F397975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 254 | 299 | 87 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100235070|Ga0070713_1002350703 |
| Length | 101 |
| Sequence | MAHKKGGGSSTNGRDSQGQRLGVKRFGGQLVTSGSILIRQRGTHYKAGKNVGRAKDDSLFARMDGVVLFEDKGGKGRFISVLSPAEHASRYEKVSSAPAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 4 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 5 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 6 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 7 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 8 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 46 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 47 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 48 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 72 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 99 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 104 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 111 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 123 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 124 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 125 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 131 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 132 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 133 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 134 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 137 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 138 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 142 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 143 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 144 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 149 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 151 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 152 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 153 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 154 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 155 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 156 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 157 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 158 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 159 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 160 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 161 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 162 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 163 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 164 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 165 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 166 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 167 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 168 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 169 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 193 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 194 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 207 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 228 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 229 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 230 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 231 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 232 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 234 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 235 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 236 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 237 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 238 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 239 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 240 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 241 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 244 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 250 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 251 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 253 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 254 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.57 |
| Metatranscriptomes | 12.46 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.57 |
| Nodule | 0.66 |
| Rhizoplane | 5.25 |
| Rhizosphere | 83.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1616504 | 2162886007 | Bacteria | 1186 |
| 2 | SwRhRL2b_contig_37466 | 2162886007 | Bacteria | 1075 |
| 3 | Ga0007417J51691_1041049 | 3300003544 | Bacteria | 751 |
| 4 | Ga0055530_10092352 | 3300003791 | Bacteria | 618 |
| 5 | Ga0055540_1050213 | 3300003792 | Bacteria | 863 |
| 6 | Ga0055531_10000500 | 3300003794 | Bacteria | 35897 |
| 7 | Ga0058863_11528505 | 3300004799 | Viruses | 710 |
| 8 | Ga0058861_11957894 | 3300004800 | Bacteria | 946 |
| 9 | Ga0058862_11853061 | 3300004803 | Viruses | 723 |
| 10 | Ga0058862_12441055 | 3300004803 | Bacteria | 987 |
| 11 | Ga0065704_10041388 | 3300005289 | Bacteria | 789 |
| 12 | Ga0065704_10117241 | 3300005289 | Bacteria | 1834 |
| 13 | Ga0070670_100992313 | 3300005331 | Bacteria | 763 |
| 14 | Ga0070666_10699993 | 3300005335 | Bacteria | 743 |
| 15 | Ga0070680_101407062 | 3300005336 | Viruses | 604 |
| 16 | Ga0068868_100250372 | 3300005338 | Bacteria | 1491 |
| 17 | Ga0070660_101144957 | 3300005339 | Bacteria | 659 |
| 18 | Ga0070687_100301947 | 3300005343 | Bacteria | 1016 |
| 19 | Ga0070675_101129783 | 3300005354 | Bacteria | 721 |
| 20 | Ga0070674_100057937 | 3300005356 | Bacteria | 2691 |
| 21 | Ga0070673_101281203 | 3300005364 | Bacteria | 688 |
| 22 | Ga0070659_101996429 | 3300005366 | Bacteria | 521 |
| 23 | Ga0070713_100235070 | 3300005436 | Bacteria | 1667 |
