F397922
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 200 | 610 | 293 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10198084|Ga0070658_101980842 |
| Length | 317 |
| Sequence | LARTRFLKDTGLTVRMTTVMFALGALFVGLVVALMYAVPSQFAWVVAVIGLAVAWGQWYFSDRVAMRGMRAHEVTPEEDPELHGMVDRLCALADMPKPRVAVAATDMPNAFATGRSPDRSVVCVTTGIRTMLTPEELEAVLAHELSHVAHRDVLVMTIASSAGIIAGFLLRSWRFGALMRRGKGGGLFAVVGVVAISLVVYAISFLLLRLLSRYRELCADRSGAYLTQKPGALASALQKISGGIVATPQRDLRASQPMNAFFIAPAITSRTLQALSSTHPTLEQRLDQLARIATELGRPFDGGPATGSPGEPTALGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 62 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 63 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 90 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 91 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 92 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 93 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 96 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 103 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 104 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 111 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 114 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 115 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 116 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 117 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 118 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 119 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 120 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 121 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 122 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 123 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 124 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 133 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 134 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 135 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 178 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 183 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 187 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 188 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 189 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 190 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 191 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 192 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 193 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 194 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 195 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 196 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 197 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 198 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 199 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 200 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.44 |
| Metatranscriptomes | 1.97 |
| Isolates | 4.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.66 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 0.33 |
| Rhizoplane | 6.23 |
| Rhizosphere | 82.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10198084 | 3300005327 | Bacteria | 1694 |
| 2 | JGI24750J21931_1004497 | 3300002070 | Bacteria | 1691 |
| 3 | JGI24738J21930_10001662 | 3300002075 | Bacteria | 6090 |
| 4 | JGI24749J21850_1004669 | 3300002076 | Bacteria | 1920 |
| 5 | JGI24744J21845_10006771 | 3300002077 | Bacteria | 2371 |
| 6 | Ga0070683_100028338 | 3300005329 | Bacteria | 5061 |
| 7 | Ga0070683_100081273 | 3300005329 | Bacteria | 3034 |
| 8 | Ga0070670_100195988 | 3300005331 | Bacteria | 1755 |
| 9 | Ga0070682_100084016 | 3300005337 | Bacteria | 2068 |
| 10 | Ga0070682_100119664 | 3300005337 | Bacteria | 1766 |
| 11 | Ga0068868_100026120 | 3300005338 | Bacteria | 4448 |
| 12 | Ga0068868_100132485 | 3300005338 | Bacteria | 2041 |
| 13 | Ga0070687_100009535 | 3300005343 | Bacteria | 4165 |
| 14 | Ga0070687_100159545 | 3300005343 | Bacteria | 1332 |
| 15 | Ga0070692_10005827 | 3300005345 | Bacteria | 5298 |
| 16 | Ga0070669_100040160 | 3300005353 | Bacteria | 3401 |
