F397926

General Info

Members Datasets Scaffolds Average Seq Length
305 235 293 169

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100100646|Ga0070683_1001006462
Length 183
Sequence MSQPYVGQILMFGGSFAPAGWMICQGQTIPISENDVLFNLIGTTYGGDGQSTFNLPDLQGRVPVHMGTGPGLSTYIIGQNGGVEQVTLTTQQIPQHNHNVLTFTGAPGGNSNKVTNSTYFADQAATVPGGGSLYCYGAGGGTQQAMSPSIVGGTGGSQPHENIQPILTVTYVISLFGVYPTPT

Samples

Sample ID Description Type Environment
1 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
2 2739367656 Pedobacter sp. CF523 Isolate Unclassified
3 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
4 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
5 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
6 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
7 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
8 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
9 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
10 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
11 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
12 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
13 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
14 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
170 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
171 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
172 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
173 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
174 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
180 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
181 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
182 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
185 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
186 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
187 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
188 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
191 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
192 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
193 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
194 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
195 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
196 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
197 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
198 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
201 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
202 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
203 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
204 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
205 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
206 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
207 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
208 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
209 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
210 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
224 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.82
Metatranscriptomes 5.25
Isolates 3.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.15
Nodule 2.95
Rhizoplane 0.98
Rhizosphere 80.33
Stem 0
Stem Tuber 0
Unclassified 4.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000925 3300000041 Bacteria 3219
2 ARcpr5yngRDRAFT_c000985 3300000043 Bacteria 3277
3 ARCol0yngRDRAFT_1002028 3300000652 Bacteria 1565
4 JGI24739J22299_10130671 3300001989 Bacteria 747
5 JGI25150J39212_1037492 3300002774 Bacteria 639
6 JGI25153J46596_10001499 3300003215 Bacteria 13924
7 Ga0055524_1001084 3300003775 Bacteria 16642
8 Ga0055528_1036296 3300003790 Bacteria 1180
9 Ga0055530_10030695 3300003791 Bacteria 1420
10 Ga0055531_10022112 3300003794 Bacteria 2437
11 Ga0055531_10023812 3300003794 Bacteria 2281
12 Ga0058859_11646911 3300004798 Bacteria 769
13 Ga0058860_10921656 3300004801 Unclassified 1931
14 Ga0065165_1013696 3300005262 Bacteria 3203
15 Ga0065715_10500064 3300005293 Bacteria 780
16 Ga0070658_10929701 3300005327 Bacteria 756
17 Ga0070683_100100646 3300005329 Bacteria 2721
18 Ga0070683_100286958 3300005329 Bacteria 1565
19 Ga0070683_100517055 3300005329 Bacteria 1141
20 Ga0070683_101614843 3300005329 Unclassified 623
21 Ga0070690_100302714 3300005330 Bacteria 1147
22 Ga0070666_10002501 3300005335 Bacteria 11120
23 Ga0070680_100392667 3300005336 Bacteria 1182
24 Ga0070660_100101140 3300005339 Bacteria 2284
25 Ga0070689_100000856 3300005340 Bacteria 18891
26 Ga0070689_100040981 3300005340 Bacteria 3553
27 Ga0070661_100000114 3300005344 Bacteria 67216
28 Ga0070661_100004215 3300005344 Bacteria 9920
29 Ga0070661_100031443 3300005344 Bacteria 3840
30 Ga0070661_100076182 3300005344 Bacteria 2472
31 Ga0070661_100228969 3300005344 Bacteria 1428
32 Ga0070673_100200738 3300005364 Bacteria 1717
33 Ga0070688_100112074 3300005365 Bacteria 1815
34 Ga0070659_100032185 3300005366 Bacteria 4066
35 Ga0070709_10045709 3300005434 Bacteria 2719
36 Ga0070714_100059118 3300005435 Bacteria 3286
37 Ga0070714_100070362 3300005435 Bacteria 3024
38 Ga0070710_10174325 3300005437 Bacteria 1342
39 Ga0070710_10349154 3300005437 Bacteria 979
40 Ga0070701_10200370 3300005438 Bacteria 1180
41 Ga0070711_100873662 3300005439 Bacteria 766
42 Ga0070700_100147831 3300005441 Bacteria 1604
43 Ga0070663_100004336 3300005455 Bacteria 8319
44 Ga0070707_100131150 3300005468 Bacteria 2437
45 Ga0070699_100007235 3300005518 Bacteria 9657
46 Ga0070679_100027584 3300005530 Bacteria 5590
47 Ga0070684_100365031 3300005535 Bacteria 1329
48 Ga0068853_100027869 3300005539 Bacteria 4749
49 Ga0068853_100288417 3300005539 Bacteria 1514
50 Ga0068853_101534704 3300005539 Bacteria 645
51 Ga0070686_100195663 3300005544 Bacteria 1446
52 Ga0070696_100837913 3300005546 Bacteria 759
53 Ga0070665_101300091 3300005548 Bacteria 737
54 Ga0068855_100000288 3300005563 Bacteria 62320
55 Ga0068855_100021912 3300005563 Bacteria 7659
56 Ga0068854_100078016 3300005578 Bacteria 2439
57 Ga0068856_100062835 3300005614 Bacteria 3668
58 Ga0068852_100121489 3300005616 Bacteria 2392
59 Ga0068852_100785822 3300005616 Bacteria 965
60 Ga0068859_100057777 3300005617 Bacteria 3907
61 Ga0068859_100061241 3300005617 Bacteria 3792
62 Ga0068859_100094382 3300005617 Bacteria 3044
63 Ga0068864_100557076 3300005618 Bacteria 1109
64 Ga0068864_101724900 3300005618 Unclassified 631
65 Ga0068863_100006096 3300005841 Bacteria 11824
66 Ga0068863_100671211 3300005841 Bacteria 1029
67 Ga0068858_100050439 3300005842 Bacteria 3852
68 Ga0068862_100064198 3300005844 Bacteria 3161
69 Ga0081539_10002485 3300005985 Bacteria 25925
70 Ga0070717_10454136 3300006028 Bacteria 1155
71 Ga0075365_10042819 3300006038 Bacteria 2962
72 Ga0075365_10113481 3300006038 Bacteria 1864
73 Ga0070715_10105555 3300006163 Bacteria 1321
74 Ga0097621_100160018 3300006237 Bacteria 1935
75 Ga0075428_100099848 3300006844 Bacteria 3165
76 Ga0075433_10003716 3300006852 Bacteria 11814
77 Ga0075434_100004729 3300006871 Bacteria 12313
78 Ga0075436_100654377 3300006914 Unclassified 776
79 Ga0097620_100057780 3300006931 Bacteria 3907
80 Ga0097620_100061237 3300006931 Bacteria 3792
81 Ga0097620_100094381 3300006931 Bacteria 3044
82 Ga0105240_10102238 3300009093 Bacteria 3483
83 Ga0105240_11256789 3300009093 Bacteria 782
84 Ga0111539_10090260 3300009094 Unclassified 3601
85 Ga0105247_10014746 3300009101 Bacteria 4684
86 Ga0105247_11328132 3300009101 Unclassified 579
87 Ga0105243_10001691 3300009148 Bacteria 19003
88 Ga0105241_10010296 3300009174 Bacteria 6864
89 Ga0105241_10051066 3300009174 Bacteria 3153
90 Ga0105241_10163325 3300009174 Bacteria 1833
91 Ga0105241_10207894 3300009174 Bacteria 1639
92 Ga0105242_10001738 3300009176 Bacteria 17212
93 Ga0105248_10039673 3300009177 Bacteria 5277
94 Ga0105248_10292993 3300009177 Bacteria 1832
95 Ga0105248_10471352 3300009177 Bacteria 1415
96 Ga0105237_10027342 3300009545 Bacteria 5824
97 Ga0105237_10073053 3300009545 Bacteria 3423
98 Ga0105238_10025461 3300009551 Bacteria 6032
99 Ga0105238_10095373 3300009551 Bacteria 2962
100 Ga0105249_10032118 3300009553 Bacteria 4749
101 Ga0105249_10393698 3300009553 Bacteria 1414
102 Ga0105239_10002938 3300010375 Bacteria 21270
103 Ga0105239_10030365 3300010375 Bacteria 5942
104 Ga0105239_10181920 3300010375 Bacteria 2352
105 Ga0105239_10340276 3300010375 Bacteria 1693
106 Ga0157370_10032018 3300013104 Bacteria 5138
107 Ga0157370_10208733 3300013104 Bacteria 1810
108 Ga0157369_10000428 3300013105 Bacteria 55858
109 Ga0157369_10015644 3300013105 Bacteria 8549
110 Ga0157369_10073425 3300013105 Bacteria 3670
111 Ga0157378_10000002 3300013297 Bacteria 222652
112 Ga0157378_10284446 3300013297 Bacteria 1595
113 Ga0157378_10870200 3300013297 Bacteria 930
114 Ga0157378_10874061 3300013297 Unclassified 928
115 Ga0163162_10003565 3300013306 Bacteria 14887
116 Ga0157372_10004527 3300013307 Bacteria 14815
117 Ga0157372_10146032 3300013307 Bacteria 2727
118 Ga0157372_10191580 3300013307 Bacteria 2368
119 Ga0157375_10006599 3300013308 Bacteria 10097
120 Ga0163163_10005607 3300014325 Bacteria 10874
121 Ga0163163_10178734 3300014325 Unclassified 2169
122 Ga0163163_11202401 3300014325 Bacteria 821
123 Ga0157379_10185242 3300014968 Bacteria 1881
124 Ga0213876_10101938 3300021384 Bacteria 1522
125 Ga0209436_112705 3300025208 Bacteria 1417
126 Ga0207425_1014226 3300025245 Bacteria 1812
127 Ga0209565_1000011 3300025263 Bacteria 637062
128 Ga0209673_1002226 3300025273 Bacteria 14092
129 Ga0209675_1026657 3300025291 Bacteria 1434
130 Ga0209564_1027393 3300025295 Bacteria 1852
131 Ga0209758_1012613 3300025297 Bacteria 4708
132 Ga0209050_1010125 3300025298 Bacteria 4692
133 Ga0209256_1000016 3300025299 Bacteria 599092
134 Ga0209257_1002046 3300025304 Bacteria 21436
135 Ga0207692_10221948 3300025898 Bacteria 1121
136 Ga0207647_10283996 3300025904 Bacteria 944
137 Ga0207654_10017661 3300025911 Bacteria 3735
138 Ga0207654_10044055 3300025911 Bacteria 2532
139 Ga0207654_10908496 3300025911 Bacteria 638
140 Ga0207707_10229737 3300025912 Bacteria 1614
141 Ga0207695_10004105 3300025913 Bacteria 20014
142 Ga0207695_10219796 3300025913 Bacteria 1807
143 Ga0207671_10006979 3300025914 Bacteria 9911
144 Ga0207671_10185866 3300025914 Bacteria 1619
145 Ga0207660_10473787 3300025917 Bacteria 1014
146 Ga0207657_10170315 3300025919 Bacteria 1764
147 Ga0207649_10000011 3300025920 Bacteria 266219
148 Ga0207649_10012084 3300025920 Bacteria 4778
149 Ga0207649_10182059 3300025920 Bacteria 1471
150 Ga0207652_10002385 3300025921 Bacteria 15871
151 Ga0207694_10015220 3300025924 Bacteria 5802
152 Ga0207694_10232087 3300025924 Bacteria 1507
153 Ga0207664_10031667 3300025929 Bacteria 4048
154 Ga0207664_10047857 3300025929 Bacteria 3361
155 Ga0207670_10000357 3300025936 Bacteria 26785
156 Ga0207670_10188618 3300025936 Bacteria 1559
157 Ga0207667_10000234 3300025949 Bacteria 77157
158 Ga0207667_10006113 3300025949 Bacteria 14632
159 Ga0207712_10029942 3300025961 Bacteria 3656
160 Ga0207640_10013754 3300025981 Bacteria 4646
161 Ga0207639_10003733 3300026041 Bacteria 10252
162 Ga0207639_10041118 3300026041 Bacteria 3456
163 Ga0207678_10001190 3300026067 Bacteria 23844
164 Ga0207678_10650331 3300026067 Bacteria 926
165 Ga0207708_10211382 3300026075 Bacteria 1551
166 Ga0207702_10086744 3300026078 Bacteria 2730
167 Ga0207702_10190383 3300026078 Bacteria 1895
168 Ga0207641_10040000 3300026088 Bacteria 3922
169 Ga0207641_10666927 3300026088 Bacteria 1022
170 Ga0207676_10632752 3300026095 Bacteria 1031
171 Ga0207676_11455623 3300026095 Unclassified 681
172 Ga0207674_10462552 3300026116 Bacteria 1226
173 Ga0207698_10203011 3300026142 Bacteria 1777
174 Ga0207698_11370223 3300026142 Bacteria 722
175 Ga0268266_11161009 3300028379 Bacteria 747
176 Ga0268265_10033720 3300028380 Bacteria 3725
177 Ga0265327_10000782 3300031251 Bacteria 49078
178 Ga0307408_100020144 3300031548 Bacteria 4496
179 Ga0307406_10018584 3300031901 Bacteria 4064
180 Ga0307406_10474512 3300031901 Unclassified 1009
181 Ga0307407_10077557 3300031903 Bacteria 1999
182 Ga0307407_10098754 3300031903 Bacteria 1807
183 Ga0307412_10019071 3300031911 Bacteria 4143
184 Ga0307412_10356395 3300031911 Unclassified 1176
185 Ga0307416_100005609 3300032002 Bacteria 7738
186 Ga0307416_102469504 3300032002 Unclassified 619
187 Ga0307414_10002816 3300032004 Bacteria 9166
188 Ga0307415_100017909 3300032126 Bacteria 4261
189 Ga0395899_0149855 3300037312 Bacteria 1654
190 Ga0395900_0851386 3300037418 Unclassified 837
191 Ga0395900_0993808 3300037418 Bacteria 759
192 Ga0395898_0125221 3300037466 Viruses 2462
193 Ga0395898_0821593 3300037466 Bacteria 869
194 Ga0395905_0003836 3300037471 Bacteria 15876
195 Ga0395905_0041336 3300037471 Bacteria 4326
196 Ga0436365_0809618 3300039437 Bacteria 1642
197 Ga0436363_0502656 3300039450 Bacteria 819
198 Ga0453684_0000738 3300044712 Bacteria 114519
199 Ga0466957_0171846 3300044842 Bacteria 1412
200 Ga0466967_0000005 3300045976 Bacteria 149543
201 Ga0495584_0238858 3300046491 Unclassified 924
202 Ga0495596_0128413 3300046500 Viruses 984
203 Ga0495610_0299010 3300046512 Bacteria 621
204 Ga0495628_0057679 3300046516 Bacteria 3055
205 Ga0495609_0028444 3300046538 Bacteria 2550
206 Ga0495621_0025689 3300046539 Bacteria 1981
207 Ga0495597_0089110 3300046542 Bacteria 1311
208 Ga0495622_0067929 3300046557 Bacteria 1647
209 Ga0495668_0192090 3300046616 Bacteria 1118
210 Ga0495625_0071161 3300046660 Bacteria 2441
211 Ga0495661_0176208 3300046665 Bacteria 1136
212 Ga0495669_0253182 3300046684 Bacteria 846
213 Ga0495681_0079021 3300047470 Bacteria 1472
214 Ga0496106_0018837 3300048909 Bacteria 5114
215 Ga0496112_0000055 3300048915 Bacteria 78086
216 Ga0496113_1064810 3300048916 Unclassified 635
217 Ga0496118_0114592 3300048921 Bacteria 1777
218 Ga0496121_0250897 3300048924 Bacteria 1227
219 Ga0496122_0000098 3300048925 Bacteria 198547
220 Ga0496123_0000420 3300048926 Bacteria 77105
221 Ga0496124_0000179 3300048927 Bacteria 125772
222 Ga0496125_0211473 3300048928 Bacteria 1259
223 Ga0501304_007152 3300049160 Viruses 915
224 Ga0501305_023676 3300049161 Unclassified 921
225 Ga0501307_002799 3300049162 Bacteria 1657
226 Ga0501290_004458 3300049513 Bacteria 1743
227 Ga0501291_003559 3300049514 Bacteria 1946
228 Ga0501292_003031 3300049515 Bacteria 2214
229 Ga0501296_000989 3300049519 Bacteria 2829
230 Ga0501299_000592 3300049522 Bacteria 4334
231 Ga0501311_006707 3300049527 Viruses 1306
232 Ga0501312_005858 3300049528 Bacteria 1512
233 Ga0501320_011433 3300049536 Viruses 920
234 Ga0501321_002719 3300049537 Bacteria 1560
235 Ga0501323_004183 3300049539 Unclassified 1513
236 Ga0501199_002596 3300049650 Bacteria 1698
237 Ga0501206_003793 3300049653 Bacteria 1919
238 Ga0501209_001193 3300049656 Bacteria 3570
239 Ga0501214_001502 3300049659 Bacteria 1831
240 Ga0501216_000529 3300049660 Bacteria 4575
241 Ga0501217_007783 3300049661 Bacteria 2302
242 Ga0501223_003232 3300049663 Bacteria 3563
243 Ga0501224_006157 3300049664 Bacteria 1735
244 Ga0501228_000864 3300049666 Bacteria 2060
245 Ga0501233_000404 3300049668 Bacteria 6801
246 Ga0501235_000880 3300049669 Bacteria 6166
247 Ga0501238_071430 3300049671 Unclassified 539
248 Ga0501239_000583 3300049672 Bacteria 2880
249 Ga0501240_000866 3300049673 Unclassified 2727
250 Ga0501243_000234 3300049675 Bacteria 6916
251 Ga0501247_003553 3300049677 Bacteria 1676
252 Ga0501249_000665 3300049679 Bacteria 7869
253 Ga0501251_008580 3300049681 Bacteria 1161
254 Ga0501256_002105 3300049685 Bacteria 1553
255 Ga0501261_001822 3300049690 Bacteria 2622
256 Ga0501225_0002158 3300049705 Bacteria 6092
257 Ga0501234_005549 3300049707 Bacteria 1975
258 Ga0501245_000404 3300049708 Bacteria 5225
259 Ga0501268_000185 3300049765 Bacteria 5880
260 Ga0501269_044903 3300049766 Unclassified 596
261 Ga0501272_001736 3300049769 Bacteria 2104
262 Ga0501273_002734 3300049770 Bacteria 1818
263 Ga0501274_007642 3300049771 Viruses 955
264 Ga0501283_005263 3300049779 Bacteria 1774
265 Ga0501204_014248 3300049850 Viruses 974
266 Ga0501212_001421 3300049851 Unclassified 2694
267 Ga0501226_001599 3300049853 Bacteria 2870
268 nmdc:mga0yw44_204480_c1 3300050492 Bacteria 1305
269 nmdc:mga0yw44_67108_c1 3300050492 Bacteria 2216
270 nmdc:mga0yw44_719495_c1 3300050492 Bacteria 678
271 nmdc:mga06z11_473244_c1 3300050494 Bacteria 758
272 nmdc:mga04h51_377002_c1 3300050495 Bacteria 590
273 nmdc:mga08y16_147731_c1 3300050511 Bacteria 2443
274 nmdc:mga0n895_4370_c1 3300050512 Bacteria 11589
275 nmdc:mga08x19_722937_c1 3300050514 Bacteria 707
276 nmdc:mga0a205_354_c1 3300050515 Bacteria 34678
277 nmdc:mga0sz30_53173_c1 3300050516 Bacteria 1720
278 Ga0500641_0111934 3300053096 Bacteria 1175
279 Ga0500655_012560 3300053133 Bacteria 1540
280 Ga0500658_0046436 3300053134 Bacteria 1759
281 Ga0500559_0014819 3300053136 Bacteria 3294
282 Ga0500604_0035392 3300053151 Bacteria 1485
283 Ga0500620_088076 3300053155 Bacteria 1080
284 Ga0500627_0067224 3300053158 Bacteria 1583
285 Ga0500611_006969 3300053727 Bacteria 1674
286 Ga0501084_0000107 3300054114 Bacteria 62192
287 Ga0587084_024155 3300059477 Bacteria 933
288 Ga0587077_007756 3300059493 Bacteria 1576
289 Ga0587085_004702 3300059506 Bacteria 1566
290 Ga0587091_007312 3300059511 Bacteria 1588
291 Ga0587109_022010 3300059624 Bacteria 1144
292 Ga0587076_005835 3300059645 Bacteria 1613
293 Ga0501082_0490243 3300060353 Bacteria 1074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050494 nmdc:mga06z11_473244_c1 nmdc:mga06z11_473244_c1_305_739 134
2 3300048928 Ga0496125_0211473 Ga0496125_0211473_110_649 138
3 3300053133 Ga0500655_012560 Ga0500655_012560_807_1295 139
4 3300046539 Ga0495621_0025689 Ga0495621_0025689_547_999 145
5 3300046557 Ga0495622_0067929 Ga0495622_0067929_512_997 145
6 3300037312 Ga0395899_0149855 Ga0395899_0149855_922_1407 146
7 3300037418 Ga0395900_0851386 Ga0395900_0851386_110_595 146
8 3300037466 Ga0395898_0125221 Ga0395898_0125221_1269_1754 146
9 3300037471 Ga0395905_0041336 Ga0395905_0041336_1775_2260 146
10 3300050516 nmdc:mga0sz30_53173_c1 nmdc:mga0sz30_53173_c1_1204_1689 146
11 iso_pu_bacteria 2869234852 2869239688 153
12 iso_pu_bacteria 2874109183 2874112225 153
13 iso_pu_bacteria 2878730984 2878735449 153
14 iso_pu_bacteria 2903513507 2903519980 153
15 3300005841 Ga0068863_100671211 Ga0068863_1006712112 154
16 3300046491 Ga0495584_0238858 Ga0495584_0238858_212_685 154
17 3300046500 Ga0495596_0128413 Ga0495596_0128413_117_590 154
18 3300046538 Ga0495609_0028444 Ga0495609_0028444_770_1243 154
19 3300046665 Ga0495661_0176208 Ga0495661_0176208_421_894 154
20 3300047470 Ga0495681_0079021 Ga0495681_0079021_262_735 154
21 3300048916 Ga0496113_1064810 Ga0496113_1064810_139_618 154
22 3300006038 Ga0075365_10042819 Ga0075365_100428194 155
23 3300050492 nmdc:mga0yw44_719495_c1 nmdc:mga0yw44_719495_c1_22_531 155
24 3300050495 nmdc:mga04h51_377002_c1 nmdc:mga04h51_377002_c1_20_529 155
25 3300009094 Ga0111539_10090260 Ga0111539_100902604 156
26 3300009101 Ga0105247_10014746 Ga0105247_100147466 156
27 3300009101 Ga0105247_11328132 Ga0105247_113281321 156
28 3300009148 Ga0105243_10001691 Ga0105243_1000169111 156
29 3300009174 Ga0105241_10163325 Ga0105241_101633252 156
30 3300009176 Ga0105242_10001738 Ga0105242_1000173810 156
31 3300009177 Ga0105248_10039673 Ga0105248_100396737 156
32 3300009177 Ga0105248_10292993 Ga0105248_102929933 156
33 3300009553 Ga0105249_10393698 Ga0105249_103936981 156
34 3300013105 Ga0157369_10000428 Ga0157369_1000042844 156
35 3300013297 Ga0157378_10000002 Ga0157378_100000026 156
36 3300013297 Ga0157378_10284446 Ga0157378_102844463 156
37 3300013306 Ga0163162_10003565 Ga0163162_1000356513 156
38 3300013307 Ga0157372_10146032 Ga0157372_101460323 156
39 3300013308 Ga0157375_10006599 Ga0157375_100065999 156
40 3300014325 Ga0163163_10005607 Ga0163163_100056078 156
41 3300014325 Ga0163163_11202401 Ga0163163_112024011 156
42 3300014968 Ga0157379_10185242 Ga0157379_101852422 156
43 3300048909 Ga0496106_0018837 Ga0496106_0018837_3172_3666 156
44 3300049160 Ga0501304_007152 Ga0501304_007152_223_717 156
45 3300049161 Ga0501305_023676 Ga0501305_023676_201_695 156
46 3300049162 Ga0501307_002799 Ga0501307_002799_223_717 156
47 3300049513 Ga0501290_004458 Ga0501290_004458_1063_1557 156
48 3300049514 Ga0501291_003559 Ga0501291_003559_833_1327 156
49 3300049515 Ga0501292_003031 Ga0501292_003031_325_819 156
50 3300049519 Ga0501296_000989 Ga0501296_000989_1048_1542 156
51 3300049522 Ga0501299_000592 Ga0501299_000592_2386_2880 156
52 3300049527 Ga0501311_006707 Ga0501311_006707_222_716 156
53 3300049528 Ga0501312_005858 Ga0501312_005858_222_716 156
54 3300049536 Ga0501320_011433 Ga0501320_011433_223_717 156
55 3300049537 Ga0501321_002719 Ga0501321_002719_223_717 156
56 3300049539 Ga0501323_004183 Ga0501323_004183_799_1293 156
57 3300049650 Ga0501199_002596 Ga0501199_002596_91_585 156
58 3300049653 Ga0501206_003793 Ga0501206_003793_636_1130 156
59 3300049656 Ga0501209_001193 Ga0501209_001193_1451_1945 156
60 3300049659 Ga0501214_001502 Ga0501214_001502_536_1030 156
61 3300049660 Ga0501216_000529 Ga0501216_000529_3113_3607 156
62 3300049661 Ga0501217_007783 Ga0501217_007783_305_799 156
63 3300049663 Ga0501223_003232 Ga0501223_003232_2546_3040 156
64 3300049664 Ga0501224_006157 Ga0501224_006157_1215_1709 156
65 3300049666 Ga0501228_000864 Ga0501228_000864_274_768 156
66 3300049668 Ga0501233_000404 Ga0501233_000404_785_1279 156
67 3300049669 Ga0501235_000880 Ga0501235_000880_4478_4972 156
68 3300049671 Ga0501238_071430 Ga0501238_071430_23_517 156
69 3300049672 Ga0501239_000583 Ga0501239_000583_362_856 156
70 3300049675 Ga0501243_000234 Ga0501243_000234_6126_6620 156
71 3300049677 Ga0501247_003553 Ga0501247_003553_990_1484 156
72 3300049679 Ga0501249_000665 Ga0501249_000665_4592_5086 156
73 3300049681 Ga0501251_008580 Ga0501251_008580_458_952 156
74 3300049685 Ga0501256_002105 Ga0501256_002105_56_550 156
75 3300049705 Ga0501225_0002158 Ga0501225_0002158_2856_3350 156
76 3300049707 Ga0501234_005549 Ga0501234_005549_187_681 156
77 3300049765 Ga0501268_000185 Ga0501268_000185_4273_4767 156
78 3300049766 Ga0501269_044903 Ga0501269_044903_75_569 156
79 3300049769 Ga0501272_001736 Ga0501272_001736_69_563 156
80 3300049770 Ga0501273_002734 Ga0501273_002734_865_1359 156
81 3300049771 Ga0501274_007642 Ga0501274_007642_252_746 156
82 3300049779 Ga0501283_005263 Ga0501283_005263_762_1256 156
83 3300049850 Ga0501204_014248 Ga0501204_014248_289_783 156
84 3300049851 Ga0501212_001421 Ga0501212_001421_1090_1584 156
85 3300049853 Ga0501226_001599 Ga0501226_001599_144_638 156
86 3300050511 nmdc:mga08y16_147731_c1 nmdc:mga08y16_147731_c1_1399_1914 156
87 3300050512 nmdc:mga0n895_4370_c1 nmdc:mga0n895_4370_c1_8567_9061 156
88 3300050515 nmdc:mga0a205_354_c1 nmdc:mga0a205_354_c1_29483_29977 156
89 3300053096 Ga0500641_0111934 Ga0500641_0111934_653_1153 156
90 3300005329 Ga0070683_100286958 Ga0070683_1002869583 157
91 3300005336 Ga0070680_100392667 Ga0070680_1003926671 157
92 3300005344 Ga0070661_100228969 Ga0070661_1002289692 157
93 3300005455 Ga0070663_100004336 Ga0070663_1000043365 157
94 3300005530 Ga0070679_100027584 Ga0070679_1000275847 157
95 3300006163 Ga0070715_10105555 Ga0070715_101055552 157
96 3300010375 Ga0105239_10340276 Ga0105239_103402762 157
97 3300025912 Ga0207707_10229737 Ga0207707_102297373 157
98 3300025917 Ga0207660_10473787 Ga0207660_104737872 157
99 3300025920 Ga0207649_10182059 Ga0207649_101820592 157
100 3300025921 Ga0207652_10002385 Ga0207652_100023853 157
101 3300026067 Ga0207678_10001190 Ga0207678_1000119021 157
102 3300026067 Ga0207678_10650331 Ga0207678_106503311 157
103 3300044842 Ga0466957_0171846 Ga0466957_0171846_724_1218 157
104 3300045976 Ga0466967_0000005 Ga0466967_0000005_71416_71907 157
105 3300046516 Ga0495628_0057679 Ga0495628_0057679_237_728 157
106 3300059493 Ga0587077_007756 Ga0587077_007756_482_970 157
107 3300005339 Ga0070660_100101140 Ga0070660_1001011402 160
108 3300005563 Ga0068855_100000288 Ga0068855_10000028820 160
109 3300025919 Ga0207657_10170315 Ga0207657_101703153 160
110 3300025949 Ga0207667_10000234 Ga0207667_1000023460 160
111 iso_pu_bacteria 2739367656 2739616494 161
112 3300037418 Ga0395900_0993808 Ga0395900_0993808_186_677 162
113 3300044712 Ga0453684_0000738 Ga0453684_0000738_87758_88270 163
114 3300048921 Ga0496118_0114592 Ga0496118_0114592_812_1318 163
115 3300048925 Ga0496122_0000098 Ga0496122_0000098_113706_114212 163
116 3300048926 Ga0496123_0000420 Ga0496123_0000420_25757_26263 163
117 3300048927 Ga0496124_0000179 Ga0496124_0000179_61161_61667 163
118 3300059506 Ga0587085_004702 Ga0587085_004702_668_1216 163
119 iso_pu_bacteria 2513237164 2514035503 163
120 iso_pu_bacteria 2958064165 2958065579 163
121 iso_pu_bacteria 2970489779 2970493469 163
122 iso_pu_bacteria 2970510686 2970515585 163
123 iso_pu_bacteria 2987652177 2987655890 163
124 iso_pu_bacteria 3004232784 3004234636 163
125 iso_pu_bacteria 8006933436 8006935784 163
126 3300004801 Ga0058860_10921656 Ga0058860_109216564 164
127 3300005435 Ga0070714_100059118 Ga0070714_1000591183 164
128 3300005618 Ga0068864_100557076 Ga0068864_1005570762 164
129 3300006914 Ga0075436_100654377 Ga0075436_1006543771 164
130 3300014325 Ga0163163_10178734 Ga0163163_101787343 164
131 3300025929 Ga0207664_10047857 Ga0207664_100478575 164
132 3300026095 Ga0207676_10632752 Ga0207676_106327522 164
133 3300046542 Ga0495597_0089110 Ga0495597_0089110_663_1229 164
134 3300050514 nmdc:mga08x19_722937_c1 nmdc:mga08x19_722937_c1_56_556 164
135 3300053136 Ga0500559_0014819 Ga0500559_0014819_230_775 164
136 3300005330 Ga0070690_100302714 Ga0070690_1003027142 165
137 3300005340 Ga0070689_100040981 Ga0070689_1000409813 165
138 3300005365 Ga0070688_100112074 Ga0070688_1001120743 165
139 3300005366 Ga0070659_100032185 Ga0070659_1000321853 165
140 3300005544 Ga0070686_100195663 Ga0070686_1001956632 165
141 3300025936 Ga0207670_10188618 Ga0207670_101886182 165
142 3300037471 Ga0395905_0003836 Ga0395905_0003836_5372_5884 165
143 3300004798 Ga0058859_11646911 Ga0058859_116469111 166
144 3300005293 Ga0065715_10500064 Ga0065715_105000641 166
145 3300005329 Ga0070683_100517055 Ga0070683_1005170551 166
146 3300005340 Ga0070689_100000856 Ga0070689_1000008564 166
147 3300005344 Ga0070661_100031443 Ga0070661_1000314433 166
148 3300005364 Ga0070673_100200738 Ga0070673_1002007381 166
149 3300005437 Ga0070710_10349154 Ga0070710_103491541 166
150 3300005438 Ga0070701_10200370 Ga0070701_102003701 166
151 3300005441 Ga0070700_100147831 Ga0070700_1001478312 166
152 3300005468 Ga0070707_100131150 Ga0070707_1001311505 166
153 3300005518 Ga0070699_100007235 Ga0070699_1000072356 166
154 3300005535 Ga0070684_100365031 Ga0070684_1003650312 166
155 3300005539 Ga0068853_101534704 Ga0068853_1015347041 166
156 3300005546 Ga0070696_100837913 Ga0070696_1008379131 166
157 3300005617 Ga0068859_100057777 Ga0068859_1000577774 166
158 3300005617 Ga0068859_100061241 Ga0068859_1000612414 166
159 3300005617 Ga0068859_100094382 Ga0068859_1000943824 166
160 3300005841 Ga0068863_100006096 Ga0068863_1000060967 166
161 3300005842 Ga0068858_100050439 Ga0068858_1000504392 166
162 3300006028 Ga0070717_10454136 Ga0070717_104541363 166
163 3300006237 Ga0097621_100160018 Ga0097621_1001600181 166
164 3300006852 Ga0075433_10003716 Ga0075433_100037166 166
165 3300006871 Ga0075434_100004729 Ga0075434_1000047295 166
166 3300006931 Ga0097620_100057780 Ga0097620_1000577803 166
167 3300006931 Ga0097620_100061237 Ga0097620_1000612371 166
168 3300006931 Ga0097620_100094381 Ga0097620_1000943814 166
169 3300009177 Ga0105248_10471352 Ga0105248_104713522 166
170 3300013297 Ga0157378_10870200 Ga0157378_108702001 166
171 3300013297 Ga0157378_10874061 Ga0157378_108740612 166
172 3300025904 Ga0207647_10283996 Ga0207647_102839961 166
173 3300025936 Ga0207670_10000357 Ga0207670_1000035718 166
174 3300026075 Ga0207708_10211382 Ga0207708_102113822 166
175 3300026088 Ga0207641_10040000 Ga0207641_100400005 166
176 3300026088 Ga0207641_10666927 Ga0207641_106669272 166
177 3300026116 Ga0207674_10462552 Ga0207674_104625521 166
178 3300031251 Ga0265327_10000782 Ga0265327_100007823 166
179 3300031548 Ga0307408_100020144 Ga0307408_1000201446 166
180 3300031901 Ga0307406_10018584 Ga0307406_100185843 166
181 3300031901 Ga0307406_10474512 Ga0307406_104745121 166
182 3300031903 Ga0307407_10077557 Ga0307407_100775572 166
183 3300031903 Ga0307407_10098754 Ga0307407_100987541 166
184 3300031911 Ga0307412_10019071 Ga0307412_100190713 166
185 3300031911 Ga0307412_10356395 Ga0307412_103563952 166
186 3300032002 Ga0307416_100005609 Ga0307416_1000056092 166
187 3300032002 Ga0307416_102469504 Ga0307416_1024695041 166
188 3300032004 Ga0307414_10002816 Ga0307414_100028167 166
189 3300032126 Ga0307415_100017909 Ga0307415_1000179093 166
190 3300049673 Ga0501240_000866 Ga0501240_000866_804_1328 166
191 3300049690 Ga0501261_001822 Ga0501261_001822_957_1481 166
192 3300049708 Ga0501245_000404 Ga0501245_000404_1303_1827 166
193 3300054114 Ga0501084_0000107 Ga0501084_0000107_14395_14940 166
194 3300059477 Ga0587084_024155 Ga0587084_024155_199_744 166
195 3300059624 Ga0587109_022010 Ga0587109_022010_69_593 166
196 3300060353 Ga0501082_0490243 Ga0501082_0490243_400_945 166
197 3300000041 ARcpr5oldR_c000925 ARcpr5oldR_0009254 167
198 3300000043 ARcpr5yngRDRAFT_c000985 ARcpr5yngRDRAFT_0009854 167
199 3300000652 ARCol0yngRDRAFT_1002028 ARCol0yngRDRAFT_10020283 167
200 3300001989 JGI24739J22299_10130671 JGI24739J22299_101306712 167
201 3300002774 JGI25150J39212_1037492 JGI25150J39212_10374921 167
202 3300003215 JGI25153J46596_10001499 JGI25153J46596_100014997 167
203 3300003775 Ga0055524_1001084 Ga0055524_100108420 167
204 3300003790 Ga0055528_1036296 Ga0055528_10362962 167
205 3300003791 Ga0055530_10030695 Ga0055530_100306952 167
206 3300003794 Ga0055531_10022112 Ga0055531_100221124 167
207 3300003794 Ga0055531_10023812 Ga0055531_100238125 167
208 3300005262 Ga0065165_1013696 Ga0065165_10136965 167
209 3300005327 Ga0070658_10929701 Ga0070658_109297011 167
210 3300005329 Ga0070683_100100646 Ga0070683_1001006462 167
211 3300005329 Ga0070683_101614843 Ga0070683_1016148431 167
212 3300005335 Ga0070666_10002501 Ga0070666_1000250113 167
213 3300005344 Ga0070661_100000114 Ga0070661_10000011452 167
214 3300005344 Ga0070661_100004215 Ga0070661_1000042156 167
215 3300005344 Ga0070661_100076182 Ga0070661_1000761825 167
216 3300005434 Ga0070709_10045709 Ga0070709_100457093 167
217 3300005435 Ga0070714_100070362 Ga0070714_1000703625 167
218 3300005437 Ga0070710_10174325 Ga0070710_101743252 167
219 3300005439 Ga0070711_100873662 Ga0070711_1008736622 167
220 3300005539 Ga0068853_100027869 Ga0068853_1000278693 167
221 3300005539 Ga0068853_100288417 Ga0068853_1002884173 167
222 3300005548 Ga0070665_101300091 Ga0070665_1013000911 167
223 3300005563 Ga0068855_100021912 Ga0068855_1000219123 167
224 3300005578 Ga0068854_100078016 Ga0068854_1000780163 167
225 3300005614 Ga0068856_100062835 Ga0068856_1000628353 167
226 3300005616 Ga0068852_100121489 Ga0068852_1001214892 167
227 3300005616 Ga0068852_100785822 Ga0068852_1007858221 167
228 3300005618 Ga0068864_101724900 Ga0068864_1017249002 167
229 3300005844 Ga0068862_100064198 Ga0068862_1000641983 167
230 3300005985 Ga0081539_10002485 Ga0081539_100024857 167
231 3300006038 Ga0075365_10113481 Ga0075365_101134813 167
232 3300006844 Ga0075428_100099848 Ga0075428_1000998483 167
233 3300009093 Ga0105240_10102238 Ga0105240_101022386 167
234 3300009093 Ga0105240_11256789 Ga0105240_112567892 167
235 3300009174 Ga0105241_10010296 Ga0105241_100102963 167
236 3300009174 Ga0105241_10051066 Ga0105241_100510663 167
237 3300009174 Ga0105241_10207894 Ga0105241_102078942 167
238 3300009545 Ga0105237_10027342 Ga0105237_100273426 167
239 3300009545 Ga0105237_10073053 Ga0105237_100730532 167
240 3300009551 Ga0105238_10025461 Ga0105238_100254616 167
241 3300009551 Ga0105238_10095373 Ga0105238_100953732 167
242 3300009553 Ga0105249_10032118 Ga0105249_100321187 167
243 3300010375 Ga0105239_10002938 Ga0105239_100029382 167
244 3300010375 Ga0105239_10030365 Ga0105239_100303655 167
245 3300010375 Ga0105239_10181920 Ga0105239_101819202 167
246 3300013104 Ga0157370_10032018 Ga0157370_100320183 167
247 3300013104 Ga0157370_10208733 Ga0157370_102087333 167
248 3300013105 Ga0157369_10015644 Ga0157369_100156447 167
249 3300013105 Ga0157369_10073425 Ga0157369_100734252 167
250 3300013307 Ga0157372_10004527 Ga0157372_1000452710 167
251 3300013307 Ga0157372_10191580 Ga0157372_101915802 167
252 3300021384 Ga0213876_10101938 Ga0213876_101019382 167
253 3300025208 Ga0209436_112705 Ga0209436_1127052 167
254 3300025245 Ga0207425_1014226 Ga0207425_10142262 167
255 3300025263 Ga0209565_1000011 Ga0209565_1000011236 167
256 3300025273 Ga0209673_1002226 Ga0209673_100222610 167
257 3300025291 Ga0209675_1026657 Ga0209675_10266572 167
258 3300025295 Ga0209564_1027393 Ga0209564_10273932 167
259 3300025297 Ga0209758_1012613 Ga0209758_10126138 167
260 3300025298 Ga0209050_1010125 Ga0209050_10101254 167
261 3300025299 Ga0209256_1000016 Ga0209256_1000016363 167
262 3300025304 Ga0209257_1002046 Ga0209257_100204618 167
263 3300025898 Ga0207692_10221948 Ga0207692_102219481 167
264 3300025911 Ga0207654_10017661 Ga0207654_100176612 167
265 3300025911 Ga0207654_10044055 Ga0207654_100440552 167
266 3300025911 Ga0207654_10908496 Ga0207654_109084962 167
267 3300025913 Ga0207695_10004105 Ga0207695_100041059 167
268 3300025913 Ga0207695_10219796 Ga0207695_102197962 167
269 3300025914 Ga0207671_10006979 Ga0207671_100069799 167
270 3300025914 Ga0207671_10185866 Ga0207671_101858661 167
271 3300025920 Ga0207649_10000011 Ga0207649_1000001110 167
272 3300025920 Ga0207649_10012084 Ga0207649_100120844 167
273 3300025924 Ga0207694_10015220 Ga0207694_100152205 167
274 3300025924 Ga0207694_10232087 Ga0207694_102320872 167
275 3300025929 Ga0207664_10031667 Ga0207664_100316673 167
276 3300025949 Ga0207667_10006113 Ga0207667_100061133 167
277 3300025961 Ga0207712_10029942 Ga0207712_100299426 167
278 3300025981 Ga0207640_10013754 Ga0207640_100137543 167
279 3300026041 Ga0207639_10003733 Ga0207639_100037333 167
280 3300026041 Ga0207639_10041118 Ga0207639_100411182 167
281 3300026078 Ga0207702_10086744 Ga0207702_100867443 167
282 3300026078 Ga0207702_10190383 Ga0207702_101903834 167
283 3300026095 Ga0207676_11455623 Ga0207676_114556232 167
284 3300026142 Ga0207698_10203011 Ga0207698_102030113 167
285 3300026142 Ga0207698_11370223 Ga0207698_113702231 167
286 3300028379 Ga0268266_11161009 Ga0268266_111610092 167
287 3300028380 Ga0268265_10033720 Ga0268265_100337204 167
288 3300037466 Ga0395898_0821593 Ga0395898_0821593_66_569 167
289 3300039437 Ga0436365_0809618 Ga0436365_0809618_670_1179 167
290 3300039450 Ga0436363_0502656 Ga0436363_0502656_27_539 167
291 3300046512 Ga0495610_0299010 Ga0495610_0299010_36_539 167
292 3300046616 Ga0495668_0192090 Ga0495668_0192090_137_640 167
293 3300046660 Ga0495625_0071161 Ga0495625_0071161_1061_1564 167
294 3300046684 Ga0495669_0253182 Ga0495669_0253182_280_783 167
295 3300048915 Ga0496112_0000055 Ga0496112_0000055_49448_49957 167
296 3300048924 Ga0496121_0250897 Ga0496121_0250897_173_676 167
297 3300050492 nmdc:mga0yw44_204480_c1 nmdc:mga0yw44_204480_c1_557_1078 167
298 3300050492 nmdc:mga0yw44_67108_c1 nmdc:mga0yw44_67108_c1_1026_1529 167
299 3300053134 Ga0500658_0046436 Ga0500658_0046436_1226_1729 167
300 3300053151 Ga0500604_0035392 Ga0500604_0035392_680_1183 167
301 3300053155 Ga0500620_088076 Ga0500620_088076_131_634 167
302 3300053158 Ga0500627_0067224 Ga0500627_0067224_240_743 167
303 3300053727 Ga0500611_006969 Ga0500611_006969_74_577 167
304 3300059511 Ga0587091_007312 Ga0587091_007312_556_1074 167
305 3300059645 Ga0587076_005835 Ga0587076_005835_582_1100 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.99

Feature Viewer

pLDDT pTM Quality
72.95 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map