| 24 | Ga0070701_10153363 | 3300005438 | Bacteria | 1328 |
| 25 | Ga0070708_100068257 | 3300005445 | Bacteria | 3195 |
| 26 | Ga0070708_101933644 | 3300005445 | Bacteria | 547 |
| 27 | Ga0070708_102081283 | 3300005445 | Bacteria | 525 |
| 28 | Ga0070678_100881928 | 3300005456 | Bacteria | 817 |
| 29 | Ga0070681_10464168 | 3300005458 | Viruses | 1179 |
| 30 | Ga0070706_100649475 | 3300005467 | Bacteria | 979 |
| 31 | Ga0070707_100866308 | 3300005468 | Bacteria | 868 |
| 32 | Ga0070699_100275092 | 3300005518 | Bacteria | 1508 |
| 33 | Ga0070699_100547113 | 3300005518 | Bacteria | 1053 |
| 34 | Ga0070697_100283534 | 3300005536 | Bacteria | 1422 |
| 35 | Ga0070697_100778544 | 3300005536 | Unclassified | 846 |
| 36 | Ga0070695_101408308 | 3300005545 | Unclassified | 578 |
| 37 | Ga0070693_100501830 | 3300005547 | Bacteria | 861 |
| 38 | Ga0070665_101124563 | 3300005548 | Bacteria | 797 |
| 39 | Ga0070664_100652607 | 3300005564 | Bacteria | 978 |
| 40 | Ga0068866_10024434 | 3300005718 | Bacteria | 2826 |
| 41 | Ga0068863_101304606 | 3300005841 | Bacteria | 733 |
| 42 | Ga0068860_100861348 | 3300005843 | Bacteria | 921 |
| 43 | Ga0068862_100787052 | 3300005844 | Bacteria | 928 |
| 44 | Ga0075366_10107738 | 3300006195 | Bacteria | 1675 |
| 45 | Ga0075433_11189463 | 3300006852 | Bacteria | 662 |
| 46 | Ga0068865_100282545 | 3300006881 | Bacteria | 1322 |
| 47 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 48 | Ga0099794_10062561 | 3300007265 | Bacteria | 1810 |
| 49 | Ga0099794_10076960 | 3300007265 | Bacteria | 1641 |
| 50 | Ga0099794_10177254 | 3300007265 | Bacteria | 1087 |
| 51 | Ga0105250_10001192 | 3300009092 | Bacteria | 14517 |
| 52 | Ga0105240_10011302 | 3300009093 | Bacteria | 12439 |
| 53 | Ga0111539_13453028 | 3300009094 | Bacteria | 508 |
| 54 | Ga0105245_10103773 | 3300009098 | Bacteria | 2635 |
| 55 | Ga0105243_10002600 | 3300009148 | Bacteria | 15051 |
| 56 | Ga0105241_10230366 | 3300009174 | Bacteria | 1561 |
| 57 | Ga0105242_12689804 | 3300009176 | Bacteria | 547 |
| 58 | Ga0105237_10004245 | 3300009545 | Bacteria | 16680 |
| 59 | Ga0105249_13508913 | 3300009553 | Bacteria | 505 |
| 60 | Ga0099796_10192390 | 3300010159 | Bacteria | 824 |
| 61 | Ga0105239_10417172 | 3300010375 | Bacteria | 1520 |
| 62 | Ga0105246_11118836 | 3300011119 | Bacteria | 720 |
| 63 | Ga0157371_10601419 | 3300013102 | Bacteria | 818 |
| 64 | Ga0157370_10730523 | 3300013104 | Bacteria | 903 |
| 65 | Ga0157378_10152966 | 3300013297 | Bacteria | 2151 |
| 66 | Ga0157378_10167039 | 3300013297 | Bacteria | 2062 |
| 67 | Ga0163162_10426021 | 3300013306 | Bacteria | 1459 |
| 68 | Ga0163162_10903500 | 3300013306 | Bacteria | 996 |
| 69 | Ga0157375_10044060 | 3300013308 | Bacteria | 4331 |
| 70 | Ga0157375_10188136 | 3300013308 | Bacteria | 2219 |
| 71 | Ga0163163_10022210 | 3300014325 | Bacteria | 6004 |
| 72 | Ga0163163_10732562 | 3300014325 | Bacteria | 1052 |
| 73 | Ga0163163_11065845 | 3300014325 | Bacteria | 871 |
| 74 | Ga0157380_10328721 | 3300014326 | Bacteria | 1421 |
| 75 | Ga0157376_10052430 | 3300014969 | Bacteria | 3392 |
| 76 | Ga0157376_12666545 | 3300014969 | Bacteria | 540 |
| 77 | Ga0163161_10077396 | 3300017792 | Bacteria | 2443 |
| 78 | Ga0206356_11405752 | 3300020070 | Viruses | 906 |
| 79 | Ga0206352_10989137 | 3300020078 | Bacteria | 942 |
| 80 | Ga0213872_10126370 | 3300021361 | Bacteria | 1128 |
| 81 | Ga0228598_1064083 | 3300024227 | Unclassified | 733 |
| 82 | Ga0209050_1001301 | 3300025298 | Bacteria | 28152 |
| 83 | Ga0209051_1044141 | 3300025303 | Bacteria | 1556 |
| 84 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 85 | Ga0209257_1143970 | 3300025304 | Bacteria | 532 |
| 86 | Ga0207696_1001691 | 3300025711 | Bacteria | 11466 |
| 87 | Ga0207684_10886966 | 3300025910 | Bacteria | 750 |
| 88 | Ga0207707_10470902 | 3300025912 | Viruses | 1074 |
| 89 | Ga0207695_10004215 | 3300025913 | Bacteria | 19760 |
| 90 | Ga0207671_10160951 | 3300025914 | Viruses | 1738 |
| 91 | Ga0207657_11019487 | 3300025919 | Bacteria | 635 |
| 92 | Ga0207652_10337278 | 3300025921 | Viruses | 1361 |
| 93 | Ga0207681_11580133 | 3300025923 | Bacteria | 549 |
| 94 | Ga0207650_10263018 | 3300025925 | Bacteria | 1400 |
| 95 | Ga0207659_10581825 | 3300025926 | Bacteria | 953 |
| 96 | Ga0207687_10066964 | 3300025927 | Bacteria | 2553 |
| 97 | Ga0207700_11290357 | 3300025928 | Unclassified | 651 |
| 98 | Ga0207709_10000111 | 3300025935 | Bacteria | 127580 |
| 99 | Ga0207709_11386355 | 3300025935 | Bacteria | 582 |
| 100 | Ga0207670_11664635 | 3300025936 | Unclassified | 543 |
| 101 | Ga0207669_10063132 | 3300025937 | Bacteria | 2285 |
| 102 | Ga0207704_10654241 | 3300025938 | Bacteria | 866 |
| 103 | Ga0207677_11063187 | 3300026023 | Bacteria | 736 |
| 104 | Ga0207639_11468345 | 3300026041 | Bacteria | 640 |
| 105 | Ga0207702_10560276 | 3300026078 | Bacteria | 1118 |
| 106 | Ga0207641_11298766 | 3300026088 | Bacteria | 728 |
| 107 | Ga0207674_10014017 | 3300026116 | Bacteria | 8859 |
| 108 | Ga0207683_10755550 | 3300026121 | Bacteria | 902 |
| 109 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 110 | Ga0209588_1001135 | 3300027671 | Bacteria | 6854 |
| 111 | Ga0268266_10550823 | 3300028379 | Bacteria | 1105 |
| 112 | Ga0268265_10348791 | 3300028380 | Bacteria | 1351 |
| 113 | Ga0265319_1062375 | 3300028563 | Bacteria | 1207 |
| 114 | Ga0307515_10016568 | 3300028794 | Bacteria | 13488 |
| 115 | Ga0307515_10070822 | 3300028794 | Bacteria | 4738 |
| 116 | Ga0265338_10033189 | 3300028800 | Bacteria | 5015 |
| 117 | Ga0265762_1048314 | 3300030760 | Unclassified | 848 |
| 118 | Ga0265760_10083015 | 3300031090 | Bacteria | 994 |