| 17 | Ga0070675_100039990 | 3300005354 | Bacteria | 3827 |
| 18 | Ga0070674_100035394 | 3300005356 | Bacteria | 3344 |
| 19 | Ga0070673_100054376 | 3300005364 | Bacteria | 3149 |
| 20 | Ga0070659_100077941 | 3300005366 | Bacteria | 2644 |
| 21 | Ga0070659_100215265 | 3300005366 | Bacteria | 1584 |
| 22 | Ga0070709_10049472 | 3300005434 | Bacteria | 2629 |
| 23 | Ga0070713_100115443 | 3300005436 | Bacteria | 2347 |
| 24 | Ga0070701_10010070 | 3300005438 | Bacteria | 4167 |
| 25 | Ga0070711_100129134 | 3300005439 | Bacteria | 1880 |
| 26 | Ga0070705_100263984 | 3300005440 | Bacteria | 1216 |
| 27 | Ga0070700_100008782 | 3300005441 | Bacteria | 5518 |
| 28 | Ga0070678_100111825 | 3300005456 | Bacteria | 2138 |
| 29 | Ga0068867_100043129 | 3300005459 | Bacteria | 3302 |
| 30 | Ga0070685_10054390 | 3300005466 | Bacteria | 2322 |
| 31 | Ga0070698_100030055 | 3300005471 | Bacteria | 5637 |
| 32 | Ga0070679_100212184 | 3300005530 | Bacteria | 1899 |
| 33 | Ga0070684_100047928 | 3300005535 | Bacteria | 3705 |
| 34 | Ga0070684_100157232 | 3300005535 | Bacteria | 2061 |
| 35 | Ga0070672_100041078 | 3300005543 | Bacteria | 3553 |
| 36 | Ga0070686_100023482 | 3300005544 | Bacteria | 3685 |
| 37 | Ga0068854_100015956 | 3300005578 | Bacteria | 4994 |
| 38 | Ga0070702_100036088 | 3300005615 | Bacteria | 2736 |
| 39 | Ga0068852_100010468 | 3300005616 | Bacteria | 6934 |
| 40 | Ga0068861_100003359 | 3300005719 | Bacteria | 10606 |
| 41 | Ga0068861_100033156 | 3300005719 | Bacteria | 3808 |
| 42 | Ga0068860_100002948 | 3300005843 | Bacteria | 17594 |
| 43 | Ga0075365_10003862 | 3300006038 | Bacteria | 7831 |
| 44 | Ga0075365_10031238 | 3300006038 | Bacteria | 3416 |
| 45 | Ga0075365_10047529 | 3300006038 | Bacteria | 2821 |
| 46 | Ga0075364_10033178 | 3300006051 | Bacteria | 3322 |
| 47 | Ga0075364_10100490 | 3300006051 | Bacteria | 1925 |
| 48 | Ga0070712_100091239 | 3300006175 | Bacteria | 2232 |
| 49 | Ga0075362_10013631 | 3300006177 | Bacteria | 3259 |
| 50 | Ga0075367_10008293 | 3300006178 | Bacteria | 5380 |
| 51 | Ga0097621_100159866 | 3300006237 | Bacteria | 1936 |
| 52 | Ga0075428_100082218 | 3300006844 | Bacteria | 3515 |
| 53 | Ga0068865_100017070 | 3300006881 | Bacteria | 4660 |
| 54 | Ga0111539_10451725 | 3300009094 | Bacteria | 1496 |
| 55 | Ga0105245_10011453 | 3300009098 | Bacteria | 7724 |
| 56 | Ga0105245_10452975 | 3300009098 | Bacteria | 1292 |
| 57 | Ga0105243_10007913 | 3300009148 | Bacteria | 8163 |
| 58 | Ga0105248_10031255 | 3300009177 | Bacteria | 5951 |
| 59 | Ga0105238_10375403 | 3300009551 | Bacteria | 1413 |
| 60 | Ga0105249_10039872 | 3300009553 | Bacteria | 4264 |
| 61 | Ga0157372_10017271 | 3300013307 | Bacteria | 7747 |
| 62 | Ga0157372_10410099 | 3300013307 | Bacteria | 1579 |
| 63 | Ga0157375_10044758 | 3300013308 | Bacteria | 4304 |
| 64 | Ga0163163_10130802 | 3300014325 | Bacteria | 2550 |
| 65 | Ga0157380_10005482 | 3300014326 | Bacteria | 8865 |
| 66 | Ga0157380_10028366 | 3300014326 | Bacteria | 4267 |
| 67 | Ga0182008_10016996 | 3300014497 | Bacteria | 3774 |
| 68 | Ga0157376_10276993 | 3300014969 | Bacteria | 1578 |
| 69 | Ga0163161_10014516 | 3300017792 | Bacteria | 5485 |
| 70 | Ga0197907_11514771 | 3300020069 | Bacteria | 1011 |
| 71 | Ga0206352_10898548 | 3300020078 | Bacteria | 1237 |
| 72 | Ga0206350_10092016 | 3300020080 | Bacteria | 1969 |
| 73 | Ga0206354_10832940 | 3300020081 | Bacteria | 2232 |
| 74 | Ga0213876_10005734 | 3300021384 | Bacteria | 6804 |
| 75 | Ga0213875_10000263 | 3300021388 | Bacteria | 52579 |
| 76 | Ga0224712_10000413 | 3300022467 | Bacteria | 8442 |
| 77 | Ga0207688_10015175 | 3300025901 | Bacteria | 4178 |
| 78 | Ga0207699_10040829 | 3300025906 | Bacteria | 2676 |
| 79 | Ga0207693_10107118 | 3300025915 | Bacteria | 2193 |
| 80 | Ga0207662_10038562 | 3300025918 | Bacteria | 2800 |
| 81 | Ga0207659_10029863 | 3300025926 | Bacteria | 3719 |
| 82 | Ga0207687_10114941 | 3300025927 | Bacteria | 2004 |
| 83 | Ga0207687_10377057 | 3300025927 | Bacteria | 1161 |
| 84 | Ga0207690_10010541 | 3300025932 | Bacteria | 5498 |
| 85 | Ga0207690_10055617 | 3300025932 | Bacteria | 2666 |
| 86 | Ga0207686_10025546 | 3300025934 | Bacteria | 3437 |
| 87 | Ga0207709_10011079 | 3300025935 | Bacteria | 4973 |
| 88 | Ga0207669_10260895 | 3300025937 | Bacteria | 1296 |
| 89 | Ga0207704_10010057 | 3300025938 | Bacteria | 4594 |
| 90 | Ga0207691_10006431 | 3300025940 | Bacteria | 11347 |
| 91 | Ga0207691_10343018 | 3300025940 | Bacteria | 1278 |
| 92 | Ga0207661_10013050 | 3300025944 | Bacteria | 6063 |
| 93 | Ga0207651_10164427 | 3300025960 | Bacteria | 1743 |
| 94 | Ga0207668_10199018 | 3300025972 | Bacteria | 1594 |
| 95 | Ga0207640_10017896 | 3300025981 | Bacteria | 4154 |
| 96 | Ga0207708_10001687 | 3300026075 | Bacteria | 16343 |
| 97 | Ga0207708_10011579 | 3300026075 | Bacteria | 6573 |
| 98 | Ga0207648_10009611 | 3300026089 | Bacteria | 9251 |
| 99 | Ga0207648_10060048 | 3300026089 | Bacteria | 3316 |
| 100 | Ga0207675_100011002 | 3300026118 | Bacteria | 8474 |
| 101 | Ga0207675_100039635 | 3300026118 | Bacteria | 4397 |
| 102 | Ga0207683_10208663 | 3300026121 | Bacteria | 1777 |
| 103 | Ga0207698_10232094 | 3300026142 | Bacteria | 1676 |
| 104 | Ga0207428_10109820 | 3300027907 | Bacteria | 2124 |
| 105 | Ga0268264_10009815 | 3300028381 | Bacteria | 7923 |
| 106 | Ga0265330_10044170 | 3300031235 | Bacteria | 1969 |
| 107 | Ga0265320_10069859 | 3300031240 | Bacteria | 1657 |
| 108 | Ga0265325_10025618 | 3300031241 | Bacteria | 3201 |
| 109 | Ga0265340_10015098 | 3300031247 | Bacteria | 4019 |
| 110 | Ga0265314_10020311 | 3300031711 | Bacteria | 5128 |
| 111 | Ga0316576_10001404 | 3300031727 | Bacteria | 12898 |
| 112 | Ga0316576_10028216 | 3300031727 | Bacteria | 3954 |
| 113 | Ga0316578_10070776 | 3300031728 | Bacteria | 2065 |
| 114 | Ga0307405_10508346 | 3300031731 | Bacteria | 967 |
| 115 | Ga0307410_10102655 | 3300031852 | Bacteria | 2052 |
| 116 | Ga0307407_10290582 | 3300031903 | Bacteria | 1136 |
| 117 | Ga0307412_10352368 | 3300031911 | Bacteria | 1182 |
| 118 | Ga0307409_100140427 | 3300031995 | Bacteria | 2080 |
| 119 | Ga0307416_100256097 | 3300032002 | Bacteria | 1707 |
| 120 | Ga0307414_10150146 | 3300032004 | Bacteria | 1837 |
| 121 | Ga0316593_10029615 | 3300032168 | Bacteria | 1772 |
| 122 | Ga0373961_0083046 | 3300035241 | Bacteria | 1011 |
| 123 | Ga0316574_0011220 | 3300035398 | Bacteria | 5087 |
| 124 | Ga0316584_0019534 | 3300036712 | Bacteria | 4899 |
| 125 | Ga0316584_0040609 | 3300036712 | Bacteria | 3467 |
| 126 | Ga0395900_0078093 | 3300037418 | Bacteria | 3402 |
| 127 | Ga0395898_0259220 | 3300037466 | Bacteria | 1658 |
| 128 | Ga0436364_0065152 | 3300037853 | Bacteria | 40870 |
| 129 | Ga0395901_0012965 | 3300038443 | Bacteria | 8457 |
| 130 | Ga0395901_0063434 | 3300038443 | Bacteria | 3845 |
| 131 | Ga0436365_1871915 | 3300039437 | Bacteria | 18062 |
| 132 | Ga0439447_033809 | 3300041407 | Bacteria | 1273 |
| 133 | Ga0439461_0008842 | 3300041410 | Bacteria | 1815 |
| 134 | Ga0451853_1338114 | 3300041512 | Bacteria | 2552 |
| 135 | Ga0451853_1451241 | 3300041512 | Bacteria | 876 |
| 136 | Ga0439431_0006778 | 3300041997 | Bacteria | 2542 |
| 137 | Ga0439442_022701 | 3300042002 | Bacteria | 1303 |
| 138 | Ga0439445_0029444 | 3300042004 | Bacteria | 1419 |
| 139 | Ga0439434_0045944 | 3300042435 | Bacteria | 1347 |
| 140 | Ga0466972_0019690 | 3300044658 | Bacteria | 3374 |
| 141 | Ga0466972_0027287 | 3300044658 | Bacteria | 2826 |
| 142 | Ga0466972_0056777 | 3300044658 | Bacteria | 1882 |
| 143 | Ga0466965_0015340 | 3300044683 | Bacteria | 3639 |
| 144 | Ga0466965_0046016 | 3300044683 | Bacteria | 2159 |
| 145 | Ga0466965_0121217 | 3300044683 | Bacteria | 1351 |
| 146 | Ga0466966_0111071 | 3300044684 | Bacteria | 1690 |
| 147 | Ga0466961_0056990 | 3300044693 | Bacteria | 2488 |
| 148 | Ga0466961_0249711 | 3300044693 | Bacteria | 1089 |
| 149 | Ga0466963_0033931 | 3300044694 | Bacteria | 3318 |
| 150 | Ga0466963_0049878 | 3300044694 | Bacteria | 2769 |
| 151 | Ga0466963_0153522 | 3300044694 | Bacteria | 1600 |
| 152 | Ga0466964_0003466 | 3300044706 | Bacteria | 5758 |
| 153 | Ga0466964_0038237 | 3300044706 | Bacteria | 1929 |
| 154 | Ga0466971_0012057 | 3300044719 | Bacteria | 3788 |
