F397975

General Info

Members Datasets Scaffolds Average Seq Length
305 254 299 87

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100235070|Ga0070713_1002350703
Length 101
Sequence MAHKKGGGSSTNGRDSQGQRLGVKRFGGQLVTSGSILIRQRGTHYKAGKNVGRAKDDSLFARMDGVVLFEDKGGKGRFISVLSPAEHASRYEKVSSAPAAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
4 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
5 2738543013 Variovorax sp. BT01 Isolate Unclassified
6 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
7 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
143 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
144 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
145 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
156 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
157 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
158 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
159 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
160 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
161 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
162 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
163 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
164 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
165 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
166 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
167 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
207 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
228 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
229 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
234 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
235 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
236 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
237 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
238 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
239 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
240 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
241 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
242 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
250 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
254 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.57
Metatranscriptomes 12.46
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0.66
Rhizoplane 5.25
Rhizosphere 83.61
Stem 0
Stem Tuber 0
Unclassified 4.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1616504 2162886007 Bacteria 1186
2 SwRhRL2b_contig_37466 2162886007 Bacteria 1075
3 Ga0007417J51691_1041049 3300003544 Bacteria 751
4 Ga0055530_10092352 3300003791 Bacteria 618
5 Ga0055540_1050213 3300003792 Bacteria 863
6 Ga0055531_10000500 3300003794 Bacteria 35897
7 Ga0058863_11528505 3300004799 Viruses 710
8 Ga0058861_11957894 3300004800 Bacteria 946
9 Ga0058862_11853061 3300004803 Viruses 723
10 Ga0058862_12441055 3300004803 Bacteria 987
11 Ga0065704_10041388 3300005289 Bacteria 789
12 Ga0065704_10117241 3300005289 Bacteria 1834
13 Ga0070670_100992313 3300005331 Bacteria 763
14 Ga0070666_10699993 3300005335 Bacteria 743
15 Ga0070680_101407062 3300005336 Viruses 604
16 Ga0068868_100250372 3300005338 Bacteria 1491
17 Ga0070660_101144957 3300005339 Bacteria 659
18 Ga0070687_100301947 3300005343 Bacteria 1016
19 Ga0070675_101129783 3300005354 Bacteria 721
20 Ga0070674_100057937 3300005356 Bacteria 2691
21 Ga0070673_101281203 3300005364 Bacteria 688
22 Ga0070659_101996429 3300005366 Bacteria 521
23 Ga0070713_100235070 3300005436 Bacteria 1667
24 Ga0070701_10153363 3300005438 Bacteria 1328
25 Ga0070708_100068257 3300005445 Bacteria 3195
26 Ga0070708_101933644 3300005445 Bacteria 547
27 Ga0070708_102081283 3300005445 Bacteria 525
28 Ga0070678_100881928 3300005456 Bacteria 817
29 Ga0070681_10464168 3300005458 Viruses 1179
30 Ga0070706_100649475 3300005467 Bacteria 979
31 Ga0070707_100866308 3300005468 Bacteria 868
32 Ga0070699_100275092 3300005518 Bacteria 1508
33 Ga0070699_100547113 3300005518 Bacteria 1053
34 Ga0070697_100283534 3300005536 Bacteria 1422
35 Ga0070697_100778544 3300005536 Unclassified 846
36 Ga0070695_101408308 3300005545 Unclassified 578
37 Ga0070693_100501830 3300005547 Bacteria 861
38 Ga0070665_101124563 3300005548 Bacteria 797
39 Ga0070664_100652607 3300005564 Bacteria 978
40 Ga0068866_10024434 3300005718 Bacteria 2826
41 Ga0068863_101304606 3300005841 Bacteria 733
42 Ga0068860_100861348 3300005843 Bacteria 921
43 Ga0068862_100787052 3300005844 Bacteria 928
44 Ga0075366_10107738 3300006195 Bacteria 1675
45 Ga0075433_11189463 3300006852 Bacteria 662
46 Ga0068865_100282545 3300006881 Bacteria 1322
47 Ga0079104_1000055 3300006946 Bacteria 166522
48 Ga0099794_10062561 3300007265 Bacteria 1810
49 Ga0099794_10076960 3300007265 Bacteria 1641
50 Ga0099794_10177254 3300007265 Bacteria 1087
51 Ga0105250_10001192 3300009092 Bacteria 14517
52 Ga0105240_10011302 3300009093 Bacteria 12439
53 Ga0111539_13453028 3300009094 Bacteria 508
54 Ga0105245_10103773 3300009098 Bacteria 2635
55 Ga0105243_10002600 3300009148 Bacteria 15051
56 Ga0105241_10230366 3300009174 Bacteria 1561
57 Ga0105242_12689804 3300009176 Bacteria 547
58 Ga0105237_10004245 3300009545 Bacteria 16680
59 Ga0105249_13508913 3300009553 Bacteria 505
60 Ga0099796_10192390 3300010159 Bacteria 824
61 Ga0105239_10417172 3300010375 Bacteria 1520
62 Ga0105246_11118836 3300011119 Bacteria 720
63 Ga0157371_10601419 3300013102 Bacteria 818
64 Ga0157370_10730523 3300013104 Bacteria 903
65 Ga0157378_10152966 3300013297 Bacteria 2151
66 Ga0157378_10167039 3300013297 Bacteria 2062
67 Ga0163162_10426021 3300013306 Bacteria 1459
68 Ga0163162_10903500 3300013306 Bacteria 996
69 Ga0157375_10044060 3300013308 Bacteria 4331
70 Ga0157375_10188136 3300013308 Bacteria 2219
71 Ga0163163_10022210 3300014325 Bacteria 6004
72 Ga0163163_10732562 3300014325 Bacteria 1052
73 Ga0163163_11065845 3300014325 Bacteria 871
74 Ga0157380_10328721 3300014326 Bacteria 1421
75 Ga0157376_10052430 3300014969 Bacteria 3392
76 Ga0157376_12666545 3300014969 Bacteria 540
77 Ga0163161_10077396 3300017792 Bacteria 2443
78 Ga0206356_11405752 3300020070 Viruses 906
79 Ga0206352_10989137 3300020078 Bacteria 942
80 Ga0213872_10126370 3300021361 Bacteria 1128
81 Ga0228598_1064083 3300024227 Unclassified 733
82 Ga0209050_1001301 3300025298 Bacteria 28152
83 Ga0209051_1044141 3300025303 Bacteria 1556
84 Ga0209257_1000131 3300025304 Bacteria 211464
85 Ga0209257_1143970 3300025304 Bacteria 532
86 Ga0207696_1001691 3300025711 Bacteria 11466
87 Ga0207684_10886966 3300025910 Bacteria 750
88 Ga0207707_10470902 3300025912 Viruses 1074
89 Ga0207695_10004215 3300025913 Bacteria 19760
90 Ga0207671_10160951 3300025914 Viruses 1738
91 Ga0207657_11019487 3300025919 Bacteria 635
92 Ga0207652_10337278 3300025921 Viruses 1361
93 Ga0207681_11580133 3300025923 Bacteria 549
94 Ga0207650_10263018 3300025925 Bacteria 1400
95 Ga0207659_10581825 3300025926 Bacteria 953
96 Ga0207687_10066964 3300025927 Bacteria 2553
97 Ga0207700_11290357 3300025928 Unclassified 651
98 Ga0207709_10000111 3300025935 Bacteria 127580
99 Ga0207709_11386355 3300025935 Bacteria 582
100 Ga0207670_11664635 3300025936 Unclassified 543
101 Ga0207669_10063132 3300025937 Bacteria 2285
102 Ga0207704_10654241 3300025938 Bacteria 866
103 Ga0207677_11063187 3300026023 Bacteria 736
104 Ga0207639_11468345 3300026041 Bacteria 640
105 Ga0207702_10560276 3300026078 Bacteria 1118
106 Ga0207641_11298766 3300026088 Bacteria 728
107 Ga0207674_10014017 3300026116 Bacteria 8859
108 Ga0207683_10755550 3300026121 Bacteria 902
109 Ga0209281_1000007 3300027111 Bacteria 938265
110 Ga0209588_1001135 3300027671 Bacteria 6854
111 Ga0268266_10550823 3300028379 Bacteria 1105
112 Ga0268265_10348791 3300028380 Bacteria 1351
113 Ga0265319_1062375 3300028563 Bacteria 1207
114 Ga0307515_10016568 3300028794 Bacteria 13488
115 Ga0307515_10070822 3300028794 Bacteria 4738
116 Ga0265338_10033189 3300028800 Bacteria 5015
117 Ga0265762_1048314 3300030760 Unclassified 848
118 Ga0265760_10083015 3300031090 Bacteria 994
119 Ga0265760_10258923 3300031090 Unclassified 605
120 Ga0265325_10083964 3300031241 Unclassified 1579
121 Ga0265331_10434164 3300031250 Bacteria 590
122 Ga0265327_10012557 3300031251 Bacteria 5702
123 Ga0265316_10370395 3300031344 Bacteria 1035
124 Ga0316579_10128751 3300031691 Bacteria 1219
125 Ga0265314_10364511 3300031711 Bacteria 791
126 Ga0316578_10186210 3300031728 Unclassified 1251
127 Ga0307405_10173496 3300031731 Bacteria 1540
128 Ga0316577_10143904 3300031733 Bacteria 1343
129 Ga0307413_10609019 3300031824 Bacteria 895
130 Ga0307410_10478600 3300031852 Bacteria 1021
131 Ga0307410_10627174 3300031852 Bacteria 899
132 Ga0307410_11975304 3300031852 Bacteria 520
133 Ga0307406_10172895 3300031901 Bacteria 1565
134 Ga0307407_10415712 3300031903 Bacteria 968
135 Ga0307409_100242668 3300031995 Bacteria 1641
136 Ga0307409_102079147 3300031995 Bacteria 598
137 Ga0307409_102746827 3300031995 Bacteria 520
138 Ga0307416_101134350 3300032002 Bacteria 887
139 Ga0307414_10202034 3300032004 Bacteria 1617
140 Ga0307414_10922542 3300032004 Bacteria 801
141 Ga0307411_10094050 3300032005 Bacteria 2100
142 Ga0307411_10789251 3300032005 Bacteria 835
143 Ga0307415_100113492 3300032126 Bacteria 2015
144 Ga0316593_10018037 3300032168 Bacteria 2163
145 Ga0316593_10062408 3300032168 Bacteria 1276
146 Ga0316596_1149608 3300033541 Bacteria 641
147 Ga0373948_0017442 3300034817 Bacteria 1338
148 Ga0373928_0249119 3300035084 Bacteria 529
149 Ga0373934_0175752 3300035086 Unclassified 879
150 Ga0373952_0060529 3300035092 Bacteria 925
151 Ga0373936_0278820 3300035113 Bacteria 751
152 Ga0373956_0010970 3300035119 Bacteria 3729
153 Ga0373957_0028076 3300035120 Bacteria 2048
154 Ga0373955_0190796 3300035172 Unclassified 1218
155 Ga0373931_0504334 3300035691 Bacteria 781
156 Ga0373931_1230018 3300035691 Bacteria 513
157 Ga0373927_0081090 3300035695 Bacteria 2103
158 Ga0373933_0000034 3300035724 Bacteria 83243
159 Ga0373933_0392313 3300035724 Bacteria 905
160 Ga0373933_0700748 3300035724 Bacteria 666
161 Ga0373947_0771883 3300035725 Unclassified 656
162 Ga0373937_0000001 3300036401 Bacteria 478903
163 Ga0373937_0223132 3300036401 Bacteria 1774
164 Ga0373925_1228126 3300037068 Bacteria 616
165 Ga0436361_0796155 3300039447 Bacteria 8850
166 Ga0439461_0010810 3300041410 Bacteria 1683
167 Ga0451794_48726 3300041446 Bacteria 666
168 Ga0451791_0860348 3300041451 Bacteria 536
169 Ga0451797_1587335 3300041453 Bacteria 1089
170 Ga0451795_1097443 3300041456 Bacteria 589
171 Ga0451800_0771616 3300041459 Bacteria 545
172 Ga0451805_055637 3300041461 Bacteria 538
173 Ga0451804_0153612 3300041463 Bacteria 900
174 Ga0451849_0418868 3300041505 Bacteria 1006
175 Ga0451855_1465734 3300041511 Bacteria 742
176 Ga0451853_0597047 3300041512 Bacteria 1019
177 Ga0439437_000955 3300042000 Bacteria 3011
178 Ga0439445_0056112 3300042004 Bacteria 1071
179 Ga0450911_000084 3300042115 Bacteria 37818
180 Ga0450912_003447 3300042116 Bacteria 1126
181 Ga0450917_000101 3300042120 Bacteria 5224
182 Ga0450922_028653 3300042124 Bacteria 600
183 Ga0450888_000038 3300042126 Bacteria 9334
184 Ga0450890_001097 3300042127 Bacteria 3945
185 Ga0450891_000246 3300042129 Bacteria 5494
186 Ga0450892_000862 3300042130 Bacteria 3303
187 Ga0450902_076547 3300042137 Bacteria 586
188 Ga0450889_000093 3300042144 Bacteria 8414
189 Ga0439444_0203110 3300042437 Bacteria 501
190 Ga0450916_019177 3300042530 Bacteria 927
191 Ga0450893_0003312 3300042532 Bacteria 2534
192 Ga0451577_0567837 3300042876 Bacteria 1030
193 Ga0451577_0602671 3300042876 Bacteria 997
194 Ga0453683_0212095 3300044673 Bacteria 1230
195 Ga0453684_0810033 3300044712 Bacteria 1009
196 Ga0453684_0812199 3300044712 Bacteria 1008
197 Ga0451576_0009538 3300045051 Bacteria 11245
198 Ga0451576_0181581 3300045051 Bacteria 2197
199 Ga0451576_0228760 3300045051 Bacteria 1942
200 Ga0451576_0441129 3300045051 Bacteria 1366
201 Ga0451576_0949953 3300045051 Bacteria 901
202 Ga0451576_2020924 3300045051 Bacteria 594
203 Ga0495651_0005814 3300046462 Bacteria 9411
204 Ga0495653_0115206 3300046463 Bacteria 1924
205 Ga0495653_0225666 3300046463 Bacteria 1257
206 Ga0495580_0499769 3300046472 Bacteria 812
207 Ga0495580_0847901 3300046472 Bacteria 590
208 Ga0495608_0554910 3300046511 Unclassified 692
209 Ga0495628_0419215 3300046516 Bacteria 976
210 Ga0495652_0039918 3300046529 Bacteria 4057
211 Ga0495587_0000912 3300046536 Bacteria 19527
212 Ga0495645_0141760 3300046543 Bacteria 1676
213 Ga0495657_0448915 3300046675 Bacteria 755
214 Ga0495599_0905066 3300046678 Unclassified 500
215 Ga0495623_0030174 3300046679 Bacteria 3488
216 Ga0495646_0137888 3300046680 Unclassified 1367
217 Ga0495604_0923915 3300047317 Unclassified 544
218 Ga0495636_0245423 3300047318 Bacteria 827
219 Ga0495675_0001586 3300047444 Bacteria 13704
220 Ga0495675_0251259 3300047444 Unclassified 1062
221 Ga0495675_0571670 3300047444 Bacteria 643
222 Ga0495684_0097067 3300047471 Bacteria 2230
223 Ga0495602_0000056 3300048088 Bacteria 109741
224 Ga0495602_0031296 3300048088 Bacteria 5033
225 Ga0495602_0728122 3300048088 Unclassified 671
226 Ga0496100_0090968 3300048903 Bacteria 2082
227 Ga0496101_0433723 3300048904 Bacteria 1036
228 Ga0496105_0168660 3300048908 Bacteria 1795
229 Ga0496106_0529405 3300048909 Bacteria 946
230 Ga0496107_0058098 3300048910 Bacteria 2797
231 Ga0496108_0330486 3300048911 Unclassified 1329
232 Ga0496109_0314351 3300048912 Bacteria 1478
233 Ga0496109_0762896 3300048912 Bacteria 905
234 Ga0496114_0034066 3300048917 Bacteria 4199
235 Ga0496121_0007616 3300048924 Bacteria 13022
236 Ga0496125_0031471 3300048928 Bacteria 4728
237 Ga0496125_0356416 3300048928 Bacteria 871
238 Ga0496125_0372596 3300048928 Bacteria 844
239 Ga0496126_0156079 3300048929 Bacteria 1953
240 Ga0496126_0181491 3300048929 Bacteria 1788
241 Ga0501306_014007 3300049127 Bacteria 1053
242 Ga0501306_024998 3300049127 Bacteria 857
243 Ga0501309_001769 3300049129 Bacteria 2205
244 Ga0501310_001378 3300049130 Bacteria 2203
245 Ga0501304_002583 3300049160 Bacteria 1271
246 Ga0501305_005535 3300049161 Bacteria 1535
247 Ga0501307_004588 3300049162 Bacteria 1419
248 Ga0501294_015945 3300049517 Bacteria 779
249 Ga0501311_024032 3300049527 Bacteria 847
250 Ga0501312_007340 3300049528 Bacteria 1402
251 Ga0501313_017874 3300049529 Bacteria 859
252 Ga0501314_002027 3300049530 Bacteria 1533
253 Ga0501315_007224 3300049531 Bacteria 1261
254 Ga0501316_023949 3300049532 Bacteria 786
255 Ga0501317_003095 3300049533 Bacteria 1628
256 Ga0501318_005169 3300049534 Bacteria 1281
257 Ga0501318_032605 3300049534 Bacteria 715
258 Ga0501320_018176 3300049536 Bacteria 792
259 Ga0501322_004476 3300049538 Bacteria 941
260 Ga0501323_039659 3300049539 Bacteria 687
261 Ga0501324_016911 3300049540 Bacteria 719
262 Ga0501325_020193 3300049541 Bacteria 697
263 Ga0501329_03877 3300049545 Bacteria 778
264 Ga0501334_09885 3300049550 Bacteria 683
265 Ga0501031_0076754 3300049568 Bacteria 2176
266 Ga0501032_0006297 3300049569 Bacteria 8743
267 Ga0501039_0306200 3300049575 Bacteria 1249
268 Ga0501039_0483080 3300049575 Bacteria 973
269 Ga0501071_0946193 3300049587 Bacteria 665
270 Ga0501077_0490242 3300049593 Bacteria 788
271 Ga0501202_014864 3300049652 Bacteria 1493
272 Ga0501206_070288 3300049653 Bacteria 591
273 Ga0501211_000169 3300049658 Bacteria 5302
274 Ga0501217_307798 3300049661 Bacteria 524
275 Ga0501222_003160 3300049662 Bacteria 2264
276 Ga0501235_026669 3300049669 Bacteria 1295
277 Ga0501236_019289 3300049670 Bacteria 993
278 Ga0501242_061698 3300049674 Bacteria 571
279 Ga0501258_016784 3300049687 Bacteria 830
280 Ga0501221_000307 3300049704 Bacteria 7344
281 Ga0501229_005873 3300049706 Bacteria 1513
282 Ga0501232_008626 3300049757 Bacteria 1106
283 Ga0501264_005050 3300049761 Bacteria 1198
284 Ga0501267_000659 3300049764 Bacteria 2743
285 Ga0501272_009520 3300049769 Bacteria 1076
286 Ga0501226_003946 3300049853 Bacteria 1737
287 nmdc:mga0k408_20083_c1 3300050493 Bacteria 3738
288 nmdc:mga0k408_2385_c2 3300050493 Bacteria 8224
289 nmdc:mga07m45_273201_c2 3300050496 Bacteria 616
290 nmdc:mga06r32_294149_c1 3300050510 Bacteria 1610
291 nmdc:mga08y16_667708_c1 3300050511 Bacteria 1042
292 nmdc:mga08x19_1225502_c1 3300050514 Bacteria 532
293 Ga0495601_0049610 3300053077 Bacteria 2647
294 Ga0500607_025590 3300053121 Bacteria 3283
295 Ga0500624_080786 3300053157 Bacteria 648
296 Ga0500636_0009564 3300053177 Bacteria 5639
297 Ga0500637_0015554 3300053178 Bacteria 4035
298 Ga0500625_093527 3300053729 Bacteria 1279
299 Ga0500596_030743 3300053735 Bacteria 832

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025935 Ga0207709_11386355 Ga0207709_113863552 79
2 3300050511 nmdc:mga08y16_667708_c1 nmdc:mga08y16_667708_c1_482_757 79
3 3300049587 Ga0501071_0946193 Ga0501071_0946193_172_432 80
4 3300005841 Ga0068863_101304606 Ga0068863_1013046062 81
5 3300025936 Ga0207670_11664635 Ga0207670_116646351 81
6 3300026116 Ga0207674_10014017 Ga0207674_100140173 81
7 3300028563 Ga0265319_1062375 Ga0265319_10623752 81
8 3300028800 Ga0265338_10033189 Ga0265338_100331894 81
9 3300031241 Ga0265325_10083964 Ga0265325_100839642 81
10 3300031344 Ga0265316_10370395 Ga0265316_103703951 81
11 3300031711 Ga0265314_10364511 Ga0265314_103645112 81
12 3300035725 Ga0373947_0771883 Ga0373947_0771883_310_573 81
13 3300045051 Ga0451576_0181581 Ga0451576_0181581_630_893 81
14 3300046472 Ga0495580_0499769 Ga0495580_0499769_11_274 81
15 3300046472 Ga0495580_0847901 Ga0495580_0847901_306_569 81
16 3300046516 Ga0495628_0419215 Ga0495628_0419215_634_897 81
17 3300046543 Ga0495645_0141760 Ga0495645_0141760_982_1245 81
18 3300046678 Ga0495599_0905066 Ga0495599_0905066_197_460 81
19 3300046680 Ga0495646_0137888 Ga0495646_0137888_62_325 81
20 3300047444 Ga0495675_0251259 Ga0495675_0251259_390_653 81
21 3300047471 Ga0495684_0097067 Ga0495684_0097067_1737_2000 81
22 3300053077 Ga0495601_0049610 Ga0495601_0049610_1750_2013 81
23 iso_pu_bacteria 2643221544 2643743060 81
24 iso_pu_bacteria 2643221639 2644218523 81
25 iso_pu_bacteria 2643221646 2644260418 81
26 iso_pu_bacteria 2738543013 2739248267 81
27 iso_pu_bacteria 2904479285 2904480792 81
28 iso_pu_bacteria 2932422444 2932424035 81
29 3300005445 Ga0070708_100068257 Ga0070708_1000682572 83
30 3300005467 Ga0070706_100649475 Ga0070706_1006494752 83
31 3300005843 Ga0068860_100861348 Ga0068860_1008613482 83
32 3300025910 Ga0207684_10886966 Ga0207684_108869662 83
33 3300026088 Ga0207641_11298766 Ga0207641_112987662 83
34 3300031731 Ga0307405_10173496 Ga0307405_101734963 83
35 3300031852 Ga0307410_10478600 Ga0307410_104786002 83
36 3300031852 Ga0307410_11975304 Ga0307410_119753042 83
37 3300031903 Ga0307407_10415712 Ga0307407_104157122 83
38 3300031995 Ga0307409_100242668 Ga0307409_1002426682 83
39 3300032002 Ga0307416_101134350 Ga0307416_1011343502 83
40 3300032005 Ga0307411_10789251 Ga0307411_107892512 83
41 3300032126 Ga0307415_100113492 Ga0307415_1001134922 83
42 3300032168 Ga0316593_10018037 Ga0316593_100180373 83
43 3300041451 Ga0451791_0860348 Ga0451791_0860348_70_327 83
44 3300041456 Ga0451795_1097443 Ga0451795_1097443_264_530 83
45 3300041505 Ga0451849_0418868 Ga0451849_0418868_426_683 83
46 3300041512 Ga0451853_0597047 Ga0451853_0597047_679_936 83
47 3300042437 Ga0439444_0203110 Ga0439444_0203110_93_368 83
48 3300049534 Ga0501318_032605 Ga0501318_032605_435_695 83
49 3300050510 nmdc:mga06r32_294149_c1 nmdc:mga06r32_294149_c1_779_1042 83
50 3300004799 Ga0058863_11528505 Ga0058863_115285051 84
51 3300004800 Ga0058861_11957894 Ga0058861_119578942 84
52 3300004803 Ga0058862_11853061 Ga0058862_118530611 84
53 3300004803 Ga0058862_12441055 Ga0058862_124410552 84
54 3300005336 Ga0070680_101407062 Ga0070680_1014070622 84
55 3300005436 Ga0070713_100235070 Ga0070713_1002350703 84
56 3300005445 Ga0070708_101933644 Ga0070708_1019336442 84
57 3300005458 Ga0070681_10464168 Ga0070681_104641682 84
58 3300005468 Ga0070707_100866308 Ga0070707_1008663081 84
59 3300005518 Ga0070699_100275092 Ga0070699_1002750922 84
60 3300005518 Ga0070699_100547113 Ga0070699_1005471132 84
61 3300005536 Ga0070697_100283534 Ga0070697_1002835342 84
62 3300005536 Ga0070697_100778544 Ga0070697_1007785441 84
63 3300005545 Ga0070695_101408308 Ga0070695_1014083082 84
64 3300009093 Ga0105240_10011302 Ga0105240_100113022 84
65 3300009545 Ga0105237_10004245 Ga0105237_1000424510 84
66 3300010159 Ga0099796_10192390 Ga0099796_101923902 84
67 3300013104 Ga0157370_10730523 Ga0157370_107305232 84
68 3300020070 Ga0206356_11405752 Ga0206356_114057522 84
69 3300024227 Ga0228598_1064083 Ga0228598_10640831 84
70 3300025912 Ga0207707_10470902 Ga0207707_104709022 84
71 3300025913 Ga0207695_10004215 Ga0207695_1000421510 84
72 3300025914 Ga0207671_10160951 Ga0207671_101609514 84
73 3300025921 Ga0207652_10337278 Ga0207652_103372782 84
74 3300025928 Ga0207700_11290357 Ga0207700_112903572 84
75 3300030760 Ga0265762_1048314 Ga0265762_10483142 84
76 3300031090 Ga0265760_10083015 Ga0265760_100830151 84
77 3300031090 Ga0265760_10258923 Ga0265760_102589231 84
78 3300031728 Ga0316578_10186210 Ga0316578_101862102 84
79 3300031733 Ga0316577_10143904 Ga0316577_101439042 84
80 3300035086 Ga0373934_0175752 Ga0373934_0175752_35_340 84
81 3300035119 Ga0373956_0010970 Ga0373956_0010970_21_326 84
82 3300035120 Ga0373957_0028076 Ga0373957_0028076_786_1091 84
83 3300035172 Ga0373955_0190796 Ga0373955_0190796_181_486 84
84 3300035724 Ga0373933_0000034 Ga0373933_0000034_8762_9067 84
85 3300036401 Ga0373937_0000001 Ga0373937_0000001_247434_247739 84
86 3300036401 Ga0373937_0223132 Ga0373937_0223132_231_491 84
87 3300044712 Ga0453684_0810033 Ga0453684_0810033_163_426 84
88 3300046462 Ga0495651_0005814 Ga0495651_0005814_802_1107 84
89 3300046463 Ga0495653_0115206 Ga0495653_0115206_1330_1635 84
90 3300046463 Ga0495653_0225666 Ga0495653_0225666_964_1224 84
91 3300046511 Ga0495608_0554910 Ga0495608_0554910_69_374 84
92 3300046529 Ga0495652_0039918 Ga0495652_0039918_52_357 84
93 3300046536 Ga0495587_0000912 Ga0495587_0000912_2439_2744 84
94 3300046675 Ga0495657_0448915 Ga0495657_0448915_158_418 84
95 3300046679 Ga0495623_0030174 Ga0495623_0030174_2851_3156 84
96 3300047317 Ga0495604_0923915 Ga0495604_0923915_67_372 84
97 3300047444 Ga0495675_0001586 Ga0495675_0001586_8571_8876 84
98 3300047444 Ga0495675_0571670 Ga0495675_0571670_119_379 84
99 3300048088 Ga0495602_0000056 Ga0495602_0000056_105597_105902 84
100 3300048088 Ga0495602_0031296 Ga0495602_0031296_1006_1266 84
101 3300048088 Ga0495602_0728122 Ga0495602_0728122_270_578 84
102 2162886007 SwRhRL2b_contig_1616504 SwRhRL2b_0742.00006700 85
103 2162886007 SwRhRL2b_contig_37466 SwRhRL2b_0180.00004430 85
104 3300003544 Ga0007417J51691_1041049 Ga0007417J51691_10410492 85
105 3300003791 Ga0055530_10092352 Ga0055530_100923521 85
106 3300003792 Ga0055540_1050213 Ga0055540_10502131 85
107 3300003794 Ga0055531_10000500 Ga0055531_1000050026 85
108 3300005289 Ga0065704_10041388 Ga0065704_100413882 85
109 3300005289 Ga0065704_10117241 Ga0065704_101172413 85
110 3300005331 Ga0070670_100992313 Ga0070670_1009923132 85
111 3300005335 Ga0070666_10699993 Ga0070666_106999931 85
112 3300005338 Ga0068868_100250372 Ga0068868_1002503723 85
113 3300005339 Ga0070660_101144957 Ga0070660_1011449572 85
114 3300005343 Ga0070687_100301947 Ga0070687_1003019472 85
115 3300005354 Ga0070675_101129783 Ga0070675_1011297832 85
116 3300005356 Ga0070674_100057937 Ga0070674_1000579371 85
117 3300005364 Ga0070673_101281203 Ga0070673_1012812032 85
118 3300005366 Ga0070659_101996429 Ga0070659_1019964291 85
119 3300005438 Ga0070701_10153363 Ga0070701_101533633 85
120 3300005445 Ga0070708_102081283 Ga0070708_1020812831 85
121 3300005456 Ga0070678_100881928 Ga0070678_1008819281 85
122 3300005547 Ga0070693_100501830 Ga0070693_1005018301 85
123 3300005548 Ga0070665_101124563 Ga0070665_1011245631 85
124 3300005564 Ga0070664_100652607 Ga0070664_1006526071 85
125 3300005718 Ga0068866_10024434 Ga0068866_100244341 85
126 3300005844 Ga0068862_100787052 Ga0068862_1007870521 85
127 3300006195 Ga0075366_10107738 Ga0075366_101077383 85
128 3300006852 Ga0075433_11189463 Ga0075433_111894631 85
129 3300006881 Ga0068865_100282545 Ga0068865_1002825452 85
130 3300006946 Ga0079104_1000055 Ga0079104_100005535 85
131 3300007265 Ga0099794_10062561 Ga0099794_100625612 85
132 3300007265 Ga0099794_10076960 Ga0099794_100769602 85
133 3300007265 Ga0099794_10177254 Ga0099794_101772543 85
134 3300009092 Ga0105250_10001192 Ga0105250_1000119211 85
135 3300009094 Ga0111539_13453028 Ga0111539_134530282 85
136 3300009098 Ga0105245_10103773 Ga0105245_101037733 85
137 3300009148 Ga0105243_10002600 Ga0105243_100026005 85
138 3300009174 Ga0105241_10230366 Ga0105241_102303663 85
139 3300009176 Ga0105242_12689804 Ga0105242_126898041 85
140 3300009553 Ga0105249_13508913 Ga0105249_135089131 85
141 3300010375 Ga0105239_10417172 Ga0105239_104171722 85
142 3300011119 Ga0105246_11118836 Ga0105246_111188362 85
143 3300013102 Ga0157371_10601419 Ga0157371_106014192 85
144 3300013297 Ga0157378_10152966 Ga0157378_101529663 85
145 3300013297 Ga0157378_10167039 Ga0157378_101670392 85
146 3300013306 Ga0163162_10426021 Ga0163162_104260212 85
147 3300013306 Ga0163162_10903500 Ga0163162_109035001 85
148 3300013308 Ga0157375_10044060 Ga0157375_100440604 85
149 3300013308 Ga0157375_10188136 Ga0157375_101881362 85
150 3300014325 Ga0163163_10022210 Ga0163163_100222103 85
151 3300014325 Ga0163163_10732562 Ga0163163_107325621 85
152 3300014325 Ga0163163_11065845 Ga0163163_110658453 85
153 3300014326 Ga0157380_10328721 Ga0157380_103287213 85
154 3300014969 Ga0157376_10052430 Ga0157376_100524302 85
155 3300014969 Ga0157376_12666545 Ga0157376_126665451 85
156 3300017792 Ga0163161_10077396 Ga0163161_100773963 85
157 3300020078 Ga0206352_10989137 Ga0206352_109891372 85
158 3300021361 Ga0213872_10126370 Ga0213872_101263702 85
159 3300025298 Ga0209050_1001301 Ga0209050_10013013 85
160 3300025303 Ga0209051_1044141 Ga0209051_10441411 85
161 3300025304 Ga0209257_1000131 Ga0209257_100013113 85
162 3300025304 Ga0209257_1143970 Ga0209257_11439701 85
163 3300025711 Ga0207696_1001691 Ga0207696_10016913 85
164 3300025919 Ga0207657_11019487 Ga0207657_110194871 85
165 3300025923 Ga0207681_11580133 Ga0207681_115801332 85
166 3300025925 Ga0207650_10263018 Ga0207650_102630181 85
167 3300025926 Ga0207659_10581825 Ga0207659_105818251 85
168 3300025927 Ga0207687_10066964 Ga0207687_100669643 85
169 3300025935 Ga0207709_10000111 Ga0207709_1000011184 85
170 3300025937 Ga0207669_10063132 Ga0207669_100631322 85
171 3300025938 Ga0207704_10654241 Ga0207704_106542411 85
172 3300026023 Ga0207677_11063187 Ga0207677_110631872 85
173 3300026041 Ga0207639_11468345 Ga0207639_114683451 85
174 3300026078 Ga0207702_10560276 Ga0207702_105602762 85
175 3300026121 Ga0207683_10755550 Ga0207683_107555501 85
176 3300027111 Ga0209281_1000007 Ga0209281_1000007794 85
177 3300027671 Ga0209588_1001135 Ga0209588_10011357 85
178 3300028379 Ga0268266_10550823 Ga0268266_105508232 85
179 3300028380 Ga0268265_10348791 Ga0268265_103487912 85
180 3300028794 Ga0307515_10016568 Ga0307515_1001656814 85
181 3300028794 Ga0307515_10070822 Ga0307515_100708225 85
182 3300031250 Ga0265331_10434164 Ga0265331_104341642 85
183 3300031251 Ga0265327_10012557 Ga0265327_100125572 85
184 3300031691 Ga0316579_10128751 Ga0316579_101287512 85
185 3300031824 Ga0307413_10609019 Ga0307413_106090192 85
186 3300031852 Ga0307410_10627174 Ga0307410_106271742 85
187 3300031901 Ga0307406_10172895 Ga0307406_101728953 85
188 3300031995 Ga0307409_102079147 Ga0307409_1020791472 85
189 3300031995 Ga0307409_102746827 Ga0307409_1027468271 85
190 3300032004 Ga0307414_10202034 Ga0307414_102020343 85
191 3300032004 Ga0307414_10922542 Ga0307414_109225422 85
192 3300032005 Ga0307411_10094050 Ga0307411_100940502 85
193 3300032168 Ga0316593_10062408 Ga0316593_100624082 85
194 3300033541 Ga0316596_1149608 Ga0316596_11496081 85
195 3300034817 Ga0373948_0017442 Ga0373948_0017442_425_688 85
196 3300035084 Ga0373928_0249119 Ga0373928_0249119_207_470 85
197 3300035092 Ga0373952_0060529 Ga0373952_0060529_65_322 85
198 3300035113 Ga0373936_0278820 Ga0373936_0278820_127_390 85
199 3300035691 Ga0373931_0504334 Ga0373931_0504334_13_276 85
200 3300035691 Ga0373931_1230018 Ga0373931_1230018_45_311 85
201 3300035695 Ga0373927_0081090 Ga0373927_0081090_114_377 85
202 3300035724 Ga0373933_0392313 Ga0373933_0392313_134_397 85
203 3300035724 Ga0373933_0700748 Ga0373933_0700748_396_653 85
204 3300037068 Ga0373925_1228126 Ga0373925_1228126_225_482 85
205 3300039447 Ga0436361_0796155 Ga0436361_0796155_734_994 85
206 3300041410 Ga0439461_0010810 Ga0439461_0010810_662_925 85
207 3300041446 Ga0451794_48726 Ga0451794_48726_304_561 85
208 3300041453 Ga0451797_1587335 Ga0451797_1587335_88_351 85
209 3300041459 Ga0451800_0771616 Ga0451800_0771616_157_420 85
210 3300041461 Ga0451805_055637 Ga0451805_055637_100_360 85
211 3300041463 Ga0451804_0153612 Ga0451804_0153612_62_319 85
212 3300041511 Ga0451855_1465734 Ga0451855_1465734_293_556 85
213 3300042000 Ga0439437_000955 Ga0439437_000955_1013_1276 85
214 3300042004 Ga0439445_0056112 Ga0439445_0056112_708_971 85
215 3300042115 Ga0450911_000084 Ga0450911_000084_4970_5230 85
216 3300042116 Ga0450912_003447 Ga0450912_003447_195_458 85
217 3300042120 Ga0450917_000101 Ga0450917_000101_3166_3429 85
218 3300042124 Ga0450922_028653 Ga0450922_028653_32_295 85
219 3300042126 Ga0450888_000038 Ga0450888_000038_7924_8187 85
220 3300042127 Ga0450890_001097 Ga0450890_001097_967_1230 85
221 3300042129 Ga0450891_000246 Ga0450891_000246_4494_4757 85
222 3300042130 Ga0450892_000862 Ga0450892_000862_2202_2465 85
223 3300042137 Ga0450902_076547 Ga0450902_076547_91_351 85
224 3300042144 Ga0450889_000093 Ga0450889_000093_5298_5561 85
225 3300042530 Ga0450916_019177 Ga0450916_019177_554_814 85
226 3300042532 Ga0450893_0003312 Ga0450893_0003312_1089_1352 85
227 3300042876 Ga0451577_0567837 Ga0451577_0567837_139_405 85
228 3300042876 Ga0451577_0602671 Ga0451577_0602671_410_670 85
229 3300044673 Ga0453683_0212095 Ga0453683_0212095_647_910 85
230 3300044712 Ga0453684_0812199 Ga0453684_0812199_259_522 85
231 3300045051 Ga0451576_0009538 Ga0451576_0009538_6137_6397 85
232 3300045051 Ga0451576_0228760 Ga0451576_0228760_1465_1734 85
233 3300045051 Ga0451576_0441129 Ga0451576_0441129_711_974 85
234 3300045051 Ga0451576_0949953 Ga0451576_0949953_546_809 85
235 3300045051 Ga0451576_2020924 Ga0451576_2020924_249_509 85
236 3300047318 Ga0495636_0245423 Ga0495636_0245423_117_377 85
237 3300048903 Ga0496100_0090968 Ga0496100_0090968_583_840 85
238 3300048904 Ga0496101_0433723 Ga0496101_0433723_452_709 85
239 3300048908 Ga0496105_0168660 Ga0496105_0168660_192_449 85
240 3300048909 Ga0496106_0529405 Ga0496106_0529405_450_707 85
241 3300048910 Ga0496107_0058098 Ga0496107_0058098_960_1217 85
242 3300048911 Ga0496108_0330486 Ga0496108_0330486_494_751 85
243 3300048912 Ga0496109_0314351 Ga0496109_0314351_825_1082 85
244 3300048912 Ga0496109_0762896 Ga0496109_0762896_510_767 85
245 3300048917 Ga0496114_0034066 Ga0496114_0034066_89_346 85
246 3300048924 Ga0496121_0007616 Ga0496121_0007616_512_772 85
247 3300048928 Ga0496125_0031471 Ga0496125_0031471_950_1210 85
248 3300048928 Ga0496125_0356416 Ga0496125_0356416_570_830 85
249 3300048928 Ga0496125_0372596 Ga0496125_0372596_491_751 85
250 3300048929 Ga0496126_0156079 Ga0496126_0156079_119_379 85
251 3300048929 Ga0496126_0181491 Ga0496126_0181491_1357_1617 85
252 3300049127 Ga0501306_014007 Ga0501306_014007_411_671 85
253 3300049127 Ga0501306_024998 Ga0501306_024998_480_743 85
254 3300049129 Ga0501309_001769 Ga0501309_001769_490_753 85
255 3300049130 Ga0501310_001378 Ga0501310_001378_490_753 85
256 3300049160 Ga0501304_002583 Ga0501304_002583_362_625 85
257 3300049161 Ga0501305_005535 Ga0501305_005535_489_752 85
258 3300049162 Ga0501307_004588 Ga0501307_004588_478_741 85
259 3300049517 Ga0501294_015945 Ga0501294_015945_439_702 85
260 3300049527 Ga0501311_024032 Ga0501311_024032_490_753 85
261 3300049528 Ga0501312_007340 Ga0501312_007340_647_910 85
262 3300049529 Ga0501313_017874 Ga0501313_017874_482_745 85
263 3300049530 Ga0501314_002027 Ga0501314_002027_487_750 85
264 3300049531 Ga0501315_007224 Ga0501315_007224_360_623 85
265 3300049532 Ga0501316_023949 Ga0501316_023949_481_744 85
266 3300049533 Ga0501317_003095 Ga0501317_003095_489_752 85
267 3300049534 Ga0501318_005169 Ga0501318_005169_482_745 85
268 3300049536 Ga0501320_018176 Ga0501320_018176_489_752 85
269 3300049538 Ga0501322_004476 Ga0501322_004476_560_823 85
270 3300049539 Ga0501323_039659 Ga0501323_039659_47_310 85
271 3300049540 Ga0501324_016911 Ga0501324_016911_35_298 85
272 3300049541 Ga0501325_020193 Ga0501325_020193_35_298 85
273 3300049545 Ga0501329_03877 Ga0501329_03877_351_611 85
274 3300049550 Ga0501334_09885 Ga0501334_09885_318_578 85
275 3300049568 Ga0501031_0076754 Ga0501031_0076754_440_706 85
276 3300049569 Ga0501032_0006297 Ga0501032_0006297_6818_7075 85
277 3300049575 Ga0501039_0306200 Ga0501039_0306200_376_633 85
278 3300049575 Ga0501039_0483080 Ga0501039_0483080_155_412 85
279 3300049593 Ga0501077_0490242 Ga0501077_0490242_440_697 85
280 3300049652 Ga0501202_014864 Ga0501202_014864_439_702 85
281 3300049653 Ga0501206_070288 Ga0501206_070288_84_347 85
282 3300049658 Ga0501211_000169 Ga0501211_000169_133_396 85
283 3300049661 Ga0501217_307798 Ga0501217_307798_133_396 85
284 3300049662 Ga0501222_003160 Ga0501222_003160_910_1173 85
285 3300049669 Ga0501235_026669 Ga0501235_026669_717_980 85
286 3300049670 Ga0501236_019289 Ga0501236_019289_168_431 85
287 3300049674 Ga0501242_061698 Ga0501242_061698_233_496 85
288 3300049687 Ga0501258_016784 Ga0501258_016784_527_790 85
289 3300049704 Ga0501221_000307 Ga0501221_000307_4175_4438 85
290 3300049706 Ga0501229_005873 Ga0501229_005873_854_1117 85
291 3300049757 Ga0501232_008626 Ga0501232_008626_52_315 85
292 3300049761 Ga0501264_005050 Ga0501264_005050_790_1053 85
293 3300049764 Ga0501267_000659 Ga0501267_000659_186_449 85
294 3300049769 Ga0501272_009520 Ga0501272_009520_534_797 85
295 3300049853 Ga0501226_003946 Ga0501226_003946_76_339 85
296 3300050493 nmdc:mga0k408_20083_c1 nmdc:mga0k408_20083_c1_159_422 85
297 3300050493 nmdc:mga0k408_2385_c2 nmdc:mga0k408_2385_c2_264_527 85
298 3300050496 nmdc:mga07m45_273201_c2 nmdc:mga07m45_273201_c2_128_391 85
299 3300050514 nmdc:mga08x19_1225502_c1 nmdc:mga08x19_1225502_c1_203_463 85
300 3300053121 Ga0500607_025590 Ga0500607_025590_369_632 85
301 3300053157 Ga0500624_080786 Ga0500624_080786_88_351 85
302 3300053177 Ga0500636_0009564 Ga0500636_0009564_3904_4167 85
303 3300053178 Ga0500637_0015554 Ga0500637_0015554_3018_3281 85
304 3300053729 Ga0500625_093527 Ga0500625_093527_167_430 85
305 3300053735 Ga0500596_030743 Ga0500596_030743_328_591 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9733 19 85
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9725 19 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9721 21 85
8c95-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.956 19 85
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9451 19 85
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9721 21 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9293 21 85 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8937 21 85 2.40.50.100
af_Q9ZVX0_51_147_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8763 8 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8725 29 83 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A2E9FJN9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.005 21 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A378VWB8-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.005 21 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A5C8B9S1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.003 25 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A0K8NY46-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 1.001 20 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A0A8XHI5-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9984 20 85 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.47 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map