| 119 | Ga0265760_10258923 | 3300031090 | Unclassified | 605 |
| 120 | Ga0265325_10083964 | 3300031241 | Unclassified | 1579 |
| 121 | Ga0265331_10434164 | 3300031250 | Bacteria | 590 |
| 122 | Ga0265327_10012557 | 3300031251 | Bacteria | 5702 |
| 123 | Ga0265316_10370395 | 3300031344 | Bacteria | 1035 |
| 124 | Ga0316579_10128751 | 3300031691 | Bacteria | 1219 |
| 125 | Ga0265314_10364511 | 3300031711 | Bacteria | 791 |
| 126 | Ga0316578_10186210 | 3300031728 | Unclassified | 1251 |
| 127 | Ga0307405_10173496 | 3300031731 | Bacteria | 1540 |
| 128 | Ga0316577_10143904 | 3300031733 | Bacteria | 1343 |
| 129 | Ga0307413_10609019 | 3300031824 | Bacteria | 895 |
| 130 | Ga0307410_10478600 | 3300031852 | Bacteria | 1021 |
| 131 | Ga0307410_10627174 | 3300031852 | Bacteria | 899 |
| 132 | Ga0307410_11975304 | 3300031852 | Bacteria | 520 |
| 133 | Ga0307406_10172895 | 3300031901 | Bacteria | 1565 |
| 134 | Ga0307407_10415712 | 3300031903 | Bacteria | 968 |
| 135 | Ga0307409_100242668 | 3300031995 | Bacteria | 1641 |
| 136 | Ga0307409_102079147 | 3300031995 | Bacteria | 598 |
| 137 | Ga0307409_102746827 | 3300031995 | Bacteria | 520 |
| 138 | Ga0307416_101134350 | 3300032002 | Bacteria | 887 |
| 139 | Ga0307414_10202034 | 3300032004 | Bacteria | 1617 |
| 140 | Ga0307414_10922542 | 3300032004 | Bacteria | 801 |
| 141 | Ga0307411_10094050 | 3300032005 | Bacteria | 2100 |
| 142 | Ga0307411_10789251 | 3300032005 | Bacteria | 835 |
| 143 | Ga0307415_100113492 | 3300032126 | Bacteria | 2015 |
| 144 | Ga0316593_10018037 | 3300032168 | Bacteria | 2163 |
| 145 | Ga0316593_10062408 | 3300032168 | Bacteria | 1276 |
| 146 | Ga0316596_1149608 | 3300033541 | Bacteria | 641 |
| 147 | Ga0373948_0017442 | 3300034817 | Bacteria | 1338 |
| 148 | Ga0373928_0249119 | 3300035084 | Bacteria | 529 |
| 149 | Ga0373934_0175752 | 3300035086 | Unclassified | 879 |
| 150 | Ga0373952_0060529 | 3300035092 | Bacteria | 925 |
| 151 | Ga0373936_0278820 | 3300035113 | Bacteria | 751 |
| 152 | Ga0373956_0010970 | 3300035119 | Bacteria | 3729 |
| 153 | Ga0373957_0028076 | 3300035120 | Bacteria | 2048 |
| 154 | Ga0373955_0190796 | 3300035172 | Unclassified | 1218 |
| 155 | Ga0373931_0504334 | 3300035691 | Bacteria | 781 |
| 156 | Ga0373931_1230018 | 3300035691 | Bacteria | 513 |
| 157 | Ga0373927_0081090 | 3300035695 | Bacteria | 2103 |
| 158 | Ga0373933_0000034 | 3300035724 | Bacteria | 83243 |
| 159 | Ga0373933_0392313 | 3300035724 | Bacteria | 905 |
| 160 | Ga0373933_0700748 | 3300035724 | Bacteria | 666 |
| 161 | Ga0373947_0771883 | 3300035725 | Unclassified | 656 |
| 162 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 163 | Ga0373937_0223132 | 3300036401 | Bacteria | 1774 |
| 164 | Ga0373925_1228126 | 3300037068 | Bacteria | 616 |
| 165 | Ga0436361_0796155 | 3300039447 | Bacteria | 8850 |
| 166 | Ga0439461_0010810 | 3300041410 | Bacteria | 1683 |
| 167 | Ga0451794_48726 | 3300041446 | Bacteria | 666 |
| 168 | Ga0451791_0860348 | 3300041451 | Bacteria | 536 |
| 169 | Ga0451797_1587335 | 3300041453 | Bacteria | 1089 |
| 170 | Ga0451795_1097443 | 3300041456 | Bacteria | 589 |
| 171 | Ga0451800_0771616 | 3300041459 | Bacteria | 545 |
| 172 | Ga0451805_055637 | 3300041461 | Bacteria | 538 |
| 173 | Ga0451804_0153612 | 3300041463 | Bacteria | 900 |
| 174 | Ga0451849_0418868 | 3300041505 | Bacteria | 1006 |
| 175 | Ga0451855_1465734 | 3300041511 | Bacteria | 742 |
| 176 | Ga0451853_0597047 | 3300041512 | Bacteria | 1019 |
| 177 | Ga0439437_000955 | 3300042000 | Bacteria | 3011 |
| 178 | Ga0439445_0056112 | 3300042004 | Bacteria | 1071 |
| 179 | Ga0450911_000084 | 3300042115 | Bacteria | 37818 |
| 180 | Ga0450912_003447 | 3300042116 | Bacteria | 1126 |
| 181 | Ga0450917_000101 | 3300042120 | Bacteria | 5224 |
| 182 | Ga0450922_028653 | 3300042124 | Bacteria | 600 |
| 183 | Ga0450888_000038 | 3300042126 | Bacteria | 9334 |
| 184 | Ga0450890_001097 | 3300042127 | Bacteria | 3945 |
| 185 | Ga0450891_000246 | 3300042129 | Bacteria | 5494 |
| 186 | Ga0450892_000862 | 3300042130 | Bacteria | 3303 |
| 187 | Ga0450902_076547 | 3300042137 | Bacteria | 586 |
| 188 | Ga0450889_000093 | 3300042144 | Bacteria | 8414 |
| 189 | Ga0439444_0203110 | 3300042437 | Bacteria | 501 |
| 190 | Ga0450916_019177 | 3300042530 | Bacteria | 927 |
| 191 | Ga0450893_0003312 | 3300042532 | Bacteria | 2534 |
| 192 | Ga0451577_0567837 | 3300042876 | Bacteria | 1030 |
| 193 | Ga0451577_0602671 | 3300042876 | Bacteria | 997 |
| 194 | Ga0453683_0212095 | 3300044673 | Bacteria | 1230 |
| 195 | Ga0453684_0810033 | 3300044712 | Bacteria | 1009 |
| 196 | Ga0453684_0812199 | 3300044712 | Bacteria | 1008 |
| 197 | Ga0451576_0009538 | 3300045051 | Bacteria | 11245 |
| 198 | Ga0451576_0181581 | 3300045051 | Bacteria | 2197 |
| 199 | Ga0451576_0228760 | 3300045051 | Bacteria | 1942 |
| 200 | Ga0451576_0441129 | 3300045051 | Bacteria | 1366 |
| 201 | Ga0451576_0949953 | 3300045051 | Bacteria | 901 |
| 202 | Ga0451576_2020924 | 3300045051 | Bacteria | 594 |
| 203 | Ga0495651_0005814 | 3300046462 | Bacteria | 9411 |
| 204 | Ga0495653_0115206 | 3300046463 | Bacteria | 1924 |
| 205 | Ga0495653_0225666 | 3300046463 | Bacteria | 1257 |
| 206 | Ga0495580_0499769 | 3300046472 | Bacteria | 812 |
| 207 | Ga0495580_0847901 | 3300046472 | Bacteria | 590 |
| 208 | Ga0495608_0554910 | 3300046511 | Unclassified | 692 |
| 209 | Ga0495628_0419215 | 3300046516 | Bacteria | 976 |
| 210 | Ga0495652_0039918 | 3300046529 | Bacteria | 4057 |
| 211 | Ga0495587_0000912 | 3300046536 | Bacteria | 19527 |
| 212 | Ga0495645_0141760 | 3300046543 | Bacteria | 1676 |
| 213 | Ga0495657_0448915 | 3300046675 | Bacteria | 755 |
| 214 | Ga0495599_0905066 | 3300046678 | Unclassified | 500 |
| 215 | Ga0495623_0030174 | 3300046679 | Bacteria | 3488 |
| 216 | Ga0495646_0137888 | 3300046680 | Unclassified | 1367 |
| 217 | Ga0495604_0923915 | 3300047317 | Unclassified | 544 |
| 218 | Ga0495636_0245423 | 3300047318 | Bacteria | 827 |
| 219 | Ga0495675_0001586 | 3300047444 | Bacteria | 13704 |
| 220 | Ga0495675_0251259 | 3300047444 | Unclassified | 1062 |
| 221 | Ga0495675_0571670 | 3300047444 | Bacteria | 643 |
| 222 | Ga0495684_0097067 | 3300047471 | Bacteria | 2230 |
| 223 | Ga0495602_0000056 | 3300048088 | Bacteria | 109741 |
| 224 | Ga0495602_0031296 | 3300048088 | Bacteria | 5033 |
| 225 | Ga0495602_0728122 | 3300048088 | Unclassified | 671 |
| 226 | Ga0496100_0090968 | 3300048903 | Bacteria | 2082 |
| 227 | Ga0496101_0433723 | 3300048904 | Bacteria | 1036 |
| 228 | Ga0496105_0168660 | 3300048908 | Bacteria | 1795 |
| 229 | Ga0496106_0529405 | 3300048909 | Bacteria | 946 |
| 230 | Ga0496107_0058098 | 3300048910 | Bacteria | 2797 |
| 231 | Ga0496108_0330486 | 3300048911 | Unclassified | 1329 |
| 232 | Ga0496109_0314351 | 3300048912 | Bacteria | 1478 |
| 233 | Ga0496109_0762896 | 3300048912 | Bacteria | 905 |
| 234 | Ga0496114_0034066 | 3300048917 | Bacteria | 4199 |
| 235 | Ga0496121_0007616 | 3300048924 | Bacteria | 13022 |
| 236 | Ga0496125_0031471 | 3300048928 | Bacteria | 4728 |
| 237 | Ga0496125_0356416 | 3300048928 | Bacteria | 871 |
| 238 | Ga0496125_0372596 | 3300048928 | Bacteria | 844 |
| 239 | Ga0496126_0156079 | 3300048929 | Bacteria | 1953 |
| 240 | Ga0496126_0181491 | 3300048929 | Bacteria | 1788 |
| 241 | Ga0501306_014007 | 3300049127 | Bacteria | 1053 |
| 242 | Ga0501306_024998 | 3300049127 | Bacteria | 857 |
| 243 | Ga0501309_001769 | 3300049129 | Bacteria | 2205 |
| 244 | Ga0501310_001378 | 3300049130 | Bacteria | 2203 |
| 245 | Ga0501304_002583 | 3300049160 | Bacteria | 1271 |
| 246 | Ga0501305_005535 | 3300049161 | Bacteria | 1535 |
| 247 | Ga0501307_004588 | 3300049162 | Bacteria | 1419 |
| 248 | Ga0501294_015945 | 3300049517 | Bacteria | 779 |
| 249 | Ga0501311_024032 | 3300049527 | Bacteria | 847 |
| 250 | Ga0501312_007340 | 3300049528 | Bacteria | 1402 |
| 251 | Ga0501313_017874 | 3300049529 | Bacteria | 859 |
| 252 | Ga0501314_002027 | 3300049530 | Bacteria | 1533 |
| 253 | Ga0501315_007224 | 3300049531 | Bacteria | 1261 |
| 254 | Ga0501316_023949 | 3300049532 | Bacteria | 786 |
| 255 | Ga0501317_003095 | 3300049533 | Bacteria | 1628 |
| 256 | Ga0501318_005169 | 3300049534 | Bacteria | 1281 |
| 257 | Ga0501318_032605 | 3300049534 | Bacteria | 715 |
| 258 | Ga0501320_018176 | 3300049536 | Bacteria | 792 |
| 259 | Ga0501322_004476 | 3300049538 | Bacteria | 941 |
| 260 | Ga0501323_039659 | 3300049539 | Bacteria | 687 |
| 261 | Ga0501324_016911 | 3300049540 | Bacteria | 719 |
| 262 | Ga0501325_020193 | 3300049541 | Bacteria | 697 |
| 263 | Ga0501329_03877 | 3300049545 | Bacteria | 778 |
| 264 | Ga0501334_09885 | 3300049550 | Bacteria | 683 |
| 265 | Ga0501031_0076754 | 3300049568 | Bacteria | 2176 |
| 266 | Ga0501032_0006297 | 3300049569 | Bacteria | 8743 |
| 267 | Ga0501039_0306200 | 3300049575 | Bacteria | 1249 |
| 268 | Ga0501039_0483080 | 3300049575 | Bacteria | 973 |
| 269 | Ga0501071_0946193 | 3300049587 | Bacteria | 665 |
| 270 | Ga0501077_0490242 | 3300049593 | Bacteria | 788 |
| 271 | Ga0501202_014864 | 3300049652 | Bacteria | 1493 |
| 272 | Ga0501206_070288 | 3300049653 | Bacteria | 591 |
| 273 | Ga0501211_000169 | 3300049658 | Bacteria | 5302 |
| 274 | Ga0501217_307798 | 3300049661 | Bacteria | 524 |
| 275 | Ga0501222_003160 | 3300049662 | Bacteria | 2264 |
| 276 | Ga0501235_026669 | 3300049669 | Bacteria | 1295 |
| 277 | Ga0501236_019289 | 3300049670 | Bacteria | 993 |
| 278 | Ga0501242_061698 | 3300049674 | Bacteria | 571 |
| 279 | Ga0501258_016784 | 3300049687 | Bacteria | 830 |
| 280 | Ga0501221_000307 | 3300049704 | Bacteria | 7344 |
| 281 | Ga0501229_005873 | 3300049706 | Bacteria | 1513 |
| 282 | Ga0501232_008626 | 3300049757 | Bacteria | 1106 |
| 283 | Ga0501264_005050 | 3300049761 | Bacteria | 1198 |
| 284 | Ga0501267_000659 | 3300049764 | Bacteria | 2743 |
| 285 | Ga0501272_009520 | 3300049769 | Bacteria | 1076 |
| 286 | Ga0501226_003946 | 3300049853 | Bacteria | 1737 |
| 287 | nmdc:mga0k408_20083_c1 | 3300050493 | Bacteria | 3738 |
| 288 | nmdc:mga0k408_2385_c2 | 3300050493 | Bacteria | 8224 |
| 289 | nmdc:mga07m45_273201_c2 | 3300050496 | Bacteria | 616 |
| 290 | nmdc:mga06r32_294149_c1 | 3300050510 | Bacteria | 1610 |
| 291 | nmdc:mga08y16_667708_c1 | 3300050511 | Bacteria | 1042 |
| 292 | nmdc:mga08x19_1225502_c1 | 3300050514 | Bacteria | 532 |
| 293 | Ga0495601_0049610 | 3300053077 | Bacteria | 2647 |
| 294 | Ga0500607_025590 | 3300053121 | Bacteria | 3283 |
| 295 | Ga0500624_080786 | 3300053157 | Bacteria | 648 |
| 296 | Ga0500636_0009564 | 3300053177 | Bacteria | 5639 |
| 297 | Ga0500637_0015554 | 3300053178 | Bacteria | 4035 |
| 298 | Ga0500625_093527 | 3300053729 | Bacteria | 1279 |
| 299 | Ga0500596_030743 | 3300053735 | Bacteria | 832 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025935 | Ga0207709_11386355 | Ga0207709_113863552 | 79 |
| 2 | 3300050511 | nmdc:mga08y16_667708_c1 | nmdc:mga08y16_667708_c1_482_757 | 79 |
| 3 | 3300049587 | Ga0501071_0946193 | Ga0501071_0946193_172_432 | 80 |
| 4 | 3300005841 | Ga0068863_101304606 | Ga0068863_1013046062 | 81 |
| 5 | 3300025936 | Ga0207670_11664635 | Ga0207670_116646351 | 81 |
| 6 | 3300026116 | Ga0207674_10014017 | Ga0207674_100140173 | 81 |
| 7 | 3300028563 | Ga0265319_1062375 | Ga0265319_10623752 | 81 |
| 8 | 3300028800 | Ga0265338_10033189 | Ga0265338_100331894 | 81 |
| 9 | 3300031241 | Ga0265325_10083964 | Ga0265325_100839642 | 81 |
| 10 | 3300031344 | Ga0265316_10370395 | Ga0265316_103703951 | 81 |
| 11 | 3300031711 | Ga0265314_10364511 | Ga0265314_103645112 | 81 |
| 12 | 3300035725 | Ga0373947_0771883 | Ga0373947_0771883_310_573 | 81 |
| 13 | 3300045051 | Ga0451576_0181581 | Ga0451576_0181581_630_893 | 81 |
| 14 | 3300046472 | Ga0495580_0499769 | Ga0495580_0499769_11_274 | 81 |
| 15 | 3300046472 | Ga0495580_0847901 | Ga0495580_0847901_306_569 | 81 |
| 16 | 3300046516 | Ga0495628_0419215 | Ga0495628_0419215_634_897 | 81 |
| 17 | 3300046543 | Ga0495645_0141760 | Ga0495645_0141760_982_1245 | 81 |
| 18 | 3300046678 | Ga0495599_0905066 | Ga0495599_0905066_197_460 | 81 |
| 19 | 3300046680 | Ga0495646_0137888 | Ga0495646_0137888_62_325 | 81 |
| 20 | 3300047444 | Ga0495675_0251259 | Ga0495675_0251259_390_653 | 81 |
| 21 | 3300047471 | Ga0495684_0097067 | Ga0495684_0097067_1737_2000 | 81 |
| 22 | 3300053077 | Ga0495601_0049610 | Ga0495601_0049610_1750_2013 | 81 |
| 23 | iso_pu_bacteria | 2643221544 | 2643743060 | 81 |
| 24 | iso_pu_bacteria | 2643221639 | 2644218523 | 81 |
| 25 | iso_pu_bacteria | 2643221646 | 2644260418 | 81 |
| 26 | iso_pu_bacteria | 2738543013 | 2739248267 | 81 |
| 27 | iso_pu_bacteria | 2904479285 | 2904480792 | 81 |
| 28 | iso_pu_bacteria | 2932422444 | 2932424035 | 81 |
| 29 | 3300005445 | Ga0070708_100068257 | Ga0070708_1000682572 | 83 |
| 30 | 3300005467 | Ga0070706_100649475 | Ga0070706_1006494752 | 83 |
| 31 | 3300005843 | Ga0068860_100861348 | Ga0068860_1008613482 | 83 |
| 32 | 3300025910 | Ga0207684_10886966 | Ga0207684_108869662 | 83 |
| 33 | 3300026088 | Ga0207641_11298766 | Ga0207641_112987662 | 83 |
| 34 | 3300031731 | Ga0307405_10173496 | Ga0307405_101734963 | 83 |
| 35 | 3300031852 | Ga0307410_10478600 | Ga0307410_104786002 | 83 |
| 36 | 3300031852 | Ga0307410_11975304 | Ga0307410_119753042 | 83 |
| 37 | 3300031903 | Ga0307407_10415712 | Ga0307407_104157122 | 83 |
| 38 | 3300031995 | Ga0307409_100242668 | Ga0307409_1002426682 | 83 |
| 39 | 3300032002 | Ga0307416_101134350 | Ga0307416_1011343502 | 83 |
| 40 | 3300032005 | Ga0307411_10789251 | Ga0307411_107892512 | 83 |
| 41 | 3300032126 | Ga0307415_100113492 | Ga0307415_1001134922 | 83 |
| 42 | 3300032168 | Ga0316593_10018037 | Ga0316593_100180373 | 83 |
| 43 | 3300041451 | Ga0451791_0860348 | Ga0451791_0860348_70_327 | 83 |
| 44 | 3300041456 | Ga0451795_1097443 | Ga0451795_1097443_264_530 | 83 |
| 45 | 3300041505 | Ga0451849_0418868 | Ga0451849_0418868_426_683 | 83 |
| 46 | 3300041512 | Ga0451853_0597047 | Ga0451853_0597047_679_936 | 83 |
| 47 | 3300042437 | Ga0439444_0203110 | Ga0439444_0203110_93_368 | 83 |
| 48 | 3300049534 | Ga0501318_032605 | Ga0501318_032605_435_695 | 83 |
| 49 | 3300050510 | nmdc:mga06r32_294149_c1 | nmdc:mga06r32_294149_c1_779_1042 | 83 |
| 50 | 3300004799 | Ga0058863_11528505 | Ga0058863_115285051 | 84 |
| 51 | 3300004800 | Ga0058861_11957894 | Ga0058861_119578942 | 84 |
| 52 | 3300004803 | Ga0058862_11853061 | Ga0058862_118530611 | 84 |
| 53 | 3300004803 | Ga0058862_12441055 | Ga0058862_124410552 | 84 |
| 54 | 3300005336 | Ga0070680_101407062 | Ga0070680_1014070622 | 84 |
| 55 | 3300005436 | Ga0070713_100235070 | Ga0070713_1002350703 | 84 |
| 56 | 3300005445 | Ga0070708_101933644 | Ga0070708_1019336442 | 84 |
| 57 | 3300005458 | Ga0070681_10464168 | Ga0070681_104641682 | 84 |
| 58 | 3300005468 | Ga0070707_100866308 | Ga0070707_1008663081 | 84 |
| 59 | 3300005518 | Ga0070699_100275092 | Ga0070699_1002750922 | 84 |
| 60 | 3300005518 | Ga0070699_100547113 | Ga0070699_1005471132 | 84 |
| 61 | 3300005536 | Ga0070697_100283534 | Ga0070697_1002835342 | 84 |
| 62 | 3300005536 | Ga0070697_100778544 | Ga0070697_1007785441 | 84 |
| 63 | 3300005545 | Ga0070695_101408308 | Ga0070695_1014083082 | 84 |
| 64 | 3300009093 | Ga0105240_10011302 | Ga0105240_100113022 | 84 |
| 65 | 3300009545 | Ga0105237_10004245 | Ga0105237_1000424510 | 84 |
| 66 | 3300010159 | Ga0099796_10192390 | Ga0099796_101923902 | 84 |
| 67 | 3300013104 | Ga0157370_10730523 | Ga0157370_107305232 | 84 |
| 68 | 3300020070 | Ga0206356_11405752 | Ga0206356_114057522 | 84 |
| 69 | 3300024227 | Ga0228598_1064083 | Ga0228598_10640831 | 84 |
| 70 | 3300025912 | Ga0207707_10470902 | Ga0207707_104709022 | 84 |
| 71 | 3300025913 | Ga0207695_10004215 | Ga0207695_1000421510 | 84 |
| 72 | 3300025914 | Ga0207671_10160951 | Ga0207671_101609514 | 84 |
| 73 | 3300025921 | Ga0207652_10337278 | Ga0207652_103372782 | 84 |
| 74 | 3300025928 | Ga0207700_11290357 | Ga0207700_112903572 | 84 |
| 75 | 3300030760 | Ga0265762_1048314 | Ga0265762_10483142 | 84 |
| 76 | 3300031090 | Ga0265760_10083015 | Ga0265760_100830151 | 84 |
| 77 | 3300031090 | Ga0265760_10258923 | Ga0265760_102589231 | 84 |
| 78 | 3300031728 | Ga0316578_10186210 | Ga0316578_101862102 | 84 |
| 79 | 3300031733 | Ga0316577_10143904 | Ga0316577_101439042 | 84 |
| 80 | 3300035086 | Ga0373934_0175752 | Ga0373934_0175752_35_340 | 84 |
| 81 | 3300035119 | Ga0373956_0010970 | Ga0373956_0010970_21_326 | 84 |
| 82 | 3300035120 | Ga0373957_0028076 | Ga0373957_0028076_786_1091 | 84 |
| 83 | 3300035172 | Ga0373955_0190796 | Ga0373955_0190796_181_486 | 84 |
| 84 | 3300035724 | Ga0373933_0000034 | Ga0373933_0000034_8762_9067 | 84 |
| 85 | 3300036401 | Ga0373937_0000001 | Ga0373937_0000001_247434_247739 | 84 |
| 86 | 3300036401 | Ga0373937_0223132 | Ga0373937_0223132_231_491 | 84 |
| 87 | 3300044712 | Ga0453684_0810033 | Ga0453684_0810033_163_426 | 84 |
| 88 | 3300046462 | Ga0495651_0005814 | Ga0495651_0005814_802_1107 | 84 |
| 89 | 3300046463 | Ga0495653_0115206 | Ga0495653_0115206_1330_1635 | 84 |
| 90 | 3300046463 | Ga0495653_0225666 | Ga0495653_0225666_964_1224 | 84 |
| 91 | 3300046511 | Ga0495608_0554910 | Ga0495608_0554910_69_374 | 84 |
| 92 | 3300046529 | Ga0495652_0039918 | Ga0495652_0039918_52_357 | 84 |
| 93 | 3300046536 | Ga0495587_0000912 | Ga0495587_0000912_2439_2744 | 84 |
| 94 | 3300046675 | Ga0495657_0448915 | Ga0495657_0448915_158_418 | 84 |
| 95 | 3300046679 | Ga0495623_0030174 | Ga0495623_0030174_2851_3156 | 84 |
| 96 | 3300047317 | Ga0495604_0923915 | Ga0495604_0923915_67_372 | 84 |
| 97 | 3300047444 | Ga0495675_0001586 | Ga0495675_0001586_8571_8876 | 84 |
| 98 | 3300047444 | Ga0495675_0571670 | Ga0495675_0571670_119_379 | 84 |
| 99 | 3300048088 | Ga0495602_0000056 | Ga0495602_0000056_105597_105902 | 84 |
| 100 | 3300048088 | Ga0495602_0031296 | Ga0495602_0031296_1006_1266 | 84 |
| 101 | 3300048088 | Ga0495602_0728122 | Ga0495602_0728122_270_578 | 84 |
| 102 | 2162886007 | SwRhRL2b_contig_1616504 | SwRhRL2b_0742.00006700 | 85 |
| 103 | 2162886007 | SwRhRL2b_contig_37466 | SwRhRL2b_0180.00004430 | 85 |
| 104 | 3300003544 | Ga0007417J51691_1041049 | Ga0007417J51691_10410492 | 85 |
| 105 | 3300003791 | Ga0055530_10092352 | Ga0055530_100923521 | 85 |
| 106 | 3300003792 | Ga0055540_1050213 | Ga0055540_10502131 | 85 |
| 107 | 3300003794 | Ga0055531_10000500 | Ga0055531_1000050026 | 85 |
| 108 | 3300005289 | Ga0065704_10041388 | Ga0065704_100413882 | 85 |
| 109 | 3300005289 | Ga0065704_10117241 | Ga0065704_101172413 | 85 |
| 110 | 3300005331 | Ga0070670_100992313 | Ga0070670_1009923132 | 85 |
| 111 | 3300005335 | Ga0070666_10699993 | Ga0070666_106999931 | 85 |
| 112 | 3300005338 | Ga0068868_100250372 | Ga0068868_1002503723 | 85 |
| 113 | 3300005339 | Ga0070660_101144957 | Ga0070660_1011449572 | 85 |
| 114 | 3300005343 | Ga0070687_100301947 | Ga0070687_1003019472 | 85 |
| 115 | 3300005354 | Ga0070675_101129783 | Ga0070675_1011297832 | 85 |
| 116 | 3300005356 | Ga0070674_100057937 | Ga0070674_1000579371 | 85 |
| 117 | 3300005364 | Ga0070673_101281203 | Ga0070673_1012812032 | 85 |
| 118 | 3300005366 | Ga0070659_101996429 | Ga0070659_1019964291 | 85 |
| 119 | 3300005438 | Ga0070701_10153363 | Ga0070701_101533633 | 85 |
| 120 | 3300005445 | Ga0070708_102081283 | Ga0070708_1020812831 | 85 |
| 121 | 3300005456 | Ga0070678_100881928 | Ga0070678_1008819281 | 85 |
| 122 | 3300005547 | Ga0070693_100501830 | Ga0070693_1005018301 | 85 |
| 123 | 3300005548 | Ga0070665_101124563 | Ga0070665_1011245631 | 85 |
| 124 | 3300005564 | Ga0070664_100652607 | Ga0070664_1006526071 | 85 |
| 125 | 3300005718 | Ga0068866_10024434 | Ga0068866_100244341 | 85 |
| 126 | 3300005844 | Ga0068862_100787052 | Ga0068862_1007870521 | 85 |
| 127 | 3300006195 | Ga0075366_10107738 | Ga0075366_101077383 | 85 |
| 128 | 3300006852 | Ga0075433_11189463 | Ga0075433_111894631 | 85 |
| 129 | 3300006881 | Ga0068865_100282545 | Ga0068865_1002825452 | 85 |
| 130 | 3300006946 | Ga0079104_1000055 | Ga0079104_100005535 | 85 |
| 131 | 3300007265 | Ga0099794_10062561 | Ga0099794_100625612 | 85 |
| 132 | 3300007265 | Ga0099794_10076960 | Ga0099794_100769602 | 85 |
| 133 | 3300007265 | Ga0099794_10177254 | Ga0099794_101772543 | 85 |
| 134 | 3300009092 | Ga0105250_10001192 | Ga0105250_1000119211 | 85 |
| 135 | 3300009094 | Ga0111539_13453028 | Ga0111539_134530282 | 85 |
| 136 | 3300009098 | Ga0105245_10103773 | Ga0105245_101037733 | 85 |
| 137 | 3300009148 | Ga0105243_10002600 | Ga0105243_100026005 | 85 |
| 138 | 3300009174 | Ga0105241_10230366 | Ga0105241_102303663 | 85 |
| 139 | 3300009176 | Ga0105242_12689804 | Ga0105242_126898041 | 85 |
| 140 | 3300009553 | Ga0105249_13508913 | Ga0105249_135089131 | 85 |
| 141 | 3300010375 | Ga0105239_10417172 | Ga0105239_104171722 | 85 |
| 142 | 3300011119 | Ga0105246_11118836 | Ga0105246_111188362 | 85 |
| 143 | 3300013102 | Ga0157371_10601419 | Ga0157371_106014192 | 85 |
| 144 | 3300013297 | Ga0157378_10152966 | Ga0157378_101529663 | 85 |
| 145 | 3300013297 | Ga0157378_10167039 | Ga0157378_101670392 | 85 |
| 146 | 3300013306 | Ga0163162_10426021 | Ga0163162_104260212 | 85 |
| 147 | 3300013306 | Ga0163162_10903500 | Ga0163162_109035001 | 85 |
| 148 | 3300013308 | Ga0157375_10044060 | Ga0157375_100440604 | 85 |
| 149 | 3300013308 | Ga0157375_10188136 | Ga0157375_101881362 | 85 |
| 150 | 3300014325 | Ga0163163_10022210 | Ga0163163_100222103 | 85 |
| 151 | 3300014325 | Ga0163163_10732562 | Ga0163163_107325621 | 85 |
| 152 | 3300014325 | Ga0163163_11065845 | Ga0163163_110658453 | 85 |
| 153 | 3300014326 | Ga0157380_10328721 | Ga0157380_103287213 | 85 |
| 154 | 3300014969 | Ga0157376_10052430 | Ga0157376_100524302 | 85 |
| 155 | 3300014969 | Ga0157376_12666545 | Ga0157376_126665451 | 85 |
| 156 | 3300017792 | Ga0163161_10077396 | Ga0163161_100773963 | 85 |
| 157 | 3300020078 | Ga0206352_10989137 | Ga0206352_109891372 | 85 |
| 158 | 3300021361 | Ga0213872_10126370 | Ga0213872_101263702 | 85 |
| 159 | 3300025298 | Ga0209050_1001301 | Ga0209050_10013013 | 85 |
| 160 | 3300025303 | Ga0209051_1044141 | Ga0209051_10441411 | 85 |
| 161 | 3300025304 | Ga0209257_1000131 | Ga0209257_100013113 | 85 |
| 162 | 3300025304 | Ga0209257_1143970 | Ga0209257_11439701 | 85 |
| 163 | 3300025711 | Ga0207696_1001691 | Ga0207696_10016913 | 85 |
| 164 | 3300025919 | Ga0207657_11019487 | Ga0207657_110194871 | 85 |
| 165 | 3300025923 | Ga0207681_11580133 | Ga0207681_115801332 | 85 |
| 166 | 3300025925 | Ga0207650_10263018 | Ga0207650_102630181 | 85 |
| 167 | 3300025926 | Ga0207659_10581825 | Ga0207659_105818251 | 85 |
| 168 | 3300025927 | Ga0207687_10066964 | Ga0207687_100669643 | 85 |
| 169 | 3300025935 | Ga0207709_10000111 | Ga0207709_1000011184 | 85 |
| 170 | 3300025937 | Ga0207669_10063132 | Ga0207669_100631322 | 85 |
| 171 | 3300025938 | Ga0207704_10654241 | Ga0207704_106542411 | 85 |
| 172 | 3300026023 | Ga0207677_11063187 | Ga0207677_110631872 | 85 |
| 173 | 3300026041 | Ga0207639_11468345 | Ga0207639_114683451 | 85 |
| 174 | 3300026078 | Ga0207702_10560276 | Ga0207702_105602762 | 85 |
| 175 | 3300026121 | Ga0207683_10755550 | Ga0207683_107555501 | 85 |
| 176 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007794 | 85 |
| 177 | 3300027671 | Ga0209588_1001135 | Ga0209588_10011357 | 85 |
| 178 | 3300028379 | Ga0268266_10550823 | Ga0268266_105508232 | 85 |
| 179 | 3300028380 | Ga0268265_10348791 | Ga0268265_103487912 | 85 |
| 180 | 3300028794 | Ga0307515_10016568 | Ga0307515_1001656814 | 85 |
| 181 | 3300028794 | Ga0307515_10070822 | Ga0307515_100708225 | 85 |
| 182 | 3300031250 | Ga0265331_10434164 | Ga0265331_104341642 | 85 |
| 183 | 3300031251 | Ga0265327_10012557 | Ga0265327_100125572 | 85 |
| 184 | 3300031691 | Ga0316579_10128751 | Ga0316579_101287512 | 85 |
| 185 | 3300031824 | Ga0307413_10609019 | Ga0307413_106090192 | 85 |
| 186 | 3300031852 | Ga0307410_10627174 | Ga0307410_106271742 | 85 |
| 187 | 3300031901 | Ga0307406_10172895 | Ga0307406_101728953 | 85 |
| 188 | 3300031995 | Ga0307409_102079147 | Ga0307409_1020791472 | 85 |
| 189 | 3300031995 | Ga0307409_102746827 | Ga0307409_1027468271 | 85 |
| 190 | 3300032004 | Ga0307414_10202034 | Ga0307414_102020343 | 85 |
| 191 | 3300032004 | Ga0307414_10922542 | Ga0307414_109225422 | 85 |
| 192 | 3300032005 | Ga0307411_10094050 | Ga0307411_100940502 | 85 |
| 193 | 3300032168 | Ga0316593_10062408 | Ga0316593_100624082 | 85 |
| 194 | 3300033541 | Ga0316596_1149608 | Ga0316596_11496081 | 85 |
| 195 | 3300034817 | Ga0373948_0017442 | Ga0373948_0017442_425_688 | 85 |
| 196 | 3300035084 | Ga0373928_0249119 | Ga0373928_0249119_207_470 | 85 |
| 197 | 3300035092 | Ga0373952_0060529 | Ga0373952_0060529_65_322 | 85 |
| 198 | 3300035113 | Ga0373936_0278820 | Ga0373936_0278820_127_390 | 85 |
| 199 | 3300035691 | Ga0373931_0504334 | Ga0373931_0504334_13_276 | 85 |
| 200 | 3300035691 | Ga0373931_1230018 | Ga0373931_1230018_45_311 | 85 |
| 201 | 3300035695 | Ga0373927_0081090 | Ga0373927_0081090_114_377 | 85 |
| 202 | 3300035724 | Ga0373933_0392313 | Ga0373933_0392313_134_397 | 85 |
| 203 | 3300035724 | Ga0373933_0700748 | Ga0373933_0700748_396_653 | 85 |
| 204 | 3300037068 | Ga0373925_1228126 | Ga0373925_1228126_225_482 | 85 |
| 205 | 3300039447 | Ga0436361_0796155 | Ga0436361_0796155_734_994 | 85 |
| 206 | 3300041410 | Ga0439461_0010810 | Ga0439461_0010810_662_925 | 85 |
| 207 | 3300041446 | Ga0451794_48726 | Ga0451794_48726_304_561 | 85 |
| 208 | 3300041453 | Ga0451797_1587335 | Ga0451797_1587335_88_351 | 85 |
| 209 | 3300041459 | Ga0451800_0771616 | Ga0451800_0771616_157_420 | 85 |
| 210 | 3300041461 | Ga0451805_055637 | Ga0451805_055637_100_360 | 85 |
| 211 | 3300041463 | Ga0451804_0153612 | Ga0451804_0153612_62_319 | 85 |
| 212 | 3300041511 | Ga0451855_1465734 | Ga0451855_1465734_293_556 | 85 |
| 213 | 3300042000 | Ga0439437_000955 | Ga0439437_000955_1013_1276 | 85 |
| 214 | 3300042004 | Ga0439445_0056112 | Ga0439445_0056112_708_971 | 85 |
| 215 | 3300042115 | Ga0450911_000084 | Ga0450911_000084_4970_5230 | 85 |
| 216 | 3300042116 | Ga0450912_003447 | Ga0450912_003447_195_458 | 85 |
| 217 | 3300042120 | Ga0450917_000101 | Ga0450917_000101_3166_3429 | 85 |
| 218 | 3300042124 | Ga0450922_028653 | Ga0450922_028653_32_295 | 85 |
| 219 | 3300042126 | Ga0450888_000038 | Ga0450888_000038_7924_8187 | 85 |
| 220 | 3300042127 | Ga0450890_001097 | Ga0450890_001097_967_1230 | 85 |
| 221 | 3300042129 | Ga0450891_000246 | Ga0450891_000246_4494_4757 | 85 |
| 222 | 3300042130 | Ga0450892_000862 | Ga0450892_000862_2202_2465 | 85 |
| 223 | 3300042137 | Ga0450902_076547 | Ga0450902_076547_91_351 | 85 |
| 224 | 3300042144 | Ga0450889_000093 | Ga0450889_000093_5298_5561 | 85 |
| 225 | 3300042530 | Ga0450916_019177 | Ga0450916_019177_554_814 | 85 |
| 226 | 3300042532 | Ga0450893_0003312 | Ga0450893_0003312_1089_1352 | 85 |
| 227 | 3300042876 | Ga0451577_0567837 | Ga0451577_0567837_139_405 | 85 |
| 228 | 3300042876 | Ga0451577_0602671 | Ga0451577_0602671_410_670 | 85 |
| 229 | 3300044673 | Ga0453683_0212095 | Ga0453683_0212095_647_910 | 85 |
| 230 | 3300044712 | Ga0453684_0812199 | Ga0453684_0812199_259_522 | 85 |
| 231 | 3300045051 | Ga0451576_0009538 | Ga0451576_0009538_6137_6397 | 85 |
| 232 | 3300045051 | Ga0451576_0228760 | Ga0451576_0228760_1465_1734 | 85 |
| 233 | 3300045051 | Ga0451576_0441129 | Ga0451576_0441129_711_974 | 85 |
| 234 | 3300045051 | Ga0451576_0949953 | Ga0451576_0949953_546_809 | 85 |
| 235 | 3300045051 | Ga0451576_2020924 | Ga0451576_2020924_249_509 | 85 |
| 236 | 3300047318 | Ga0495636_0245423 | Ga0495636_0245423_117_377 | 85 |
| 237 | 3300048903 | Ga0496100_0090968 | Ga0496100_0090968_583_840 | 85 |
| 238 | 3300048904 | Ga0496101_0433723 | Ga0496101_0433723_452_709 | 85 |
| 239 | 3300048908 | Ga0496105_0168660 | Ga0496105_0168660_192_449 | 85 |
| 240 | 3300048909 | Ga0496106_0529405 | Ga0496106_0529405_450_707 | 85 |
| 241 | 3300048910 | Ga0496107_0058098 | Ga0496107_0058098_960_1217 | 85 |
| 242 | 3300048911 | Ga0496108_0330486 | Ga0496108_0330486_494_751 | 85 |
| 243 | 3300048912 | Ga0496109_0314351 | Ga0496109_0314351_825_1082 | 85 |
| 244 | 3300048912 | Ga0496109_0762896 | Ga0496109_0762896_510_767 | 85 |
| 245 | 3300048917 | Ga0496114_0034066 | Ga0496114_0034066_89_346 | 85 |
| 246 | 3300048924 | Ga0496121_0007616 | Ga0496121_0007616_512_772 | 85 |
| 247 | 3300048928 | Ga0496125_0031471 | Ga0496125_0031471_950_1210 | 85 |
| 248 | 3300048928 | Ga0496125_0356416 | Ga0496125_0356416_570_830 | 85 |
| 249 | 3300048928 | Ga0496125_0372596 | Ga0496125_0372596_491_751 | 85 |
| 250 | 3300048929 | Ga0496126_0156079 | Ga0496126_0156079_119_379 | 85 |
| 251 | 3300048929 | Ga0496126_0181491 | Ga0496126_0181491_1357_1617 | 85 |
| 252 | 3300049127 | Ga0501306_014007 | Ga0501306_014007_411_671 | 85 |
| 253 | 3300049127 | Ga0501306_024998 | Ga0501306_024998_480_743 | 85 |
| 254 | 3300049129 | Ga0501309_001769 | Ga0501309_001769_490_753 | 85 |
| 255 | 3300049130 | Ga0501310_001378 | Ga0501310_001378_490_753 | 85 |
| 256 | 3300049160 | Ga0501304_002583 | Ga0501304_002583_362_625 | 85 |
| 257 | 3300049161 | Ga0501305_005535 | Ga0501305_005535_489_752 | 85 |
| 258 | 3300049162 | Ga0501307_004588 | Ga0501307_004588_478_741 | 85 |
| 259 | 3300049517 | Ga0501294_015945 | Ga0501294_015945_439_702 | 85 |
| 260 | 3300049527 | Ga0501311_024032 | Ga0501311_024032_490_753 | 85 |
| 261 | 3300049528 | Ga0501312_007340 | Ga0501312_007340_647_910 | 85 |
| 262 | 3300049529 | Ga0501313_017874 | Ga0501313_017874_482_745 | 85 |
| 263 | 3300049530 | Ga0501314_002027 | Ga0501314_002027_487_750 | 85 |
| 264 | 3300049531 | Ga0501315_007224 | Ga0501315_007224_360_623 | 85 |
| 265 | 3300049532 | Ga0501316_023949 | Ga0501316_023949_481_744 | 85 |
| 266 | 3300049533 | Ga0501317_003095 | Ga0501317_003095_489_752 | 85 |
| 267 | 3300049534 | Ga0501318_005169 | Ga0501318_005169_482_745 | 85 |
| 268 | 3300049536 | Ga0501320_018176 | Ga0501320_018176_489_752 | 85 |
| 269 | 3300049538 | Ga0501322_004476 | Ga0501322_004476_560_823 | 85 |
| 270 | 3300049539 | Ga0501323_039659 | Ga0501323_039659_47_310 | 85 |
| 271 | 3300049540 | Ga0501324_016911 | Ga0501324_016911_35_298 | 85 |
| 272 | 3300049541 | Ga0501325_020193 | Ga0501325_020193_35_298 | 85 |
| 273 | 3300049545 | Ga0501329_03877 | Ga0501329_03877_351_611 | 85 |
| 274 | 3300049550 | Ga0501334_09885 | Ga0501334_09885_318_578 | 85 |
| 275 | 3300049568 | Ga0501031_0076754 | Ga0501031_0076754_440_706 | 85 |
| 276 | 3300049569 | Ga0501032_0006297 | Ga0501032_0006297_6818_7075 | 85 |
| 277 | 3300049575 | Ga0501039_0306200 | Ga0501039_0306200_376_633 | 85 |
| 278 | 3300049575 | Ga0501039_0483080 | Ga0501039_0483080_155_412 | 85 |
| 279 | 3300049593 | Ga0501077_0490242 | Ga0501077_0490242_440_697 | 85 |
| 280 | 3300049652 | Ga0501202_014864 | Ga0501202_014864_439_702 | 85 |
| 281 | 3300049653 | Ga0501206_070288 | Ga0501206_070288_84_347 | 85 |
| 282 | 3300049658 | Ga0501211_000169 | Ga0501211_000169_133_396 | 85 |
| 283 | 3300049661 | Ga0501217_307798 | Ga0501217_307798_133_396 | 85 |
| 284 | 3300049662 | Ga0501222_003160 | Ga0501222_003160_910_1173 | 85 |
| 285 | 3300049669 | Ga0501235_026669 | Ga0501235_026669_717_980 | 85 |
| 286 | 3300049670 | Ga0501236_019289 | Ga0501236_019289_168_431 | 85 |
| 287 | 3300049674 | Ga0501242_061698 | Ga0501242_061698_233_496 | 85 |
| 288 | 3300049687 | Ga0501258_016784 | Ga0501258_016784_527_790 | 85 |
| 289 | 3300049704 | Ga0501221_000307 | Ga0501221_000307_4175_4438 | 85 |
| 290 | 3300049706 | Ga0501229_005873 | Ga0501229_005873_854_1117 | 85 |
| 291 | 3300049757 | Ga0501232_008626 | Ga0501232_008626_52_315 | 85 |
| 292 | 3300049761 | Ga0501264_005050 | Ga0501264_005050_790_1053 | 85 |
| 293 | 3300049764 | Ga0501267_000659 | Ga0501267_000659_186_449 | 85 |
| 294 | 3300049769 | Ga0501272_009520 | Ga0501272_009520_534_797 | 85 |
| 295 | 3300049853 | Ga0501226_003946 | Ga0501226_003946_76_339 | 85 |
| 296 | 3300050493 | nmdc:mga0k408_20083_c1 | nmdc:mga0k408_20083_c1_159_422 | 85 |
| 297 | 3300050493 | nmdc:mga0k408_2385_c2 | nmdc:mga0k408_2385_c2_264_527 | 85 |
| 298 | 3300050496 | nmdc:mga07m45_273201_c2 | nmdc:mga07m45_273201_c2_128_391 | 85 |
| 299 | 3300050514 | nmdc:mga08x19_1225502_c1 | nmdc:mga08x19_1225502_c1_203_463 | 85 |
| 300 | 3300053121 | Ga0500607_025590 | Ga0500607_025590_369_632 | 85 |
| 301 | 3300053157 | Ga0500624_080786 | Ga0500624_080786_88_351 | 85 |
| 302 | 3300053177 | Ga0500636_0009564 | Ga0500636_0009564_3904_4167 | 85 |
| 303 | 3300053178 | Ga0500637_0015554 | Ga0500637_0015554_3018_3281 | 85 |
| 304 | 3300053729 | Ga0500625_093527 | Ga0500625_093527_167_430 | 85 |
| 305 | 3300053735 | Ga0500596_030743 | Ga0500596_030743_328_591 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9733 | 19 | 85 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9725 | 19 | 85 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9721 | 21 | 85 |
| 8c95-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.956 | 19 | 85 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9451 | 19 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9721 | 21 | 85 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9293 | 21 | 85 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8937 | 21 | 85 | 2.40.50.100 |
| af_Q9ZVX0_51_147_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8763 | 8 | 84 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8725 | 29 | 83 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9FJN9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 1.005 | 21 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A378VWB8-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 1.005 | 21 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A5C8B9S1-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 1.003 | 25 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A0K8NY46-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 1.001 | 20 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A0A8XHI5-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9984 | 20 | 85 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar