F397964

General Info

Members Datasets Scaffolds Average Seq Length
305 184 610 194

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100330839|Ga0070688_1003308391
Length 223
Sequence VLSVVVSALALHSSCMTVDWGSERGTNDGANGSATATNGHRFEDVVLPHLDAAYRLARWLMRNDHDAEDVVQEASLRALRYFRTFTGGNGRAWFLRIVRNTCWGWRESGTHAPTDPFDEEQHSRTQPASDPETLLLQTDDVRLIERALSNLPVRFRELLVLRELEDLSYRELADVLNIPMGTVMSGLSRARQAFRGVLENQLKESGMPTRTNLRDYEADEALV

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
151 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.28
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 23.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100330839 3300005365 Unclassified 1110
2 SwRhRL3b_contig_737371 2162886006 Unclassified 1039
3 MBSR1b_contig_9259085 2162886012 Bacteria 1076
4 JGI24746J21847_1006489 3300001977 Bacteria 1811
5 JGI24751J29686_10043117 3300002459 Bacteria 932
6 Ga0065704_10404955 3300005289 Unclassified 748
7 Ga0065712_10159355 3300005290 Bacteria 1313
8 Ga0065712_10378399 3300005290 Bacteria 755
9 Ga0065715_10148372 3300005293 Bacteria 1759
10 Ga0065715_10162553 3300005293 Bacteria 1615
11 Ga0065707_10083255 3300005295 Bacteria 9778
12 Ga0065707_10231178 3300005295 Unclassified 1188
13 Ga0070676_10016590 3300005328 Bacteria 4074
14 Ga0070676_10475096 3300005328 Unclassified 883
15 Ga0070690_100100481 3300005330 Bacteria 1917
16 Ga0070670_100002297 3300005331 Bacteria 15754
17 Ga0070670_100248379 3300005331 Unclassified 1550
18 Ga0070670_100281764 3300005331 Bacteria 1451
19 Ga0070677_10001030 3300005333 Bacteria 8976
20 Ga0070677_10002521 3300005333 Bacteria 5860
21 Ga0068869_100013890 3300005334 Bacteria 5369
22 Ga0068869_100034726 3300005334 Bacteria 3569
23 Ga0070666_10002329 3300005335 Bacteria 11478
24 Ga0070680_100064606 3300005336 Bacteria 2999
25 Ga0068868_100060451 3300005338 Bacteria 3000
26 Ga0070660_100438608 3300005339 Unclassified 1082
27 Ga0070689_100166263 3300005340 Unclassified 1785
28 Ga0070689_100205166 3300005340 Bacteria 1611
29 Ga0070687_100000631 3300005343 Bacteria 11651
30 Ga0070661_100018130 3300005344 Bacteria 5003
31 Ga0070661_100480289 3300005344 Unclassified 992
32 Ga0070692_10158926 3300005345 Bacteria 1293
33 Ga0070669_100010504 3300005353 Bacteria 6576
34 Ga0070675_100058427 3300005354 Plasmid 3181
35 Ga0070675_100092438 3300005354 Bacteria 2536
36 Ga0070675_100259184 3300005354 Bacteria 1523
37 Ga0070675_100935390 3300005354 Bacteria 795
38 Ga0070671_100027633 3300005355 Bacteria 4671
39 Ga0070674_100000763 3300005356 Bacteria 16535
40 Ga0070674_100577405 3300005356 Bacteria 947
41 Ga0070673_100395075 3300005364 Unclassified 1235
42 Ga0070673_100553515 3300005364 Bacteria 1045
43 Ga0070688_100027367 3300005365 Bacteria 3396
44 Ga0070688_100175838 3300005365 Bacteria 1481
45 Ga0070659_100103545 3300005366 Unclassified 2293
46 Ga0070659_100195834 3300005366 Bacteria 1662
47 Ga0070667_100020242 3300005367 Bacteria 5524
48 Ga0070703_10086859 3300005406 Bacteria 1077
49 Ga0070701_10059966 3300005438 Bacteria 2002
50 Ga0070705_100336583 3300005440 Unclassified 1095
51 Ga0070700_100108852 3300005441 Unclassified 1839
52 Ga0070694_100059549 3300005444 Bacteria 2601
53 Ga0070694_100526032 3300005444 Bacteria 944
54 Ga0070663_100186008 3300005455 Bacteria 1614
55 Ga0070662_100034169 3300005457 Bacteria 3584
56 Ga0070685_10043965 3300005466 Bacteria 2555
57 Ga0070685_10256175 3300005466 Bacteria 1161
58 Ga0070672_100306636 3300005543 Bacteria 1347
59 Ga0070686_100010406 3300005544 Bacteria 5243
60 Ga0070686_100042394 3300005544 Bacteria 2850
61 Ga0070665_100116804 3300005548 Unclassified 2671
62 Ga0070664_100029806 3300005564 Bacteria 4550
63 Ga0070664_100036447 3300005564 Bacteria 4132
64 Ga0068857_100125356 3300005577 Bacteria 2314
65 Ga0068857_100792711 3300005577 Unclassified 904
66 Ga0068854_100018919 3300005578 Bacteria 4631
67 Ga0070702_100529103 3300005615 Unclassified 871
68 Ga0068852_100126691 3300005616 Unclassified 2346
69 Ga0068859_100112766 3300005617 Bacteria 2782
70 Ga0068859_100979433 3300005617 Unclassified 928
71 Ga0068864_100016074 3300005618 Bacteria 6227
72 Ga0068866_10104722 3300005718 Bacteria 1567
73 Ga0068861_100020735 3300005719 Bacteria 4712
74 Ga0068861_100159126 3300005719 Bacteria 1861
75 Ga0068870_10000623 3300005840 Bacteria 13495
76 Ga0068870_10027382 3300005840 Bacteria 2850
77 Ga0068870_10191575 3300005840 Bacteria 1234
78 Ga0068863_100008405 3300005841 Bacteria 10081
79 Ga0068858_100075058 3300005842 Bacteria 3140
80 Ga0068858_100318486 3300005842 Unclassified 1486
81 Ga0068858_101037876 3300005842 Bacteria 804
82 Ga0068858_101145178 3300005842 Bacteria 764
83 Ga0068860_100058342 3300005843 Bacteria 3669
84 Ga0068862_100146752 3300005844 Bacteria 2097
85 Ga0068862_100192368 3300005844 Bacteria 1836
86 Ga0068862_100220290 3300005844 Bacteria 1718
87 Ga0081455_10004043 3300005937 Bacteria 16624
88 Ga0097621_100091085 3300006237 Bacteria 2552
89 Ga0097621_100093110 3300006237 Bacteria 2525
90 Ga0097621_100249493 3300006237 Unclassified 1554
91 Ga0097621_100835604 3300006237 Unclassified 855
92 Ga0068871_100009895 3300006358 Bacteria 6922
93 Ga0068871_100009899 3300006358 Bacteria 6921
94 Ga0068871_100326203 3300006358 Bacteria 1353
95 Ga0075428_100598164 3300006844 Unclassified 1178
96 Ga0075428_100833085 3300006844 Bacteria 980
97 Ga0075431_100117697 3300006847 Bacteria 2742
98 Ga0075433_10000700 3300006852 Bacteria 22873
99 Ga0075433_10290627 3300006852 Bacteria 1448
100 Ga0075434_100158625 3300006871 Bacteria 2282
101 Ga0075434_100177370 3300006871 Bacteria 2150
102 Ga0075429_100413497 3300006880 Unclassified 1181
103 Ga0068865_100000933 3300006881 Bacteria 16600
104 Ga0068865_100014516 3300006881 Bacteria 5006
105 Ga0097620_100112772 3300006931 Bacteria 2782
106 Ga0097620_100979585 3300006931 Unclassified 928
107 Ga0111539_10007303 3300009094 Bacteria 14149
108 Ga0111539_10011876 3300009094 Bacteria 10916
109 Ga0111539_10027790 3300009094 Bacteria 6910
110 Ga0111539_10053622 3300009094 Bacteria 4800
111 Ga0111539_10099364 3300009094 Unclassified 3417
112 Ga0111539_10185455 3300009094 Unclassified 2430
113 Ga0111539_10298578 3300009094 Bacteria 1875
114 Ga0105245_10171525 3300009098 Bacteria 2066
115 Ga0105245_10334107 3300009098 Bacteria 1496
116 Ga0105245_10454844 3300009098 Bacteria 1289
117 Ga0114129_10192840 3300009147 Bacteria 2765
118 Ga0114129_10205804 3300009147 Bacteria 2663
119 Ga0114129_10546004 3300009147 Bacteria 1508
120 Ga0114129_10555215 3300009147 Bacteria 1493
121 Ga0105242_10002954 3300009176 Bacteria 13300
122 Ga0105242_10129512 3300009176 Bacteria 2176
123 Ga0105242_10570779 3300009176 Bacteria 1088
124 Ga0105248_10004970 3300009177 Bacteria 14693
125 Ga0105248_10278690 3300009177 Bacteria 1882
126 Ga0105248_10314551 3300009177 Bacteria 1764
127 Ga0105248_10326030 3300009177 Bacteria 1730
128 Ga0105249_10010150 3300009553 Bacteria 8266
129 Ga0105249_10052473 3300009553 Bacteria 3723
130 Ga0105249_10074030 3300009553 Bacteria 3151
131 Ga0157319_1005411 3300012497 Unclassified 878
132 Ga0157374_10126873 3300013296 Bacteria 2467
133 Ga0157374_10900526 3300013296 Unclassified 902
134 Ga0157378_10003933 3300013297 Bacteria 13145
135 Ga0163162_10001897 3300013306 Bacteria 19696
136 Ga0157375_10061628 3300013308 Unclassified 3725
137 Ga0163163_11425442 3300014325 Unclassified 754
138 Ga0157380_10004937 3300014326 Bacteria 9298
139 Ga0157380_10009369 3300014326 Bacteria 7012
140 Ga0157380_10023063 3300014326 Bacteria 4693
141 Ga0157380_10027868 3300014326 Bacteria 4302
142 Ga0157380_10215778 3300014326 Bacteria 1713
143 Ga0157380_10724986 3300014326 Unclassified 1002
144 Ga0157377_10201648 3300014745 Unclassified 1263
145 Ga0157379_10010869 3300014968 Bacteria 7934
146 Ga0157376_10060109 3300014969 Bacteria 3190
147 Ga0157376_10285632 3300014969 Bacteria 1556
148 Ga0157376_10511547 3300014969 Bacteria 1182
149 Ga0163161_10005805 3300017792 Bacteria 8558
150 Ga0207697_10008979 3300025315 Bacteria 4338
151 Ga0207682_10001346 3300025893 Bacteria 11328
152 Ga0207682_10004875 3300025893 Bacteria 5533
153 Ga0207688_10015360 3300025901 Bacteria 4153
154 Ga0207680_10120727 3300025903 Bacteria 1713
155 Ga0207645_10016666 3300025907 Bacteria 4859
156 Ga0207645_10162920 3300025907 Bacteria 1459
157 Ga0207643_10000661 3300025908 Bacteria 21517
158 Ga0207660_10027028 3300025917 Bacteria 3912
159 Ga0207657_10399084 3300025919 Unclassified 1082
160 Ga0207649_10385506 3300025920 Unclassified 1045
161 Ga0207681_10237731 3300025923 Unclassified 1416
162 Ga0207681_10897437 3300025923 Bacteria 742
163 Ga0207650_10010572 3300025925 Bacteria 6338
164 Ga0207650_10396076 3300025925 Unclassified 1142
165 Ga0207650_10427729 3300025925 Bacteria 1099
166 Ga0207659_10058644 3300025926 Bacteria 2764
167 Ga0207659_10191652 3300025926 Bacteria 1627
168 Ga0207659_10201293 3300025926 Bacteria 1591
169 Ga0207659_10227610 3300025926 Bacteria 1502
170 Ga0207687_10377232 3300025927 Bacteria 1161
171 Ga0207644_10235269 3300025931 Unclassified 1457
172 Ga0207690_10211142 3300025932 Bacteria 1480
173 Ga0207706_10036302 3300025933 Bacteria 4378
174 Ga0207706_10789730 3300025933 Unclassified 807
175 Ga0207686_10029211 3300025934 Bacteria 3250
176 Ga0207670_10169981 3300025936 Bacteria 1634
177 Ga0207669_10011032 3300025937 Unclassified 4377
178 Ga0207669_10251757 3300025937 Bacteria 1316
179 Ga0207704_10007902 3300025938 Bacteria 5053
180 Ga0207691_10008840 3300025940 Bacteria 9665
181 Ga0207711_10013322 3300025941 Bacteria 6832
182 Ga0207711_10077906 3300025941 Bacteria 2890
183 Ga0207711_10344626 3300025941 Bacteria 1379
184 Ga0207711_10501898 3300025941 Bacteria 1131
185 Ga0207689_10004838 3300025942 Bacteria 12145
186 Ga0207689_10106801 3300025942 Bacteria 2300
187 Ga0207679_10098713 3300025945 Bacteria 2278
188 Ga0207712_10012468 3300025961 Bacteria 5432
189 Ga0207712_10051398 3300025961 Bacteria 2882
190 Ga0207640_10147992 3300025981 Bacteria 1721
191 Ga0207677_10181240 3300026023 Bacteria 1657
192 Ga0207677_10248712 3300026023 Bacteria 1443
193 Ga0207703_10017696 3300026035 Bacteria 5564
194 Ga0207678_10206809 3300026067 Bacteria 1679
195 Ga0207708_10010329 3300026075 Bacteria 6931
196 Ga0207708_10074553 3300026075 Bacteria 2601
197 Ga0207648_10005542 3300026089 Bacteria 12711
198 Ga0207648_10046400 3300026089 Bacteria 3809
199 Ga0207674_10016299 3300026116 Bacteria 8138
200 Ga0207674_10254977 3300026116 Unclassified 1701
201 Ga0207674_10386481 3300026116 Bacteria 1353
202 Ga0207675_100001646 3300026118 Bacteria 22365
203 Ga0207675_100480260 3300026118 Unclassified 1235
204 Ga0207683_10058015 3300026121 Bacteria 3399
205 Ga0207683_10197503 3300026121 Bacteria 1828
206 Ga0209974_10093231 3300027876 Unclassified 1046
207 Ga0207428_10007845 3300027907 Bacteria 9709
208 Ga0207428_10008256 3300027907 Bacteria 9417
209 Ga0207428_10016918 3300027907 Bacteria 6266
210 Ga0207428_10065034 3300027907 Bacteria 2878
211 Ga0207428_10099531 3300027907 Bacteria 2248
212 Ga0268266_10021533 3300028379 Bacteria 5492
213 Ga0268266_10492196 3300028379 Unclassified 1170
214 Ga0268265_10032843 3300028380 Bacteria 3766
215 Ga0268265_10794639 3300028380 Unclassified 922
216 Ga0268264_10054148 3300028381 Bacteria 3349
217 Ga0268264_10193568 3300028381 Unclassified 1855
218 Ga0307408_100043709 3300031548 Bacteria 3189
219 Ga0307408_100067242 3300031548 Bacteria 2635
220 Ga0307410_10415694 3300031852 Unclassified 1090
221 Ga0307407_10146456 3300031903 Bacteria 1530
222 Ga0307416_100174321 3300032002 Bacteria 2007
223 Ga0307416_101231544 3300032002 Unclassified 854
224 Ga0307411_10219613 3300032005 Bacteria 1474
225 Ga0373952_0076635 3300035092 Unclassified 846
226 Ga0373962_0048652 3300035242 Unclassified 1216
227 Ga0373931_0425365 3300035691 Bacteria 845
228 Ga0373935_0453569 3300035692 Bacteria 927
229 Ga0373927_0319289 3300035695 Bacteria 1023
230 Ga0439435_0003141 3300042436 Bacteria 3392
231 Ga0439435_0130456 3300042436 Unclassified 794
232 Ga0451576_0064524 3300045051 Bacteria 3814
233 Ga0451576_0356372 3300045051 Bacteria 1532
234 Ga0495592_0327319 3300046454 Bacteria 989
235 Ga0495638_0003813 3300046460 Bacteria 11704
236 Ga0495645_0128027 3300046543 Bacteria 1782
237 Ga0495599_0321103 3300046678 Bacteria 932
238 Ga0495647_0059451 3300046681 Bacteria 1505
239 Ga0495647_0208314 3300046681 Unclassified 859
240 Ga0495658_0198981 3300046683 Bacteria 1248
241 Ga0495600_0128849 3300046809 Bacteria 1645
242 Ga0495600_0308179 3300046809 Unclassified 998
243 Ga0495684_0102534 3300047471 Bacteria 2163
244 Ga0496101_0010370 3300048904 Bacteria 6153
245 Ga0496102_0403916 3300048905 Bacteria 1284
246 Ga0496104_0027663 3300048907 Bacteria 5250
247 Ga0496104_0143812 3300048907 Unclassified 2291
248 Ga0496106_0072818 3300048909 Bacteria 2628
249 Ga0496107_0059897 3300048910 Bacteria 2756
250 Ga0496108_0580490 3300048911 Unclassified 977
251 Ga0496109_0055899 3300048912 Unclassified 3601
252 Ga0496114_0000473 3300048917 Bacteria 29434
253 Ga0496115_0033651 3300048918 Bacteria 4048
254 Ga0501291_069699 3300049514 Unclassified 679
255 Ga0501299_039374 3300049522 Bacteria 943
256 Ga0501036_0629000 3300049572 Bacteria 889
257 Ga0501039_0005744 3300049575 Bacteria 9393
258 Ga0501040_0007471 3300049576 Bacteria 7078
259 Ga0501041_0029395 3300049577 Bacteria 3315
260 Ga0501041_0664300 3300049577 Bacteria 666
261 Ga0501042_0056859 3300049578 Bacteria 2791
262 Ga0501046_0083141 3300049580 Unclassified 2472
263 Ga0501046_0178925 3300049580 Bacteria 1587
264 Ga0501048_0057098 3300049582 Bacteria 2768
265 Ga0501071_0201859 3300049587 Bacteria 1494
266 Ga0501072_0046606 3300049588 Unclassified 3412
267 Ga0501072_0104819 3300049588 Unclassified 2248
268 Ga0501075_0036721 3300049591 Bacteria 3658
269 Ga0501076_0007382 3300049592 Bacteria 8000
270 Ga0501076_0028445 3300049592 Bacteria 4340
271 Ga0501077_0114522 3300049593 Unclassified 1710
272 Ga0501077_0304109 3300049593 Unclassified 1016
273 Ga0501217_097591 3300049661 Unclassified 831
274 Ga0501079_0030951 3300049741 Bacteria 4112
275 Ga0501080_0451292 3300049742 Unclassified 1153
276 Ga0501081_0004311 3300049743 Bacteria 9117
277 Ga0501081_0056955 3300049743 Unclassified 2702
278 Ga0501081_0727826 3300049743 Bacteria 745
279 Ga0501044_1033154 3300049823 Bacteria 693
280 Ga0501045_0058521 3300049824 Unclassified 2822
281 Ga0501045_0107114 3300049824 Unclassified 2071
282 Ga0501045_0229027 3300049824 Unclassified 1383
283 nmdc:mga05p37_208491_c1 3300050507 Unclassified 2363
284 nmdc:mga05p37_425832_c1 3300050507 Bacteria 1543
285 nmdc:mga05p37_68_c1 3300050507 Bacteria 91472
286 nmdc:mga09592_185769_c1 3300050508 Bacteria 1798
287 nmdc:mga06r32_113673_c1 3300050510 Bacteria 2665
288 nmdc:mga08y16_110088_c1 3300050511 Unclassified 2868
289 nmdc:mga08y16_1888_c1 3300050511 Bacteria 21331
290 nmdc:mga08y16_254947_c1 3300050511 Bacteria 1813
291 nmdc:mga0n895_141431_c1 3300050512 Bacteria 2435
292 nmdc:mga0n895_4950_c1 3300050512 Bacteria 11051
293 nmdc:mga0a205_124260_c1 3300050515 Bacteria 2480
294 nmdc:mga0a205_127351_c1 3300050515 Bacteria 2446
295 nmdc:mga0a205_2715_c1 3300050515 Bacteria 15633
296 Ga0495595_0211324 3300053084 Bacteria 967
297 Ga0495619_0048462 3300053085 Bacteria 2800
298 Ga0501084_0301382 3300054114 Unclassified 1354
299 Ga0590071_000717 3300059421 Bacteria 9385
300 Ga0590074_000264 3300059423 Bacteria 7071
301 Ga0590075_000079 3300059424 Bacteria 24840
302 Ga0590077_000041 3300059426 Bacteria 29107
303 Ga0501082_0060383 3300060353 Bacteria 3265
304 Ga0501082_0722218 3300060353 Unclassified 872
305 Ga0530510_0581376 3300061734 Unclassified 851
306 Ga0070688_100330839
307 SwRhRL3b_contig_737371
308 MBSR1b_contig_9259085
309 JGI24746J21847_1006489
310 JGI24751J29686_10043117
311 Ga0065704_10404955
312 Ga0065712_10159355
313 Ga0065712_10378399
314 Ga0065715_10148372
315 Ga0065715_10162553
316 Ga0065707_10083255
317 Ga0065707_10231178
318 Ga0070676_10016590
319 Ga0070676_10475096
320 Ga0070690_100100481
321 Ga0070670_100002297
322 Ga0070670_100248379
323 Ga0070670_100281764
324 Ga0070677_10001030
325 Ga0070677_10002521
326 Ga0068869_100013890
327 Ga0068869_100034726
328 Ga0070666_10002329
329 Ga0070680_100064606
330 Ga0068868_100060451
331 Ga0070660_100438608
332 Ga0070689_100166263
333 Ga0070689_100205166
334 Ga0070687_100000631
335 Ga0070661_100018130
336 Ga0070661_100480289
337 Ga0070692_10158926
338 Ga0070669_100010504
339 Ga0070675_100058427
340 Ga0070675_100092438
341 Ga0070675_100259184
342 Ga0070675_100935390
343 Ga0070671_100027633
344 Ga0070674_100000763
345 Ga0070674_100577405
346 Ga0070673_100395075
347 Ga0070673_100553515
348 Ga0070688_100027367
349 Ga0070688_100175838
350 Ga0070659_100103545
351 Ga0070659_100195834
352 Ga0070667_100020242
353 Ga0070703_10086859
354 Ga0070701_10059966
355 Ga0070705_100336583
356 Ga0070700_100108852
357 Ga0070694_100059549
358 Ga0070694_100526032
359 Ga0070663_100186008
360 Ga0070662_100034169
361 Ga0070685_10043965
362 Ga0070685_10256175
363 Ga0070672_100306636
364 Ga0070686_100010406
365 Ga0070686_100042394
366 Ga0070665_100116804
367 Ga0070664_100029806
368 Ga0070664_100036447
369 Ga0068857_100125356
370 Ga0068857_100792711
371 Ga0068854_100018919
372 Ga0070702_100529103
373 Ga0068852_100126691
374 Ga0068859_100112766
375 Ga0068859_100979433
376 Ga0068864_100016074
377 Ga0068866_10104722
378 Ga0068861_100020735
379 Ga0068861_100159126
380 Ga0068870_10000623
381 Ga0068870_10027382
382 Ga0068870_10191575
383 Ga0068863_100008405
384 Ga0068858_100075058
385 Ga0068858_100318486
386 Ga0068858_101037876
387 Ga0068858_101145178
388 Ga0068860_100058342
389 Ga0068862_100146752
390 Ga0068862_100192368
391 Ga0068862_100220290
392 Ga0081455_10004043
393 Ga0097621_100091085
394 Ga0097621_100093110
395 Ga0097621_100249493
396 Ga0097621_100835604
397 Ga0068871_100009895
398 Ga0068871_100009899
399 Ga0068871_100326203
400 Ga0075428_100598164
401 Ga0075428_100833085
402 Ga0075431_100117697
403 Ga0075433_10000700
404 Ga0075433_10290627
405 Ga0075434_100158625
406 Ga0075434_100177370
407 Ga0075429_100413497
408 Ga0068865_100000933
409 Ga0068865_100014516
410 Ga0097620_100112772
411 Ga0097620_100979585
412 Ga0111539_10007303
413 Ga0111539_10011876
414 Ga0111539_10027790
415 Ga0111539_10053622
416 Ga0111539_10099364
417 Ga0111539_10185455
418 Ga0111539_10298578
419 Ga0105245_10171525
420 Ga0105245_10334107
421 Ga0105245_10454844
422 Ga0114129_10192840
423 Ga0114129_10205804
424 Ga0114129_10546004
425 Ga0114129_10555215
426 Ga0105242_10002954
427 Ga0105242_10129512
428 Ga0105242_10570779
429 Ga0105248_10004970
430 Ga0105248_10278690
431 Ga0105248_10314551
432 Ga0105248_10326030
433 Ga0105249_10010150
434 Ga0105249_10052473
435 Ga0105249_10074030
436 Ga0157319_1005411
437 Ga0157374_10126873
438 Ga0157374_10900526
439 Ga0157378_10003933
440 Ga0163162_10001897
441 Ga0157375_10061628
442 Ga0163163_11425442
443 Ga0157380_10004937
444 Ga0157380_10009369
445 Ga0157380_10023063
446 Ga0157380_10027868
447 Ga0157380_10215778
448 Ga0157380_10724986
449 Ga0157377_10201648
450 Ga0157379_10010869
451 Ga0157376_10060109
452 Ga0157376_10285632
453 Ga0157376_10511547
454 Ga0163161_10005805
455 Ga0207697_10008979
456 Ga0207682_10001346
457 Ga0207682_10004875
458 Ga0207688_10015360
459 Ga0207680_10120727
460 Ga0207645_10016666
461 Ga0207645_10162920
462 Ga0207643_10000661
463 Ga0207660_10027028
464 Ga0207657_10399084
465 Ga0207649_10385506
466 Ga0207681_10237731
467 Ga0207681_10897437
468 Ga0207650_10010572
469 Ga0207650_10396076
470 Ga0207650_10427729
471 Ga0207659_10058644
472 Ga0207659_10191652
473 Ga0207659_10201293
474 Ga0207659_10227610
475 Ga0207687_10377232
476 Ga0207644_10235269
477 Ga0207690_10211142
478 Ga0207706_10036302
479 Ga0207706_10789730
480 Ga0207686_10029211
481 Ga0207670_10169981
482 Ga0207669_10011032
483 Ga0207669_10251757
484 Ga0207704_10007902
485 Ga0207691_10008840
486 Ga0207711_10013322
487 Ga0207711_10077906
488 Ga0207711_10344626
489 Ga0207711_10501898
490 Ga0207689_10004838
491 Ga0207689_10106801
492 Ga0207679_10098713
493 Ga0207712_10012468
494 Ga0207712_10051398
495 Ga0207640_10147992
496 Ga0207677_10181240
497 Ga0207677_10248712
498 Ga0207703_10017696
499 Ga0207678_10206809
500 Ga0207708_10010329
501 Ga0207708_10074553
502 Ga0207648_10005542
503 Ga0207648_10046400
504 Ga0207674_10016299
505 Ga0207674_10254977
506 Ga0207674_10386481
507 Ga0207675_100001646
508 Ga0207675_100480260
509 Ga0207683_10058015
510 Ga0207683_10197503
511 Ga0209974_10093231
512 Ga0207428_10007845
513 Ga0207428_10008256
514 Ga0207428_10016918
515 Ga0207428_10065034
516 Ga0207428_10099531
517 Ga0268266_10021533
518 Ga0268266_10492196
519 Ga0268265_10032843
520 Ga0268265_10794639
521 Ga0268264_10054148
522 Ga0268264_10193568
523 Ga0307408_100043709
524 Ga0307408_100067242
525 Ga0307410_10415694
526 Ga0307407_10146456
527 Ga0307416_100174321
528 Ga0307416_101231544
529 Ga0307411_10219613
530 Ga0373952_0076635
531 Ga0373962_0048652
532 Ga0373931_0425365
533 Ga0373935_0453569
534 Ga0373927_0319289
535 Ga0439435_0003141
536 Ga0439435_0130456
537 Ga0451576_0064524
538 Ga0451576_0356372
539 Ga0495592_0327319
540 Ga0495638_0003813
541 Ga0495645_0128027
542 Ga0495599_0321103
543 Ga0495647_0059451
544 Ga0495647_0208314
545 Ga0495658_0198981
546 Ga0495600_0128849
547 Ga0495600_0308179
548 Ga0495684_0102534
549 Ga0496101_0010370
550 Ga0496102_0403916
551 Ga0496104_0027663
552 Ga0496104_0143812
553 Ga0496106_0072818
554 Ga0496107_0059897
555 Ga0496108_0580490
556 Ga0496109_0055899
557 Ga0496114_0000473
558 Ga0496115_0033651
559 Ga0501291_069699
560 Ga0501299_039374
561 Ga0501036_0629000
562 Ga0501039_0005744
563 Ga0501040_0007471
564 Ga0501041_0029395
565 Ga0501041_0664300
566 Ga0501042_0056859
567 Ga0501046_0083141
568 Ga0501046_0178925
569 Ga0501048_0057098
570 Ga0501071_0201859
571 Ga0501072_0046606
572 Ga0501072_0104819
573 Ga0501075_0036721
574 Ga0501076_0007382
575 Ga0501076_0028445
576 Ga0501077_0114522
577 Ga0501077_0304109
578 Ga0501217_097591
579 Ga0501079_0030951
580 Ga0501080_0451292
581 Ga0501081_0004311
582 Ga0501081_0056955
583 Ga0501081_0727826
584 Ga0501044_1033154
585 Ga0501045_0058521
586 Ga0501045_0107114
587 Ga0501045_0229027
588 nmdc:mga05p37_208491_c1
589 nmdc:mga05p37_425832_c1
590 nmdc:mga05p37_68_c1
591 nmdc:mga09592_185769_c1
592 nmdc:mga06r32_113673_c1
593 nmdc:mga08y16_110088_c1
594 nmdc:mga08y16_1888_c1
595 nmdc:mga08y16_254947_c1
596 nmdc:mga0n895_141431_c1
597 nmdc:mga0n895_4950_c1
598 nmdc:mga0a205_124260_c1
599 nmdc:mga0a205_127351_c1
600 nmdc:mga0a205_2715_c1
601 Ga0495595_0211324
602 Ga0495619_0048462
603 Ga0501084_0301382
604 Ga0590071_000717
605 Ga0590074_000264
606 Ga0590075_000079
607 Ga0590077_000041
608 Ga0501082_0060383
609 Ga0501082_0722218
610 Ga0530510_0581376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

147

195

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

142

194

0.96

PF04542

Sigma70_r2

Sigma-70 region 2

45

106

0.93

Map