Unclassified 7.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_830297 2162886007 Bacteria 3410
2 JGI24740J21852_10005923 3300001979 Bacteria 5122
3 JGI24739J22299_10005969 3300001989 Bacteria 4608
4 JGI25154J39366_1000080 3300002738 Bacteria 89374
5 JGI25157J39369_1008278 3300002741 Bacteria 1452
6 JGI25164J39214_1002355 3300002772 Bacteria 2970
7 JGI25406J46586_10001359 3300003203 Bacteria 11519
8 JGI25165J46597_1001347 3300003214 Bacteria 13703
9 JGI25153J46596_10010738 3300003215 Bacteria 4113
10 JGI25153J46596_10073243 3300003215 Bacteria 878
11 rootH2_10077389 3300003320 Bacteria 2048
12 rootL2_10032084 3300003322 Bacteria 14316
13 rootL2_10155532 3300003322 Bacteria 3142
14 rootL2_10225494 3300003322 Bacteria 1405
15 rootH1_10099612 3300003323 Bacteria 14680
16 JGI25160J50197_1034595 3300003354 Bacteria 1252
17 JGI25160J50197_1044919 3300003354 Bacteria 981
18 Ga0055535_1006809 3300003761 Unclassified 2262
19 Ga0055526_1004966 3300003771 Bacteria 7809
20 Ga0055526_1013443 3300003771 Bacteria 3463
21 Ga0055528_1000595 3300003790 Bacteria 27213
22 Ga0055530_10002678 3300003791 Bacteria 11104
23 Ga0065165_1000280 3300005262 Bacteria 87088
24 Ga0065165_1027777 3300005262 Bacteria 1838
25 Ga0065714_10002355 3300005288 Bacteria 26928
26 Ga0065714_10003298 3300005288 Bacteria 17303
27 Ga0065714_10007419 3300005288 Bacteria 4429
28 Ga0065704_10070217 3300005289 Bacteria 69033
29 Ga0065704_10078365 3300005289 Bacteria 4451
30 Ga0070658_10203456 3300005327 Bacteria 1671
31 Ga0070683_100006169 3300005329 Bacteria 10050
32 Ga0070683_100093068 3300005329 Bacteria 2831
33 Ga0070690_100090947 3300005330 Bacteria 2010
34 Ga0070670_100093101 3300005331 Bacteria 2592
35 Ga0068869_100174702 3300005334 Bacteria 1680
36 Ga0070666_10282197 3300005335 Bacteria 1181
37 Ga0068868_100061812 3300005338 Bacteria 2967
38 Ga0070689_100628269 3300005340 Unclassified 932
39 Ga0070661_100082729 3300005344 Unclassified 2371
40 Ga0070661_100178759 3300005344 Bacteria 1614
41 Ga0070671_100101711 3300005355 Bacteria 2411
42 Ga0070671_100230607 3300005355 Bacteria 1571
43 Ga0070673_100273345 3300005364 Bacteria 1480
44 Ga0070659_100003758 3300005366 Bacteria 10828
45 Ga0070700_100132970 3300005441 Bacteria 1681
46 Ga0070663_100004419 3300005455 Bacteria 8268
47 Ga0070681_10011469 3300005458 Bacteria 8773
48 Ga0070681_10216129 3300005458 Bacteria 1833
49 Ga0070698_100314849 3300005471 Bacteria 1496
50 Ga0070679_100020757 3300005530 Bacteria 6407
51 Ga0070684_100009465 3300005535 Bacteria 7674
52 Ga0070684_100016346 3300005535 Bacteria 6062
53 Ga0070665_100000845 3300005548 Bacteria 39974
54 Ga0068855_100000302 3300005563 Bacteria 61501
55 Ga0068855_100295689 3300005563 Bacteria 1794
56 Ga0070664_100002232 3300005564 Bacteria 15589
57 Ga0068857_100109824 3300005577 Bacteria 2478
58 Ga0068856_100012073 3300005614 Bacteria 8368
59 Ga0068856_100012396 3300005614 Bacteria 8256
60 Ga0068856_100343349 3300005614 Bacteria 1511
61 Ga0070702_100024761 3300005615 Bacteria 3206
62 Ga0070702_100273072 3300005615 Unclassified 1157
63 Ga0068852_100000248 3300005616 Bacteria 36699
64 Ga0068852_100195694 3300005616 Bacteria 1910
65 Ga0068859_100681427 3300005617 Unclassified 1119
66 Ga0068861_100084708 3300005719 Bacteria 2489
67 Ga0068861_100429148 3300005719 Unclassified 1179
68 Ga0068851_10153646 3300005834 Bacteria 1260
69 Ga0068858_100128227 3300005842 Bacteria 2378
70 Ga0068860_100474379 3300005843 Bacteria 1246
71 Ga0081539_10000037 3300005985 Bacteria 296160
72 Ga0097620_100681523 3300006931 Unclassified 1119
73 Ga0105240_10000010 3300009093 Bacteria 537830
74 Ga0105240_10004108 3300009093 Bacteria 22346
75 Ga0105240_10043975 3300009093 Bacteria 5679
76 Ga0105240_10069569 3300009093 Bacteria 4356
77 Ga0105240_10184933 3300009093 Bacteria 2455
78 Ga0114129_10002041 3300009147 Bacteria 27695
79 Ga0105241_10007402 3300009174 Bacteria 8077
80 Ga0105241_10067515 3300009174 Bacteria 2768
81 Ga0105241_10067770 3300009174 Bacteria 2763
82 Ga0105237_10002429 3300009545 Bacteria 23143
83 Ga0105237_10004724 3300009545 Bacteria 15670
84 Ga0105237_10011481 3300009545 Bacteria 9372
85 Ga0105237_10045574 3300009545 Bacteria 4412
86 Ga0105237_10077429 3300009545 Bacteria 3315
87 Ga0105237_10226546 3300009545 Bacteria 1870
88 Ga0105238_10058338 3300009551 Bacteria 3869
89 Ga0105239_10000679 3300010375 Bacteria 48522
90 Ga0105239_10001032 3300010375 Bacteria 38819
91 Ga0105239_10002322 3300010375 Bacteria 24279
92 Ga0105239_10010888 3300010375 Bacteria 10161
93 Ga0105239_10015056 3300010375 Bacteria 8574
94 Ga0105239_10019590 3300010375 Bacteria 7468
95 Ga0105239_10170620 3300010375 Unclassified 2433
96 Ga0105239_10382623 3300010375 Bacteria 1591
97 Ga0157373_10000440 3300013100 Bacteria 32951
98 Ga0157373_10004120 3300013100 Bacteria 10962
99 Ga0157373_10059117 3300013100 Bacteria 2716
100 Ga0157371_10002650 3300013102 Bacteria 16949
101 Ga0157371_10026681 3300013102 Bacteria 4195
102 Ga0157371_10076220 3300013102 Bacteria 2375
103 Ga0157371_10094764 3300013102 Bacteria 2115
104 Ga0157371_10127870 3300013102 Bacteria 1807
105 Ga0157370_10027681 3300013104 Bacteria 5588
106 Ga0157370_10129146 3300013104 Bacteria 2358
107 Ga0157374_10104682 3300013296 Bacteria 2717
108 Ga0157374_10253944 3300013296 Unclassified 1730
109 Ga0157374_10324975 3300013296 Bacteria 1525
110 Ga0157378_10344666 3300013297 Bacteria 1454
111 Ga0163162_10011996 3300013306 Bacteria 8452
112 Ga0157372_10007963 3300013307 Bacteria 11267
113 Ga0157372_10013931 3300013307 Bacteria 8592
114 Ga0157372_10103702 3300013307 Bacteria 3250
115 Ga0157372_10130046 3300013307 Bacteria 2896
116 Ga0157372_10500618 3300013307 Bacteria 1417
117 Ga0163163_10124766 3300014325 Bacteria 2612
118 Ga0182008_10000034 3300014497 Bacteria 138235
119 Ga0157377_10005854 3300014745 Bacteria 5815
120 Ga0157377_10094326 3300014745 Bacteria 1773
121 Ga0209436_103456 3300025208 Unclassified 4200
122 Ga0207427_100159 3300025231 Bacteria 76256
123 Ga0209437_100021 3300025233 Bacteria 646400
124 Ga0209437_100041 3300025233 Bacteria 444465
125 Ga0209258_100036 3300025242 Bacteria 428859
126 Ga0209646_1000091 3300025246 Bacteria 188727
127 Ga0209026_1000466 3300025250 Bacteria 31172
128 Ga0209026_1001412 3300025250 Bacteria 10688
129 Ga0209148_1000139 3300025254 Bacteria 167011
130 Ga0209233_1000264 3300025261 Bacteria 78251
131 Ga0209673_1000014 3300025273 Bacteria 537082
132 Ga0209673_1000018 3300025273 Bacteria 458281
133 Ga0209130_1002864 3300025284 Bacteria 7976
134 Ga0209675_1028974 3300025291 Bacteria 1340
135 Ga0209564_1000465 3300025295 Bacteria 67957
136 Ga0209564_1002499 3300025295 Bacteria 14320
137 Ga0209758_1001032 3300025297 Bacteria 36527
138 Ga0209758_1004063 3300025297 Bacteria 12608
139 Ga0209758_1027411 3300025297 Bacteria 2434
140 Ga0209050_1000177 3300025298 Bacteria 146637
141 Ga0209050_1002162 3300025298 Bacteria 17825
142 Ga0209050_1013311 3300025298 Bacteria 3665
143 Ga0207426_1000234 3300025302 Bacteria 126926
144 Ga0207426_1000251 3300025302 Bacteria 117462
145 Ga0207426_1000435 3300025302 Bacteria 67658
146 Ga0209051_1030337 3300025303 Bacteria 2100
147 Ga0209257_1002645 3300025304 Bacteria 17239
148 Ga0207656_10154736 3300025321 Bacteria 1088
149 Ga0207688_10101439 3300025901 Bacteria 1662
150 Ga0207647_10000045 3300025904 Bacteria 90413
151 Ga0207647_10002941 3300025904 Bacteria 12819
152 Ga0207645_10391925 3300025907 Bacteria 933
153 Ga0207705_10282778 3300025909 Bacteria 1270
154 Ga0207705_10391769 3300025909 Bacteria 1074
155 Ga0207707_10199308 3300025912 Unclassified 1745
156 Ga0207695_10000019 3300025913 Bacteria 732137
157 Ga0207695_10097611 3300025913 Unclassified 2939
158 Ga0207671_10000382 3300025914 Bacteria 62807
159 Ga0207671_10000598 3300025914 Bacteria 48008
160 Ga0207671_10004874 3300025914 Bacteria 12624
161 Ga0207671_10017162 3300025914 Bacteria 5593
162 Ga0207671_10024009 3300025914 Bacteria 4589
163 Ga0207671_10084846 3300025914 Bacteria 2379
164 Ga0207660_10075525 3300025917 Unclassified 2462
165 Ga0207649_10160629 3300025920 Unclassified 1557
166 Ga0207649_10304310 3300025920 Bacteria 1166
167 Ga0207652_10162049 3300025921 Unclassified 2005
168 Ga0207650_10192490 3300025925 Bacteria 1630
169 Ga0207644_10150560 3300025931 Bacteria 1800
170 Ga0207690_10001397 3300025932 Bacteria 15167
171 Ga0207670_10448754 3300025936 Bacteria 1039
172 Ga0207669_10202791 3300025937 Bacteria 1441
173 Ga0207691_10133987 3300025940 Bacteria 2187
174 Ga0207661_10004657 3300025944 Bacteria 9608
175 Ga0207679_10010129 3300025945 Bacteria 6063
176 Ga0207667_10005555 3300025949 Bacteria 15386
177 Ga0207667_10024059 3300025949 Bacteria 6697
178 Ga0207677_10049654 3300026023 Bacteria 2833
179 Ga0207639_10047788 3300026041 Bacteria 3236
180 Ga0207639_10220954 3300026041 Bacteria 1636
181 Ga0207678_10094349 3300026067 Bacteria 2557
182 Ga0207702_10030201 3300026078 Bacteria 4515
183 Ga0207702_10261530 3300026078 Bacteria 1630
184 Ga0207674_10057736 3300026116 Bacteria 3934
185 Ga0207674_10062838 3300026116 Bacteria 3750
186 Ga0207674_10108655 3300026116 Bacteria 2750
187 Ga0207698_10010662 3300026142 Bacteria 5924
188 Ga0207698_10155273 3300026142 Bacteria 1993
189 Ga0207698_10372222 3300026142 Unclassified 1356
190 Ga0207698_10565184 3300026142 Bacteria 1117
191 Ga0268266_10004662 3300028379 Bacteria 13064
192 Ga0268264_10463684 3300028381 Bacteria 1229
193 Ga0307515_10000223 3300028794 Bacteria 140434
194 Ga0316181_1067118 3300030744 Bacteria 1311
195 Ga0316182_1285095 3300030745 Bacteria 1079
196 Ga0265327_10051130 3300031251 Bacteria 2158
197 Ga0307513_10097703 3300031456 Bacteria 2971
198 Ga0307509_10203885 3300031507 Bacteria 1811
199 Ga0307405_10014964 3300031731 Unclassified 4188
200 Ga0307410_10109450 3300031852 Bacteria 1997
201 Ga0307412_10000049 3300031911 Bacteria 151588
202 Ga0307414_10000142 3300032004 Bacteria 48979
203 Ga0307414_10007128 3300032004 Bacteria 6274
204 Ga0307414_10010924 3300032004 Bacteria 5300
205 Ga0307414_10400100 3300032004 Bacteria 1192
206 Ga0307411_10460455 3300032005 Bacteria 1066
207 Ga0307507_10000010 3300033179 Bacteria 265208
208 Ga0395899_0000002 3300037312 Bacteria 1324310
209 Ga0395899_0157890 3300037312 Unclassified 1604
210 Ga0395900_0374870 3300037418 Bacteria 1392
211 Ga0395900_0582952 3300037418 Unclassified 1060
212 Ga0395905_0000565 3300037471 Bacteria 50339
213 Ga0395905_0319212 3300037471 Bacteria 1443
214 Ga0395901_0579173 3300038443 Bacteria 1134
215 Ga0439436_0017383 3300041404 Bacteria 2152
216 Ga0439465_0012191 3300041413 Bacteria 2691
217 Ga0451853_2388852 3300041512 Bacteria 2660
218 Ga0451853_3622070 3300041512 Bacteria 3294
219 Ga0439431_0001090 3300041997 Bacteria 5880
220 Ga0439445_0006705 3300042004 Bacteria 2653
221 Ga0439457_009194 3300042014 Bacteria 2305
222 Ga0466969_0000050 3300044656 Bacteria 63194
223 Ga0466969_0087958 3300044656 Bacteria 1475
224 Ga0466965_0056730 3300044683 Bacteria 1951
225 Ga0466966_0004558 3300044684 Bacteria 9130
226 Ga0466966_0022052 3300044684 Bacteria 4181
227 Ga0466961_0344799 3300044693 Unclassified 907
228 Ga0466968_0035523 3300044735 Bacteria 2086
229 Ga0466970_0000371 3300044765 Bacteria 21819
230 Ga0466957_0000137 3300044842 Bacteria 31195
231 Ga0466957_0016656 3300044842 Bacteria 4300
232 Ga0466960_0111342 3300044901 Bacteria 1423
233 Ga0466959_0000034 3300045049 Bacteria 108946
234 Ga0466959_0066904 3300045049 Bacteria 2606
235 Ga0466959_0154206 3300045049 Bacteria 1617
236 Ga0466958_0111944 3300045836 Bacteria 1704
237 Ga0495638_0000121 3300046460 Bacteria 126440
238 Ga0495651_0272358 3300046462 Bacteria 1147
239 Ga0495585_0001889 3300046492 Bacteria 15797
240 Ga0495606_0102704 3300046507 Bacteria 1738
241 Ga0495648_0001649 3300046524 Bacteria 21669
242 Ga0495648_0029041 3300046524 Bacteria 3675
243 Ga0495652_0423091 3300046529 Bacteria 938
244 Ga0495609_0005985 3300046538 Bacteria 6284
245 Ga0495622_0063222 3300046557 Bacteria 1713
246 Ga0495633_0000081 3300046558 Bacteria 125903
247 Ga0495668_0000003 3300046616 Bacteria 695023
248 Ga0495668_0004316 3300046616 Bacteria 10164
249 Ga0495625_0001508 3300046660 Bacteria 27981
250 Ga0495625_0091117 3300046660 Bacteria 2107
251 Ga0495672_0045175 3300047320 Bacteria 2638
252 Ga0495687_070171 3300047443 Bacteria 1408
253 Ga0495686_0000454 3300047472 Bacteria 61738
254 Ga0495686_0000748 3300047472 Bacteria 43100
255 Ga0495686_0032896 3300047472 Bacteria 3352
256 Ga0496115_0294272 3300048918 Bacteria 1331
257 Ga0496121_0000043 3300048924 Bacteria 341882
258 Ga0495682_0017257 3300049460 Bacteria 2727
259 Ga0501043_0208300 3300049579 Bacteria 1516
260 Ga0501047_0075397 3300049581 Bacteria 3246
261 Ga0501047_0134042 3300049581 Bacteria 2357
262 Ga0501223_000353 3300049663 Bacteria 11314
263 Ga0501225_0000315 3300049705 Bacteria 15102
264 Ga0501241_002936 3300049758 Bacteria 3266
265 Ga0501035_0351964 3300049822 Bacteria 1232
266 Ga0501044_0010027 3300049823 Bacteria 10294
267 nmdc:mga0k408_222270_c1 3300050493 Bacteria 1127
268 nmdc:mga0k408_511_c1 3300050493 Bacteria 21337
269 nmdc:mga07m45_91775_c1 3300050496 Bacteria 1740
270 nmdc:mga05p37_3508_c1 3300050507 Bacteria 18329
271 Ga0500578_0000017 3300053086 Bacteria 178494
272 Ga0500578_0056924 3300053086 Bacteria 2500
273 Ga0500644_0000332 3300053088 Bacteria 24138
274 Ga0500646_0022652 3300053090 Bacteria 1681
275 Ga0500583_0000139 3300053092 Bacteria 30587
276 Ga0500583_0006314 3300053092 Bacteria 4065
277 Ga0500583_0026295 3300053092 Bacteria 2497
278 Ga0500651_0000202 3300053093 Bacteria 37847
279 Ga0500651_0197258 3300053093 Unclassified 1189
280 Ga0500569_000892 3300053109 Bacteria 5328
281 Ga0500607_053192 3300053121 Bacteria 2147
282 Ga0500618_000061 3300053125 Bacteria 96180
283 Ga0500652_110408 3300053131 Bacteria 1149
284 Ga0500658_0006478 3300053134 Bacteria 4341
285 Ga0500658_0122498 3300053134 Bacteria 1154
286 Ga0500568_0051529 3300053139 Bacteria 1619
287 Ga0500577_0000782 3300053142 Bacteria 8190
288 Ga0500589_003640 3300053147 Bacteria 5605
289 Ga0500616_0000004 3300053153 Bacteria 1002714
290 Ga0500616_0018085 3300053153 Bacteria 3988
291 Ga0500622_0056125 3300053156 Bacteria 2016
292 Ga0500636_0011690 3300053177 Bacteria 5139
293 Ga0500611_000072 3300053727 Bacteria 41204
294 Ga0500645_054977 3300053730 Bacteria 1157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100681427 Ga0068859_1006814271 230
2 3300006931 Ga0097620_100681523 Ga0097620_1006815231 230
3 3300013296 Ga0157374_10324975 Ga0157374_103249752 239
4 3300031507 Ga0307509_10203885 Ga0307509_102038852 239
5 3300053086 Ga0500578_0056924 Ga0500578_0056924_1344_2144 239
6 iso_pu_bacteria 2929239360 2929244143 253
7 iso_pu_bacteria 8003151029 8003157700 253
8 3300013296 Ga0157374_10253944 Ga0157374_102539441 254
9 iso_pu_bacteria 2818991460 2819679962 254
10 3300003761 Ga0055535_1006809 Ga0055535_10068092 255
11 3300005577 Ga0068857_100109824 Ga0068857_1001098243 255
12 3300005614 Ga0068856_100012396 Ga0068856_1000123967 255
13 3300010375 Ga0105239_10015056 Ga0105239_100150566 255
14 3300025242 Ga0209258_100036 Ga0209258_100036285 255
15 3300025254 Ga0209148_1000139 Ga0209148_100013911 255
16 3300026116 Ga0207674_10062838 Ga0207674_100628381 255
17 3300044656 Ga0466969_0000050 Ga0466969_0000050_15101_15934 255
18 3300044684 Ga0466966_0004558 Ga0466966_0004558_6195_7028 255
19 3300044693 Ga0466961_0344799 Ga0466961_0344799_37_870 255
20 3300044735 Ga0466968_0035523 Ga0466968_0035523_477_1310 255
21 3300045049 Ga0466959_0000034 Ga0466959_0000034_64508_65341 255
22 3300048918 Ga0496115_0294272 Ga0496115_0294272_327_1124 255
23 3300053088 Ga0500644_0000332 Ga0500644_0000332_1130_1948 255
24 3300053090 Ga0500646_0022652 Ga0500646_0022652_291_1112 255
25 3300053092 Ga0500583_0026295 Ga0500583_0026295_785_1603 255
26 3300053093 Ga0500651_0197258 Ga0500651_0197258_258_1079 255
27 3300053109 Ga0500569_000892 Ga0500569_000892_2087_2908 255
28 3300053121 Ga0500607_053192 Ga0500607_053192_161_979 255
29 3300053134 Ga0500658_0006478 Ga0500658_0006478_1863_2684 255
30 3300053142 Ga0500577_0000782 Ga0500577_0000782_566_1387 255
31 3300053153 Ga0500616_0018085 Ga0500616_0018085_267_1088 255
32 3300053177 Ga0500636_0011690 Ga0500636_0011690_1700_2518 255
33 iso_pu_bacteria 2839989709 2839991024 255
34 3300041997 Ga0439431_0001090 Ga0439431_0001090_1502_2332 256
35 3300042004 Ga0439445_0006705 Ga0439445_0006705_514_1344 256
36 3300001979 JGI24740J21852_10005923 JGI24740J21852_100059235 257
37 3300002738 JGI25154J39366_1000080 JGI25154J39366_100008064 257
38 3300003215 JGI25153J46596_10010738 JGI25153J46596_100107384 257
39 3300005262 Ga0065165_1027777 Ga0065165_10277773 257
40 3300005471 Ga0070698_100314849 Ga0070698_1003148491 257
41 3300005614 Ga0068856_100012073 Ga0068856_1000120736 257
42 3300009093 Ga0105240_10004108 Ga0105240_100041089 257
43 3300009093 Ga0105240_10043975 Ga0105240_100439755 257
44 3300009093 Ga0105240_10184933 Ga0105240_101849333 257
45 3300009174 Ga0105241_10067515 Ga0105241_100675152 257
46 3300009545 Ga0105237_10011481 Ga0105237_100114818 257
47 3300009551 Ga0105238_10058338 Ga0105238_100583383 257
48 3300010375 Ga0105239_10001032 Ga0105239_1000103226 257
49 3300010375 Ga0105239_10010888 Ga0105239_100108886 257
50 3300025246 Ga0209646_1000091 Ga0209646_10000912 257
51 3300025250 Ga0209026_1000466 Ga0209026_10004667 257
52 3300025297 Ga0209758_1004063 Ga0209758_10040632 257
53 3300025302 Ga0207426_1000251 Ga0207426_100025155 257
54 3300025914 Ga0207671_10017162 Ga0207671_100171626 257
55 3300025937 Ga0207669_10202791 Ga0207669_102027912 257
56 3300026041 Ga0207639_10220954 Ga0207639_102209542 257
57 3300026078 Ga0207702_10030201 Ga0207702_100302014 257
58 3300026116 Ga0207674_10057736 Ga0207674_100577362 257
59 3300026116 Ga0207674_10108655 Ga0207674_101086553 257
60 3300041404 Ga0439436_0017383 Ga0439436_0017383_368_1222 257
61 3300041512 Ga0451853_2388852 Ga0451853_2388852_46_900 257
62 3300041512 Ga0451853_3622070 Ga0451853_3622070_629_1483 257
63 3300042014 Ga0439457_009194 Ga0439457_009194_1157_2011 257
64 3300044842 Ga0466957_0016656 Ga0466957_0016656_2225_3079 257
65 3300046462 Ga0495651_0272358 Ga0495651_0272358_26_862 257
66 3300046529 Ga0495652_0423091 Ga0495652_0423091_25_861 257
67 3300047472 Ga0495686_0032896 Ga0495686_0032896_2399_3235 257
68 3300049579 Ga0501043_0208300 Ga0501043_0208300_144_998 257
69 3300049581 Ga0501047_0075397 Ga0501047_0075397_997_1851 257
70 3300049581 Ga0501047_0134042 Ga0501047_0134042_1471_2262 257
71 3300049705 Ga0501225_0000315 Ga0501225_0000315_390_1244 257
72 3300049822 Ga0501035_0351964 Ga0501035_0351964_124_915 257
73 3300049823 Ga0501044_0010027 Ga0501044_0010027_6161_7015 257
74 3300053086 Ga0500578_0000017 Ga0500578_0000017_32547_33401 257
75 3300053092 Ga0500583_0006314 Ga0500583_0006314_1838_2692 257
76 3300053131 Ga0500652_110408 Ga0500652_110408_141_923 257
77 3300053134 Ga0500658_0122498 Ga0500658_0122498_31_885 257
78 3300053139 Ga0500568_0051529 Ga0500568_0051529_611_1393 257
79 3300053147 Ga0500589_003640 Ga0500589_003640_3072_3926 257
80 3300053156 Ga0500622_0056125 Ga0500622_0056125_862_1716 257
81 3300025208 Ga0209436_103456 Ga0209436_1034564 258
82 3300025284 Ga0209130_1002864 Ga0209130_10028645 258
83 3300025302 Ga0207426_1000234 Ga0207426_100023440 258
84 3300025914 Ga0207671_10024009 Ga0207671_100240091 258
85 3300025949 Ga0207667_10024059 Ga0207667_100240595 258
86 3300026078 Ga0207702_10261530 Ga0207702_102615301 258
87 3300050507 nmdc:mga05p37_3508_c1 nmdc:mga05p37_3508_c1_7494_8363 258
88 3300001989 JGI24739J22299_10005969 JGI24739J22299_100059695 259
89 3300002741 JGI25157J39369_1008278 JGI25157J39369_10082782 259
90 3300002772 JGI25164J39214_1002355 JGI25164J39214_10023551 259
91 3300003203 JGI25406J46586_10001359 JGI25406J46586_100013597 259
92 3300003214 JGI25165J46597_1001347 JGI25165J46597_10013473 259
93 3300003215 JGI25153J46596_10073243 JGI25153J46596_100732431 259
94 3300003320 rootH2_10077389 rootH2_100773891 259
95 3300003322 rootL2_10032084 rootL2_100320843 259
96 3300003354 JGI25160J50197_1034595 JGI25160J50197_10345952 259
97 3300003354 JGI25160J50197_1044919 JGI25160J50197_10449191 259
98 3300003771 Ga0055526_1004966 Ga0055526_10049664 259
99 3300003771 Ga0055526_1013443 Ga0055526_10134431 259
100 3300003790 Ga0055528_1000595 Ga0055528_100059519 259
101 3300003791 Ga0055530_10002678 Ga0055530_100026785 259
102 3300005262 Ga0065165_1000280 Ga0065165_100028068 259
103 3300005329 Ga0070683_100006169 Ga0070683_1000061693 259
104 3300005329 Ga0070683_100093068 Ga0070683_1000930682 259
105 3300005330 Ga0070690_100090947 Ga0070690_1000909472 259
106 3300005331 Ga0070670_100093101 Ga0070670_1000931012 259
107 3300005334 Ga0068869_100174702 Ga0068869_1001747022 259
108 3300005335 Ga0070666_10282197 Ga0070666_102821971 259
109 3300005338 Ga0068868_100061812 Ga0068868_1000618121 259
110 3300005340 Ga0070689_100628269 Ga0070689_1006282691 259
111 3300005344 Ga0070661_100082729 Ga0070661_1000827293 259
112 3300005344 Ga0070661_100178759 Ga0070661_1001787591 259
113 3300005355 Ga0070671_100101711 Ga0070671_1001017113 259
114 3300005355 Ga0070671_100230607 Ga0070671_1002306072 259
115 3300005364 Ga0070673_100273345 Ga0070673_1002733451 259
116 3300005441 Ga0070700_100132970 Ga0070700_1001329701 259
117 3300005455 Ga0070663_100004419 Ga0070663_1000044196 259
118 3300005458 Ga0070681_10216129 Ga0070681_102161292 259
119 3300005535 Ga0070684_100009465 Ga0070684_10000946511 259
120 3300005535 Ga0070684_100016346 Ga0070684_1000163462 259
121 3300005548 Ga0070665_100000845 Ga0070665_1000008458 259
122 3300005563 Ga0068855_100000302 Ga0068855_10000030237 259
123 3300005564 Ga0070664_100002232 Ga0070664_10000223210 259
124 3300005614 Ga0068856_100343349 Ga0068856_1003433491 259
125 3300005615 Ga0070702_100024761 Ga0070702_1000247613 259
126 3300005615 Ga0070702_100273072 Ga0070702_1002730722 259
127 3300005616 Ga0068852_100195694 Ga0068852_1001956941 259
128 3300005719 Ga0068861_100084708 Ga0068861_1000847082 259
129 3300005719 Ga0068861_100429148 Ga0068861_1004291482 259
130 3300005842 Ga0068858_100128227 Ga0068858_1001282273 259
131 3300005843 Ga0068860_100474379 Ga0068860_1004743792 259
132 3300005985 Ga0081539_10000037 Ga0081539_10000037261 259
133 3300009093 Ga0105240_10000010 Ga0105240_1000001073 259
134 3300009093 Ga0105240_10069569 Ga0105240_100695693 259
135 3300009174 Ga0105241_10007402 Ga0105241_100074024 259
136 3300009174 Ga0105241_10067770 Ga0105241_100677702 259
137 3300009545 Ga0105237_10002429 Ga0105237_1000242911 259
138 3300009545 Ga0105237_10004724 Ga0105237_100047248 259
139 3300009545 Ga0105237_10045574 Ga0105237_100455743 259
140 3300009545 Ga0105237_10226546 Ga0105237_102265462 259
141 3300010375 Ga0105239_10019590 Ga0105239_100195904 259
142 3300010375 Ga0105239_10170620 Ga0105239_101706203 259
143 3300010375 Ga0105239_10382623 Ga0105239_103826232 259
144 3300013100 Ga0157373_10004120 Ga0157373_1000412010 259
145 3300013102 Ga0157371_10076220 Ga0157371_100762202 259
146 3300013102 Ga0157371_10094764 Ga0157371_100947642 259
147 3300013102 Ga0157371_10127870 Ga0157371_101278703 259
148 3300013296 Ga0157374_10104682 Ga0157374_101046821 259
149 3300013297 Ga0157378_10344666 Ga0157378_103446662 259
150 3300013306 Ga0163162_10011996 Ga0163162_1001199610 259
151 3300013307 Ga0157372_10007963 Ga0157372_1000796310 259
152 3300013307 Ga0157372_10103702 Ga0157372_101037021 259
153 3300013307 Ga0157372_10130046 Ga0157372_101300462 259
154 3300013307 Ga0157372_10500618 Ga0157372_105006182 259
155 3300014325 Ga0163163_10124766 Ga0163163_101247663 259
156 3300014745 Ga0157377_10005854 Ga0157377_100058544 259
157 3300014745 Ga0157377_10094326 Ga0157377_100943262 259
158 3300025231 Ga0207427_100159 Ga0207427_10015912 259
159 3300025233 Ga0209437_100021 Ga0209437_10002132 259
160 3300025250 Ga0209026_1001412 Ga0209026_10014122 259
161 3300025261 Ga0209233_1000264 Ga0209233_100026432 259
162 3300025273 Ga0209673_1000014 Ga0209673_1000014192 259
163 3300025273 Ga0209673_1000018 Ga0209673_1000018140 259
164 3300025291 Ga0209675_1028974 Ga0209675_10289742 259
165 3300025295 Ga0209564_1000465 Ga0209564_100046561 259
166 3300025295 Ga0209564_1002499 Ga0209564_100249915 259
167 3300025297 Ga0209758_1001032 Ga0209758_10010329 259
168 3300025297 Ga0209758_1027411 Ga0209758_10274112 259
169 3300025298 Ga0209050_1000177 Ga0209050_100017722 259
170 3300025298 Ga0209050_1002162 Ga0209050_100216214 259
171 3300025298 Ga0209050_1013311 Ga0209050_10133112 259
172 3300025302 Ga0207426_1000435 Ga0207426_100043565 259
173 3300025303 Ga0209051_1030337 Ga0209051_10303372 259
174 3300025304 Ga0209257_1002645 Ga0209257_10026455 259
175 3300025321 Ga0207656_10154736 Ga0207656_101547361 259
176 3300025901 Ga0207688_10101439 Ga0207688_101014392 259
177 3300025904 Ga0207647_10002941 Ga0207647_1000294114 259
178 3300025907 Ga0207645_10391925 Ga0207645_103919251 259
179 3300025909 Ga0207705_10282778 Ga0207705_102827782 259
180 3300025913 Ga0207695_10000019 Ga0207695_10000019378 259
181 3300025913 Ga0207695_10097611 Ga0207695_100976113 259
182 3300025914 Ga0207671_10000382 Ga0207671_100003823 259
183 3300025914 Ga0207671_10000598 Ga0207671_1000059846 259
184 3300025914 Ga0207671_10084846 Ga0207671_100848461 259
185 3300025920 Ga0207649_10160629 Ga0207649_101606292 259
186 3300025920 Ga0207649_10304310 Ga0207649_103043102 259
187 3300025925 Ga0207650_10192490 Ga0207650_101924902 259
188 3300025931 Ga0207644_10150560 Ga0207644_101505602 259
189 3300025936 Ga0207670_10448754 Ga0207670_104487541 259
190 3300025940 Ga0207691_10133987 Ga0207691_101339872 259
191 3300025944 Ga0207661_10004657 Ga0207661_1000465710 259
192 3300025945 Ga0207679_10010129 Ga0207679_1001012910 259
193 3300025949 Ga0207667_10005555 Ga0207667_100055556 259
194 3300026023 Ga0207677_10049654 Ga0207677_100496543 259
195 3300026041 Ga0207639_10047788 Ga0207639_100477882 259
196 3300026067 Ga0207678_10094349 Ga0207678_100943492 259
197 3300026142 Ga0207698_10155273 Ga0207698_101552732 259
198 3300026142 Ga0207698_10372222 Ga0207698_103722223 259
199 3300026142 Ga0207698_10565184 Ga0207698_105651842 259
200 3300028379 Ga0268266_10004662 Ga0268266_100046626 259
201 3300028381 Ga0268264_10463684 Ga0268264_104636842 259
202 3300030745 Ga0316182_1285095 Ga0316182_12850951 259
203 3300031251 Ga0265327_10051130 Ga0265327_100511301 259
204 3300031731 Ga0307405_10014964 Ga0307405_100149642 259
205 3300031852 Ga0307410_10109450 Ga0307410_101094502 259
206 3300032004 Ga0307414_10010924 Ga0307414_100109242 259
207 3300032004 Ga0307414_10400100 Ga0307414_104001001 259
208 3300037312 Ga0395899_0000002 Ga0395899_0000002_629187_629999 259
209 3300037312 Ga0395899_0157890 Ga0395899_0157890_224_1042 259
210 3300037418 Ga0395900_0374870 Ga0395900_0374870_42_878 259
211 3300037418 Ga0395900_0582952 Ga0395900_0582952_86_988 259
212 3300037471 Ga0395905_0000565 Ga0395905_0000565_17941_18777 259
213 3300037471 Ga0395905_0319212 Ga0395905_0319212_593_1417 259
214 3300038443 Ga0395901_0579173 Ga0395901_0579173_132_968 259
215 3300041413 Ga0439465_0012191 Ga0439465_0012191_448_1275 259
216 3300044656 Ga0466969_0087958 Ga0466969_0087958_105_938 259
217 3300044683 Ga0466965_0056730 Ga0466965_0056730_644_1438 259
218 3300044684 Ga0466966_0022052 Ga0466966_0022052_437_1270 259
219 3300044842 Ga0466957_0000137 Ga0466957_0000137_9900_10754 259
220 3300045049 Ga0466959_0066904 Ga0466959_0066904_185_1009 259
221 3300045049 Ga0466959_0154206 Ga0466959_0154206_639_1472 259
222 3300045836 Ga0466958_0111944 Ga0466958_0111944_499_1332 259
223 3300046460 Ga0495638_0000121 Ga0495638_0000121_19248_20078 259
224 3300046507 Ga0495606_0102704 Ga0495606_0102704_813_1649 259
225 3300046616 Ga0495668_0004316 Ga0495668_0004316_407_1261 259
226 3300047472 Ga0495686_0000748 Ga0495686_0000748_40278_41096 259
227 3300048924 Ga0496121_0000043 Ga0496121_0000043_321312_322124 259
228 3300049663 Ga0501223_000353 Ga0501223_000353_1594_2427 259
229 3300050493 nmdc:mga0k408_222270_c1 nmdc:mga0k408_222270_c1_243_1037 259
230 3300053153 Ga0500616_0000004 Ga0500616_0000004_635545_636375 259
231 3300053727 Ga0500611_000072 Ga0500611_000072_27790_28626 259
232 iso_pu_bacteria 2919437846 2919439164 259
233 3300047320 Ga0495672_0045175 Ga0495672_0045175_1087_2001 260
234 3300053092 Ga0500583_0000139 Ga0500583_0000139_27163_28065 260
235 3300005327 Ga0070658_10203456 Ga0070658_102034562 261
236 3300005458 Ga0070681_10011469 Ga0070681_100114698 261
237 3300005530 Ga0070679_100020757 Ga0070679_1000207577 261
238 3300009147 Ga0114129_10002041 Ga0114129_1000204116 261
239 3300013100 Ga0157373_10059117 Ga0157373_100591172 261
240 3300025909 Ga0207705_10391769 Ga0207705_103917691 261
241 3300025912 Ga0207707_10199308 Ga0207707_101993082 261
242 3300025917 Ga0207660_10075525 Ga0207660_100755252 261
243 3300025921 Ga0207652_10162049 Ga0207652_101620492 261
244 3300044765 Ga0466970_0000371 Ga0466970_0000371_16914_17759 261
245 3300044901 Ga0466960_0111342 Ga0466960_0111342_343_1188 261
246 iso_pu_bacteria 2738543023 2739303519 261
247 iso_pu_bacteria 2852627209 2852631587 261
248 iso_pu_bacteria 2919186247 2919190514 261
249 iso_pu_bacteria 2939664404 2939668795 261
250 3300003322 rootL2_10225494 rootL2_102254942 262
251 3300005366 Ga0070659_100003758 Ga0070659_10000375815 262
252 3300005563 Ga0068855_100295689 Ga0068855_1002956892 262
253 3300005616 Ga0068852_100000248 Ga0068852_10000024829 262
254 3300005834 Ga0068851_10153646 Ga0068851_101536461 262
255 3300013307 Ga0157372_10013931 Ga0157372_100139319 262
256 3300025904 Ga0207647_10000045 Ga0207647_1000004527 262
257 3300025932 Ga0207690_10001397 Ga0207690_1000139711 262
258 3300026142 Ga0207698_10010662 Ga0207698_100106622 262
259 3300031456 Ga0307513_10097703 Ga0307513_100977032 262
260 3300046492 Ga0495585_0001889 Ga0495585_0001889_14116_14913 262
261 3300046524 Ga0495648_0001649 Ga0495648_0001649_16847_17644 262
262 3300046557 Ga0495622_0063222 Ga0495622_0063222_726_1523 262
263 3300046660 Ga0495625_0001508 Ga0495625_0001508_1021_1818 262
264 3300049460 Ga0495682_0017257 Ga0495682_0017257_325_1122 262
265 iso_pu_bacteria 2738541284 2738762208 262
266 iso_pu_bacteria 2775506987 2776615169 262
267 3300003322 rootL2_10155532 rootL2_101555323 263
268 3300009545 Ga0105237_10077429 Ga0105237_100774291 263
269 3300010375 Ga0105239_10000679 Ga0105239_100006792 263
270 3300010375 Ga0105239_10002322 Ga0105239_1000232215 263
271 3300025233 Ga0209437_100041 Ga0209437_10004192 263
272 3300025914 Ga0207671_10004874 Ga0207671_1000487410 263
273 3300028794 Ga0307515_10000223 Ga0307515_1000022374 263
274 3300033179 Ga0307507_10000010 Ga0307507_10000010156 263
275 3300046524 Ga0495648_0029041 Ga0495648_0029041_955_1773 263
276 3300046538 Ga0495609_0005985 Ga0495609_0005985_463_1281 263
277 3300046558 Ga0495633_0000081 Ga0495633_0000081_93398_94216 263
278 3300046616 Ga0495668_0000003 Ga0495668_0000003_404278_405096 263
279 3300047443 Ga0495687_070171 Ga0495687_070171_522_1340 263
280 3300050493 nmdc:mga0k408_511_c1 nmdc:mga0k408_511_c1_12649_13464 263
281 3300050496 nmdc:mga07m45_91775_c1 nmdc:mga07m45_91775_c1_895_1710 263
282 3300053125 Ga0500618_000061 Ga0500618_000061_82357_83175 263
283 3300053730 Ga0500645_054977 Ga0500645_054977_224_1138 263
284 3300005288 Ga0065714_10007419 Ga0065714_100074195 265
285 3300013104 Ga0157370_10129146 Ga0157370_101291464 265
286 3300030744 Ga0316181_1067118 Ga0316181_10671181 265
287 3300032004 Ga0307414_10007128 Ga0307414_100071286 265
288 3300032005 Ga0307411_10460455 Ga0307411_104604552 265
289 2162886007 SwRhRL2b_contig_830297 SwRhRL2b_0119.00006050 266
290 3300003323 rootH1_10099612 rootH1_1009961210 266
291 3300005288 Ga0065714_10002355 Ga0065714_1000235512 266
292 3300005288 Ga0065714_10003298 Ga0065714_100032985 266
293 3300005289 Ga0065704_10070217 Ga0065704_1007021770 266
294 3300005289 Ga0065704_10078365 Ga0065704_100783654 266
295 3300013100 Ga0157373_10000440 Ga0157373_100004402 266
296 3300013102 Ga0157371_10002650 Ga0157371_1000265018 266
297 3300013102 Ga0157371_10026681 Ga0157371_100266815 266
298 3300013104 Ga0157370_10027681 Ga0157370_100276816 266
299 3300014497 Ga0182008_10000034 Ga0182008_10000034111 266
300 3300031911 Ga0307412_10000049 Ga0307412_1000004990 266
301 3300032004 Ga0307414_10000142 Ga0307414_1000014219 266
302 3300046660 Ga0495625_0091117 Ga0495625_0091117_914_1771 266
303 3300047472 Ga0495686_0000454 Ga0495686_0000454_24878_25732 266
304 3300049758 Ga0501241_002936 Ga0501241_002936_1212_2012 266
305 3300053093 Ga0500651_0000202 Ga0500651_0000202_23208_24008 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

41

158

0.92

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

55

246

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dqh-assembly1.cif.gz_A cronobacter sakazakii (enterobacter sakazakii) metallo-beta-lactamse harldq motif 0.8225 11 144
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.81 4 255
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8072 4 255
1qh5-assembly1.cif.gz_B human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione 0.802 8 145
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8011 4 255
ID Description Score Start End Superfamily
af_Q2G2U5_10_248_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9566 11 239 3.60.15.10
af_Q2G2U5_10_248_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9139 11 239 3.60.15.10
af_I1ML74_165_350_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8168 53 153 3.60.15.10
af_Q58271_3_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8149 9 146 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8123 8 145 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A352F8W2-F1-model_v4 MBL fold metallo-hydrolase 0.9974 5 256 GO:0016787
AF-A0A3B1CPK8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9951 6 84
AF-A0A4R8DFF8-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphodiesterase 0.9938 5 256
AF-A0A562UCG9-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphodiesterase 0.9915 4 266
AF-A0A349QVM8-F1-model_v4 MBL fold metallo-hydrolase 0.9908 7 254 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.27 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map