| 155 | Ga0466968_0050541 | 3300044735 | Bacteria | 1774 |
| 156 | Ga0466970_0011608 | 3300044765 | Bacteria | 4495 |
| 157 | Ga0466970_0068737 | 3300044765 | Bacteria | 1903 |
| 158 | Ga0466970_0166236 | 3300044765 | Bacteria | 1221 |
| 159 | Ga0466957_0009205 | 3300044842 | Bacteria | 5631 |
| 160 | Ga0466957_0066427 | 3300044842 | Bacteria | 2223 |
| 161 | Ga0466960_0004970 | 3300044901 | Bacteria | 5237 |
| 162 | Ga0466960_0073584 | 3300044901 | Bacteria | 1705 |
| 163 | Ga0466958_0010281 | 3300045836 | Bacteria | 5237 |
| 164 | Ga0466958_0038935 | 3300045836 | Bacteria | 2854 |
| 165 | Ga0466967_0011500 | 3300045976 | Bacteria | 6709 |
| 166 | Ga0466967_0167199 | 3300045976 | Bacteria | 2067 |
| 167 | Ga0466967_0173701 | 3300045976 | Bacteria | 2029 |
| 168 | Ga0466967_0309748 | 3300045976 | Bacteria | 1521 |
| 169 | Ga0495629_0189978 | 3300046459 | Bacteria | 1422 |
| 170 | Ga0496101_0033493 | 3300048904 | Bacteria | 3624 |
| 171 | Ga0496102_0017913 | 3300048905 | Bacteria | 6212 |
| 172 | Ga0496102_0470840 | 3300048905 | Bacteria | 1177 |
| 173 | Ga0496103_0042697 | 3300048906 | Bacteria | 2791 |
| 174 | Ga0496106_0082346 | 3300048909 | Bacteria | 2473 |
| 175 | Ga0496107_0019292 | 3300048910 | Bacteria | 4811 |
| 176 | Ga0496108_0045092 | 3300048911 | Bacteria | 3681 |
| 177 | Ga0496109_0098481 | 3300048912 | Bacteria | 2711 |
| 178 | Ga0496109_0451746 | 3300048912 | Bacteria | 1214 |
| 179 | Ga0496110_0077647 | 3300048913 | Bacteria | 2954 |
| 180 | Ga0496110_0110395 | 3300048913 | Bacteria | 2471 |
| 181 | Ga0496110_0143328 | 3300048913 | Bacteria | 2160 |
| 182 | Ga0496111_0014661 | 3300048914 | Bacteria | 5359 |
| 183 | Ga0496112_0152362 | 3300048915 | Bacteria | 2279 |
| 184 | Ga0496113_0191456 | 3300048916 | Bacteria | 1623 |
| 185 | Ga0496113_0239768 | 3300048916 | Bacteria | 1447 |
| 186 | Ga0496114_0026180 | 3300048917 | Bacteria | 4774 |
| 187 | Ga0496114_0056235 | 3300048917 | Bacteria | 3283 |
| 188 | Ga0496114_0100450 | 3300048917 | Bacteria | 2469 |
| 189 | Ga0501031_0012492 | 3300049568 | Bacteria | 5542 |
| 190 | Ga0501032_0055284 | 3300049569 | Bacteria | 2670 |
| 191 | Ga0501032_0118276 | 3300049569 | Bacteria | 1752 |
| 192 | Ga0501032_0153632 | 3300049569 | Bacteria | 1513 |
| 193 | Ga0501032_0160969 | 3300049569 | Bacteria | 1474 |
| 194 | Ga0501032_0185685 | 3300049569 | Bacteria | 1360 |
| 195 | Ga0501033_0002108 | 3300049570 | Bacteria | 17222 |
| 196 | Ga0501033_0068091 | 3300049570 | Bacteria | 2618 |
| 197 | Ga0501034_0018366 | 3300049571 | Bacteria | 7171 |
| 198 | Ga0501034_0176262 | 3300049571 | Bacteria | 2104 |
| 199 | Ga0501036_0002673 | 3300049572 | Bacteria | 14064 |
| 200 | Ga0501036_0004245 | 3300049572 | Bacteria | 11555 |
| 201 | Ga0501036_0028816 | 3300049572 | Bacteria | 4692 |
| 202 | Ga0501036_0193431 | 3300049572 | Bacteria | 1711 |
| 203 | Ga0501036_0234077 | 3300049572 | Bacteria | 1541 |
| 204 | Ga0501037_0008882 | 3300049573 | Bacteria | 7359 |
| 205 | Ga0501037_0192189 | 3300049573 | Bacteria | 1445 |
| 206 | Ga0501038_0001411 | 3300049574 | Bacteria | 22000 |
| 207 | Ga0501038_0018612 | 3300049574 | Bacteria | 6273 |
| 208 | Ga0501038_0031357 | 3300049574 | Bacteria | 4698 |
| 209 | Ga0501038_0176272 | 3300049574 | Bacteria | 1728 |
| 210 | Ga0501038_0240997 | 3300049574 | Bacteria | 1436 |
| 211 | Ga0501039_0009537 | 3300049575 | Bacteria | 7399 |
| 212 | Ga0501039_0067191 | 3300049575 | Bacteria | 2784 |
| 213 | Ga0501039_0226544 | 3300049575 | Bacteria | 1469 |
| 214 | Ga0501040_0010477 | 3300049576 | Bacteria | 6063 |
| 215 | Ga0501040_0104936 | 3300049576 | Bacteria | 1974 |
| 216 | Ga0501040_0106539 | 3300049576 | Bacteria | 1959 |
| 217 | Ga0501041_0009702 | 3300049577 | Bacteria | 5673 |
| 218 | Ga0501041_0111378 | 3300049577 | Bacteria | 1698 |
| 219 | Ga0501041_0124346 | 3300049577 | Bacteria | 1605 |
| 220 | Ga0501041_0301590 | 3300049577 | Bacteria | 1009 |
| 221 | Ga0501042_0033950 | 3300049578 | Bacteria | 3618 |
| 222 | Ga0501042_0072281 | 3300049578 | Bacteria | 2468 |
| 223 | Ga0501043_0066942 | 3300049579 | Bacteria | 2821 |
| 224 | Ga0501046_0000841 | 3300049580 | Bacteria | 29918 |
| 225 | Ga0501046_0059665 | 3300049580 | Bacteria | 2988 |
| 226 | Ga0501046_0075044 | 3300049580 | Bacteria | 2622 |
| 227 | Ga0501046_0159704 | 3300049580 | Bacteria | 1696 |
| 228 | Ga0501047_0186146 | 3300049581 | Bacteria | 1942 |
| 229 | Ga0501048_0017189 | 3300049582 | Bacteria | 5329 |
| 230 | Ga0501048_0036564 | 3300049582 | Bacteria | 3529 |
| 231 | Ga0501048_0061078 | 3300049582 | Bacteria | 2670 |
| 232 | Ga0501048_0202665 | 3300049582 | Bacteria | 1407 |
| 233 | Ga0501067_0001853 | 3300049583 | Bacteria | 11627 |
| 234 | Ga0501067_0004736 | 3300049583 | Bacteria | 7534 |
| 235 | Ga0501067_0014271 | 3300049583 | Bacteria | 4399 |
| 236 | Ga0501067_0014995 | 3300049583 | Bacteria | 4288 |
| 237 | Ga0501067_0042241 | 3300049583 | Bacteria | 2531 |
| 238 | Ga0501068_0144223 | 3300049584 | Bacteria | 1494 |
| 239 | Ga0501069_0064270 | 3300049585 | Bacteria | 2051 |
| 240 | Ga0501070_0002841 | 3300049586 | Bacteria | 15113 |
| 241 | Ga0501070_0004298 | 3300049586 | Bacteria | 12249 |
| 242 | Ga0501070_0006947 | 3300049586 | Bacteria | 9628 |
| 243 | Ga0501070_0042735 | 3300049586 | Bacteria | 3774 |
| 244 | Ga0501071_0009400 | 3300049587 | Bacteria | 6511 |
| 245 | Ga0501072_0007946 | 3300049588 | Bacteria | 8054 |
| 246 | Ga0501072_0014447 | 3300049588 | Bacteria | 6050 |
| 247 | Ga0501072_0037435 | 3300049588 | Bacteria | 3805 |
| 248 | Ga0501072_0186356 | 3300049588 | Bacteria | 1655 |
| 249 | Ga0501073_0005390 | 3300049589 | Bacteria | 9584 |
| 250 | Ga0501073_0006321 | 3300049589 | Bacteria | 8825 |
| 251 | Ga0501073_0015203 | 3300049589 | Bacteria | 5582 |
| 252 | Ga0501073_0082549 | 3300049589 | Bacteria | 2236 |
| 253 | Ga0501073_0187572 | 3300049589 | Bacteria | 1431 |
| 254 | Ga0501074_0000838 | 3300049590 | Bacteria | 19549 |
| 255 | Ga0501074_0004634 | 3300049590 | Bacteria | 9846 |
| 256 | Ga0501074_0026566 | 3300049590 | Bacteria | 4198 |
| 257 | Ga0501074_0064822 | 3300049590 | Bacteria | 2630 |
| 258 | Ga0501075_0150678 | 3300049591 | Bacteria | 1773 |
| 259 | Ga0501076_0041752 | 3300049592 | Bacteria | 3610 |
| 260 | Ga0501077_0024431 | 3300049593 | Bacteria | 3838 |
| 261 | Ga0501077_0094641 | 3300049593 | Bacteria | 1894 |
| 262 | Ga0501079_0000560 | 3300049741 | Bacteria | 24402 |
| 263 | Ga0501079_0032168 | 3300049741 | Bacteria | 4032 |
| 264 | Ga0501079_0103620 | 3300049741 | Bacteria | 2207 |
| 265 | Ga0501080_0001095 | 3300049742 | Bacteria | 22325 |
| 266 | Ga0501080_0031745 | 3300049742 | Bacteria | 4922 |
| 267 | Ga0501081_0289940 | 3300049743 | Bacteria | 1199 |
| 268 | Ga0501083_0004571 | 3300049744 | Bacteria | 9774 |
| 269 | Ga0501035_0105467 | 3300049822 | Bacteria | 2471 |
| 270 | Ga0501035_0236273 | 3300049822 | Bacteria | 1556 |
| 271 | Ga0501044_0015701 | 3300049823 | Bacteria | 8155 |
| 272 | Ga0501044_0059956 | 3300049823 | Bacteria | 3898 |
| 273 | Ga0501045_0021166 | 3300049824 | Bacteria | 4650 |
| 274 | Ga0501045_0088321 | 3300049824 | Bacteria | 2290 |
| 275 | nmdc:mga00v17_16414_c1 | 3300050491 | Bacteria | 4173 |
| 276 | nmdc:mga00v17_70429_c1 | 3300050491 | Bacteria | 2166 |
| 277 | nmdc:mga0yw44_13159_c1 | 3300050492 | Bacteria | 4345 |
| 278 | nmdc:mga0yw44_168634_c1 | 3300050492 | Bacteria | 1437 |
| 279 | nmdc:mga0yw44_4649_c1 | 3300050492 | Bacteria | 6340 |
| 280 | nmdc:mga06z11_58766_c1 | 3300050494 | Bacteria | 1996 |
| 281 | nmdc:mga08y16_201672_c1 | 3300050511 | Bacteria | 2061 |
| 282 | Ga0495601_0079304 | 3300053077 | Bacteria | 2105 |
| 283 | Ga0495619_0285354 | 3300053085 | Bacteria | 1144 |
| 284 | Ga0500556_0000842 | 3300053104 | Bacteria | 17570 |
| 285 | Ga0500573_0005104 | 3300053140 | Bacteria | 6998 |
| 286 | Ga0501084_0008229 | 3300054114 | Bacteria | 8603 |
| 287 | Ga0501084_0059266 | 3300054114 | Bacteria | 3204 |
| 288 | Ga0501084_0293334 | 3300054114 | Bacteria | 1373 |
| 289 | Ga0466962_0017816 | 3300061719 | Bacteria | 3418 |
| 290 | Ga0530510_0019057 | 3300061734 | Bacteria | 4867 |
| 291 | Ga0530510_0094819 | 3300061734 | Bacteria | 2180 |
| 292 | 2643825468 | 2643221561 | Bacteria | 4984412 |
| 293 | 2644089698 | 2643221615 | Bacteria | 5487866 |
| 294 | 2644229016 | 2643221641 | Bacteria | 4490190 |
| 295 | 2644319543 | 2643221657 | Bacteria | 5490246 |
| 296 | 2644531464 | 2643221696 | Bacteria | 5431823 |
| 297 | 2774393493 | 2773857762 | Bacteria | 5971770 |
| 298 | 2809195615 | 2808606439 | Bacteria | 5952208 |
| 299 | 2812350519 | 2811994878 | Bacteria | 5992952 |
| 300 | 2837275766 | 2837268691 | Bacteria | 7850704 |
| 301 | 2868094492 | 2868088558 | Bacteria | 7609351 |
| 302 | 2891971884 | 2891968417 | Bacteria | 5821697 |
| 303 | 2984576997 | 2984576629 | Bacteria | 4248407 |
| 304 | 2990258744 | 2990256926 | Bacteria | 4252839 |
| 305 | 8054612619 | 8054609563 | Bacteria | 5170090 |
| 306 | Ga0070658_10198084 | |||
| 307 | JGI24750J21931_1004497 | |||
| 308 | JGI24738J21930_10001662 | |||
| 309 | JGI24749J21850_1004669 | |||
| 310 | JGI24744J21845_10006771 | |||
| 311 | Ga0070683_100028338 | |||
| 312 | Ga0070683_100081273 | |||
| 313 | Ga0070670_100195988 | |||
| 314 | Ga0070682_100084016 | |||
| 315 | Ga0070682_100119664 | |||
| 316 | Ga0068868_100026120 | |||
| 317 | Ga0068868_100132485 | |||
| 318 | Ga0070687_100009535 | |||
| 319 | Ga0070687_100159545 | |||
| 320 | Ga0070692_10005827 | |||
| 321 | Ga0070669_100040160 | |||
| 322 | Ga0070675_100039990 | |||
| 323 | Ga0070674_100035394 | |||
| 324 | Ga0070673_100054376 | |||
| 325 | Ga0070659_100077941 | |||
| 326 | Ga0070659_100215265 | |||
| 327 | Ga0070709_10049472 | |||
| 328 | Ga0070713_100115443 | |||
| 329 | Ga0070701_10010070 | |||
| 330 | Ga0070711_100129134 | |||
| 331 | Ga0070705_100263984 | |||
| 332 | Ga0070700_100008782 | |||
| 333 | Ga0070678_100111825 | |||
| 334 | Ga0068867_100043129 | |||
| 335 | Ga0070685_10054390 | |||
| 336 | Ga0070698_100030055 | |||
| 337 | Ga0070679_100212184 | |||
| 338 | Ga0070684_100047928 | |||
| 339 | Ga0070684_100157232 | |||
| 340 | Ga0070672_100041078 | |||
| 341 | Ga0070686_100023482 | |||
| 342 | Ga0068854_100015956 | |||
| 343 | Ga0070702_100036088 | |||
| 344 | Ga0068852_100010468 | |||
| 345 | Ga0068861_100003359 | |||
| 346 | Ga0068861_100033156 | |||
| 347 | Ga0068860_100002948 | |||
| 348 | Ga0075365_10003862 | |||
| 349 | Ga0075365_10031238 | |||
| 350 | Ga0075365_10047529 | |||
| 351 | Ga0075364_10033178 | |||
| 352 | Ga0075364_10100490 | |||
| 353 | Ga0070712_100091239 | |||
| 354 | Ga0075362_10013631 | |||
| 355 | Ga0075367_10008293 | |||
| 356 | Ga0097621_100159866 | |||
| 357 | Ga0075428_100082218 | |||
| 358 | Ga0068865_100017070 | |||
| 359 | Ga0111539_10451725 | |||
| 360 | Ga0105245_10011453 | |||
| 361 | Ga0105245_10452975 | |||
| 362 | Ga0105243_10007913 | |||
| 363 | Ga0105248_10031255 | |||
| 364 | Ga0105238_10375403 | |||
| 365 | Ga0105249_10039872 | |||
| 366 | Ga0157372_10017271 | |||
| 367 | Ga0157372_10410099 | |||
| 368 | Ga0157375_10044758 | |||
| 369 | Ga0163163_10130802 | |||
| 370 | Ga0157380_10005482 | |||
| 371 | Ga0157380_10028366 | |||
| 372 | Ga0182008_10016996 | |||
| 373 | Ga0157376_10276993 | |||
| 374 | Ga0163161_10014516 | |||
| 375 | Ga0197907_11514771 | |||
| 376 | Ga0206352_10898548 | |||
| 377 | Ga0206350_10092016 | |||
| 378 | Ga0206354_10832940 | |||
| 379 | Ga0213876_10005734 | |||
| 380 | Ga0213875_10000263 | |||
| 381 | Ga0224712_10000413 | |||
| 382 | Ga0207688_10015175 | |||
| 383 | Ga0207699_10040829 | |||
| 384 | Ga0207693_10107118 | |||
| 385 | Ga0207662_10038562 | |||
| 386 | Ga0207659_10029863 | |||
| 387 | Ga0207687_10114941 | |||
| 388 | Ga0207687_10377057 | |||
| 389 | Ga0207690_10010541 | |||
| 390 | Ga0207690_10055617 | |||
| 391 | Ga0207686_10025546 | |||
| 392 | Ga0207709_10011079 | |||
| 393 | Ga0207669_10260895 | |||
| 394 | Ga0207704_10010057 | |||
| 395 | Ga0207691_10006431 | |||
| 396 | Ga0207691_10343018 | |||
| 397 | Ga0207661_10013050 | |||
| 398 | Ga0207651_10164427 | |||
| 399 | Ga0207668_10199018 | |||
| 400 | Ga0207640_10017896 | |||
| 401 | Ga0207708_10001687 | |||
| 402 | Ga0207708_10011579 | |||
| 403 | Ga0207648_10009611 | |||
| 404 | Ga0207648_10060048 | |||
| 405 | Ga0207675_100011002 | |||
| 406 | Ga0207675_100039635 | |||
| 407 | Ga0207683_10208663 | |||
| 408 | Ga0207698_10232094 | |||
| 409 | Ga0207428_10109820 | |||
| 410 | Ga0268264_10009815 | |||
| 411 | Ga0265330_10044170 | |||
| 412 | Ga0265320_10069859 | |||
| 413 | Ga0265325_10025618 | |||
| 414 | Ga0265340_10015098 | |||
| 415 | Ga0265314_10020311 | |||
| 416 | Ga0316576_10001404 | |||
| 417 | Ga0316576_10028216 | |||
| 418 | Ga0316578_10070776 | |||
| 419 | Ga0307405_10508346 | |||
| 420 | Ga0307410_10102655 | |||
| 421 | Ga0307407_10290582 | |||
| 422 | Ga0307412_10352368 | |||
| 423 | Ga0307409_100140427 | |||
| 424 | Ga0307416_100256097 | |||
| 425 | Ga0307414_10150146 | |||
| 426 | Ga0316593_10029615 | |||
| 427 | Ga0373961_0083046 | |||
| 428 | Ga0316574_0011220 | |||
| 429 | Ga0316584_0019534 | |||
| 430 | Ga0316584_0040609 | |||
| 431 | Ga0395900_0078093 | |||
| 432 | Ga0395898_0259220 | |||
| 433 | Ga0436364_0065152 | |||
| 434 | Ga0395901_0012965 | |||
| 435 | Ga0395901_0063434 | |||
| 436 | Ga0436365_1871915 | |||
| 437 | Ga0439447_033809 | |||
| 438 | Ga0439461_0008842 | |||
| 439 | Ga0451853_1338114 | |||
| 440 | Ga0451853_1451241 | |||
| 441 | Ga0439431_0006778 | |||
| 442 | Ga0439442_022701 | |||
| 443 | Ga0439445_0029444 | |||
| 444 | Ga0439434_0045944 | |||
| 445 | Ga0466972_0019690 | |||
| 446 | Ga0466972_0027287 | |||
| 447 | Ga0466972_0056777 | |||
| 448 | Ga0466965_0015340 | |||
| 449 | Ga0466965_0046016 | |||
| 450 | Ga0466965_0121217 | |||
| 451 | Ga0466966_0111071 | |||
| 452 | Ga0466961_0056990 | |||
| 453 | Ga0466961_0249711 | |||
| 454 | Ga0466963_0033931 | |||
| 455 | Ga0466963_0049878 | |||
| 456 | Ga0466963_0153522 | |||
| 457 | Ga0466964_0003466 | |||
| 458 | Ga0466964_0038237 | |||
| 459 | Ga0466971_0012057 | |||
| 460 | Ga0466968_0050541 | |||
| 461 | Ga0466970_0011608 | |||
| 462 | Ga0466970_0068737 | |||
| 463 | Ga0466970_0166236 | |||
| 464 | Ga0466957_0009205 | |||
| 465 | Ga0466957_0066427 | |||
| 466 | Ga0466960_0004970 | |||
| 467 | Ga0466960_0073584 | |||
| 468 | Ga0466958_0010281 | |||
| 469 | Ga0466958_0038935 | |||
| 470 | Ga0466967_0011500 | |||
| 471 | Ga0466967_0167199 | |||
| 472 | Ga0466967_0173701 | |||
| 473 | Ga0466967_0309748 | |||
| 474 | Ga0495629_0189978 | |||
| 475 | Ga0496101_0033493 | |||
| 476 | Ga0496102_0017913 | |||
| 477 | Ga0496102_0470840 | |||
| 478 | Ga0496103_0042697 | |||
| 479 | Ga0496106_0082346 | |||
| 480 | Ga0496107_0019292 | |||
| 481 | Ga0496108_0045092 | |||
| 482 | Ga0496109_0098481 | |||
| 483 | Ga0496109_0451746 | |||
| 484 | Ga0496110_0077647 | |||
| 485 | Ga0496110_0110395 | |||
| 486 | Ga0496110_0143328 | |||
| 487 | Ga0496111_0014661 | |||
| 488 | Ga0496112_0152362 | |||
| 489 | Ga0496113_0191456 | |||
| 490 | Ga0496113_0239768 | |||
| 491 | Ga0496114_0026180 | |||
| 492 | Ga0496114_0056235 | |||
| 493 | Ga0496114_0100450 | |||
| 494 | Ga0501031_0012492 | |||
| 495 | Ga0501032_0055284 | |||
| 496 | Ga0501032_0118276 | |||
| 497 | Ga0501032_0153632 | |||
| 498 | Ga0501032_0160969 | |||
| 499 | Ga0501032_0185685 | |||
| 500 | Ga0501033_0002108 | |||
| 501 | Ga0501033_0068091 | |||
| 502 | Ga0501034_0018366 | |||
| 503 | Ga0501034_0176262 | |||
| 504 | Ga0501036_0002673 | |||
| 505 | Ga0501036_0004245 | |||
| 506 | Ga0501036_0028816 | |||
| 507 | Ga0501036_0193431 | |||
| 508 | Ga0501036_0234077 | |||
| 509 | Ga0501037_0008882 | |||
| 510 | Ga0501037_0192189 | |||
| 511 | Ga0501038_0001411 | |||
| 512 | Ga0501038_0018612 | |||
| 513 | Ga0501038_0031357 | |||
| 514 | Ga0501038_0176272 | |||
| 515 | Ga0501038_0240997 | |||
| 516 | Ga0501039_0009537 | |||
| 517 | Ga0501039_0067191 | |||
| 518 | Ga0501039_0226544 | |||
| 519 | Ga0501040_0010477 | |||
| 520 | Ga0501040_0104936 | |||
| 521 | Ga0501040_0106539 | |||
| 522 | Ga0501041_0009702 | |||
| 523 | Ga0501041_0111378 | |||
| 524 | Ga0501041_0124346 | |||
| 525 | Ga0501041_0301590 | |||
| 526 | Ga0501042_0033950 | |||
| 527 | Ga0501042_0072281 | |||
| 528 | Ga0501043_0066942 | |||
| 529 | Ga0501046_0000841 | |||
| 530 | Ga0501046_0059665 | |||
| 531 | Ga0501046_0075044 | |||
| 532 | Ga0501046_0159704 | |||
| 533 | Ga0501047_0186146 | |||
| 534 | Ga0501048_0017189 | |||
| 535 | Ga0501048_0036564 | |||
| 536 | Ga0501048_0061078 | |||
| 537 | Ga0501048_0202665 | |||
| 538 | Ga0501067_0001853 | |||
| 539 | Ga0501067_0004736 | |||
| 540 | Ga0501067_0014271 | |||
| 541 | Ga0501067_0014995 | |||
| 542 | Ga0501067_0042241 | |||
| 543 | Ga0501068_0144223 | |||
| 544 | Ga0501069_0064270 | |||
| 545 | Ga0501070_0002841 | |||
| 546 | Ga0501070_0004298 | |||
| 547 | Ga0501070_0006947 | |||
| 548 | Ga0501070_0042735 | |||
| 549 | Ga0501071_0009400 | |||
| 550 | Ga0501072_0007946 | |||
| 551 | Ga0501072_0014447 | |||
| 552 | Ga0501072_0037435 | |||
| 553 | Ga0501072_0186356 | |||
| 554 | Ga0501073_0005390 | |||
| 555 | Ga0501073_0006321 | |||
| 556 | Ga0501073_0015203 | |||
| 557 | Ga0501073_0082549 | |||
| 558 | Ga0501073_0187572 | |||
| 559 | Ga0501074_0000838 | |||
| 560 | Ga0501074_0004634 | |||
| 561 | Ga0501074_0026566 | |||
| 562 | Ga0501074_0064822 | |||
| 563 | Ga0501075_0150678 | |||
| 564 | Ga0501076_0041752 | |||
| 565 | Ga0501077_0024431 | |||
| 566 | Ga0501077_0094641 | |||
| 567 | Ga0501079_0000560 | |||
| 568 | Ga0501079_0032168 | |||
| 569 | Ga0501079_0103620 | |||
| 570 | Ga0501080_0001095 | |||
| 571 | Ga0501080_0031745 | |||
| 572 | Ga0501081_0289940 | |||
| 573 | Ga0501083_0004571 | |||
| 574 | Ga0501035_0105467 | |||
| 575 | Ga0501035_0236273 | |||
| 576 | Ga0501044_0015701 | |||
| 577 | Ga0501044_0059956 | |||
| 578 | Ga0501045_0021166 | |||
| 579 | Ga0501045_0088321 | |||
| 580 | nmdc:mga00v17_16414_c1 | |||
| 581 | nmdc:mga00v17_70429_c1 | |||
| 582 | nmdc:mga0yw44_13159_c1 | |||
| 583 | nmdc:mga0yw44_168634_c1 | |||
| 584 | nmdc:mga0yw44_4649_c1 | |||
| 585 | nmdc:mga06z11_58766_c1 | |||
| 586 | nmdc:mga08y16_201672_c1 | |||
| 587 | Ga0495601_0079304 | |||
| 588 | Ga0495619_0285354 | |||
| 589 | Ga0500556_0000842 | |||
| 590 | Ga0500573_0005104 | |||
| 591 | Ga0501084_0008229 | |||
| 592 | Ga0501084_0059266 | |||
| 593 | Ga0501084_0293334 | |||
| 594 | Ga0466962_0017816 | |||
| 595 | Ga0530510_0019057 | |||
| 596 | Ga0530510_0094819 | |||
| 597 | 2643825468 | |||
| 598 | 2644089698 | |||
| 599 | 2644229016 | |||
| 600 | 2644319543 | |||
| 601 | 2644531464 | |||
| 602 | 2774393493 | |||
| 603 | 2809195615 | |||
| 604 | 2812350519 | |||
| 605 | 2837275766 | |||
| 606 | 2868094492 | |||
| 607 | 2891971884 | |||
| 608 | 2984576997 | |||
| 609 | 2990258744 | |||
| 610 | 8054612619 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cqb-assembly1.cif.gz_A | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.9129 | 78 | 158 |
| 3cqb-assembly1.cif.gz_B | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.8984 | 71 | 155 |
| 3cqb-assembly1.cif.gz_B | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.7564 | 71 | 155 |
| 3cqb-assembly1.cif.gz_A | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.7186 | 78 | 158 |
| 6sar-assembly1.cif.gz_A | e coli bepa/yfgc | 0.697 | 60 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS5_62_152_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9802 | 77 | 165 | 3.30.2010.10 |
| af_Q59076_58_147_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9693 | 78 | 166 | 3.30.2010.10 |
| af_P9WHS5_62_152_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9487 | 77 | 165 | 3.30.2010.10 |
| af_Q59076_58_147_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9485 | 78 | 166 | 3.30.2010.10 |
| af_O53978_67_150_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9261 | 82 | 159 | 3.30.2010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3I2P7-F1-model_v4 | M48 family metalloprotease | 0.99 | 70 | 159 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A528D7J6-F1-model_v4 | Protease HtpX | 0.9883 | 77 | 154 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A7C7PYT0-F1-model_v4 | Protease HtpX | 0.9411 | 27 | 130 |
GO:0006508
GO:0008233 GO:0016020 |
| AF-A0A377CHR2-F1-model_v4 | M48B family peptidase (EC 3.4.24.-) | 0.9398 | 70 | 158 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A528D7J6-F1-model_v4 | Protease HtpX | 0.9185 | 77 | 154 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |