F397859

General Info

Members Datasets Scaffolds Average Seq Length
304 188 608 314

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2919134579|2919137917
Length 347
Sequence APLERCSSRRRVARVSAAHAGALRIIIRRKQGMSSVVSVVDHIASAKRVLQIEASAVAALAGRLDGQFTQAVEQVLGSQGRVIICGMGKSGIIGRKIAATLASTGTPSFFMHPGEAFHGDLGMVTATDVFVAISYSGETEEVVKLLPFLKDNGNFLVAITGRATSTLAQAADCHLDAGVSQEACPLALAPTASTTATLAMGDALAVALMEARGFQPENFARFHPGGSLGRRLLSRVEHEMVAGDLPVVDAAATMMDVLQAITRSSLGLAIVRAGTSYAIITDGDVRRALERHGREVFDKSAAELMTASPAQVSVGTRVEDALVLMERRRISSLLVFDGDVLAGVFKK

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
98 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
99 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
100 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
101 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
164 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
165 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
166 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
167 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
168 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
169 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
170 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
171 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
172 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
173 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
174 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
175 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
176 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
177 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
178 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
179 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
180 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
181 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
182 2952252522 Salinicola sp. DM10 Isolate Unclassified
183 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
184 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
185 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
186 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
187 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
188 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.17
Metatranscriptomes 4.28
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 1.64
Rhizoplane 2.96
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006228 3300001904 Bacteria 2011
2 JGI24744J21845_10006339 3300002077 Bacteria 2456
3 JGI25156J39149_1000244 3300002705 Bacteria 37731
4 JGI25162J39368_1000020 3300002737 Bacteria 254723
5 JGI25162J39368_1000749 3300002737 Bacteria 22177
6 JGI25164J39214_1000901 3300002772 Bacteria 9933
7 JGI25165J46597_1000519 3300003214 Bacteria 36430
8 rootH1_10149881 3300003316 Bacteria 2094
9 rootH2_10006302 3300003320 Bacteria 47168
10 rootL2_10066343 3300003322 Bacteria 5493
11 rootH1_10006920 3300003323 Bacteria 63684
12 rootH1_10189115 3300003323 Bacteria 2933
13 Ga0055532_1000123 3300003758 Bacteria 78526
14 Ga0058863_11945642 3300004799 Bacteria 8118
15 Ga0058862_10072258 3300004803 Bacteria 4449
16 Ga0065714_10008876 3300005288 Bacteria 4602
17 Ga0065714_10080719 3300005288 Bacteria 2421
18 Ga0065714_10088918 3300005288 Bacteria 1999
19 Ga0070658_10003203 3300005327 Bacteria 13509
20 Ga0070658_10255137 3300005327 Unclassified 1488
21 Ga0070676_10000121 3300005328 Bacteria 28951
22 Ga0070680_100008599 3300005336 Bacteria 7822
23 Ga0070660_100000026 3300005339 Bacteria 89379
24 Ga0070660_100022538 3300005339 Bacteria 4659
25 Ga0070671_100004458 3300005355 Bacteria 11082
26 Ga0070673_100002402 3300005364 Bacteria 11395
27 Ga0070659_100000054 3300005366 Bacteria 89379
28 Ga0070678_100002279 3300005456 Bacteria 10444
29 Ga0070662_100000559 3300005457 Bacteria 22595
30 Ga0070681_10114124 3300005458 Bacteria 2641
31 Ga0068867_100003937 3300005459 Bacteria 10457
32 Ga0070679_100065850 3300005530 Bacteria 3611
33 Ga0070679_100138029 3300005530 Bacteria 2419
34 Ga0068853_100013381 3300005539 Bacteria 6697
35 Ga0068853_100032664 3300005539 Bacteria 4410
36 Ga0068853_100039178 3300005539 Bacteria 4041
37 Ga0070672_100066521 3300005543 Bacteria 2854
38 Ga0070665_100000003 3300005548 Bacteria 811857
39 Ga0068855_100000240 3300005563 Bacteria 69408
40 Ga0068855_100002853 3300005563 Bacteria 21245
41 Ga0068855_100009372 3300005563 Bacteria 11823
42 Ga0068855_100036996 3300005563 Bacteria 5807
43 Ga0068855_100058731 3300005563 Bacteria 4503
44 Ga0068855_100101904 3300005563 Bacteria 3305
45 Ga0068855_100399140 3300005563 Unclassified 1507
46 Ga0068856_100000092 3300005614 Bacteria 84781
47 Ga0068856_100147638 3300005614 Bacteria 2359
48 Ga0068856_100630936 3300005614 Bacteria 1092
49 Ga0068852_100000264 3300005616 Bacteria 35179
50 Ga0068852_100008969 3300005616 Bacteria 7401
51 Ga0075364_10002576 3300006051 Bacteria 10165
52 Ga0075432_10007381 3300006058 Bacteria 3742
53 Ga0075432_10011624 3300006058 Bacteria 2991
54 Ga0075366_10000615 3300006195 Bacteria 16741
55 Ga0075366_10000739 3300006195 Bacteria 15529
56 Ga0097621_100000152 3300006237 Bacteria 42727
57 Ga0068871_100000020 3300006358 Bacteria 84930
58 Ga0068865_100000138 3300006881 Bacteria 38207
59 Ga0105244_10005099 3300009036 Bacteria 8823
60 Ga0105250_10007731 3300009092 Bacteria 4607
61 Ga0105240_10010038 3300009093 Bacteria 13334
62 Ga0105240_10015889 3300009093 Bacteria 10211
63 Ga0105240_10025077 3300009093 Bacteria 7847
64 Ga0105240_10053765 3300009093 Bacteria 5052
65 Ga0105240_10325148 3300009093 Bacteria 1752
66 Ga0105240_10356858 3300009093 Bacteria 1657
67 Ga0105240_10363226 3300009093 Bacteria 1639
68 Ga0105241_10001146 3300009174 Bacteria 20196
69 Ga0105241_10234007 3300009174 Bacteria 1550
70 Ga0105241_10320451 3300009174 Bacteria 1336
71 Ga0105237_10000803 3300009545 Bacteria 42892
72 Ga0105237_10003112 3300009545 Bacteria 19992
73 Ga0105237_10005064 3300009545 Bacteria 14970
74 Ga0105237_10008443 3300009545 Bacteria 11144
75 Ga0105237_10058187 3300009545 Bacteria 3869
76 Ga0105237_10133942 3300009545 Bacteria 2473
77 Ga0105238_10029875 3300009551 Bacteria 5549
78 Ga0105238_10047090 3300009551 Bacteria 4349
79 Ga0105238_10225804 3300009551 Bacteria 1849
80 Ga0105239_10000010 3300010375 Bacteria 341545
81 Ga0105239_10000178 3300010375 Bacteria 92196
82 Ga0105239_10003299 3300010375 Bacteria 19876
83 Ga0105239_10008401 3300010375 Bacteria 11758
84 Ga0105239_10011430 3300010375 Bacteria 9900
85 Ga0105239_10012536 3300010375 Bacteria 9441
86 Ga0105239_10013700 3300010375 Bacteria 9005
87 Ga0157373_10014445 3300013100 Bacteria 5788
88 Ga0157370_10152709 3300013104 Bacteria 2148
89 Ga0157369_10018596 3300013105 Bacteria 7790
90 Ga0157369_10292620 3300013105 Bacteria 1695
91 Ga0157374_10000349 3300013296 Bacteria 42687
92 Ga0157374_10009334 3300013296 Bacteria 8416
93 Ga0157374_10013797 3300013296 Bacteria 7058
94 Ga0157378_10036594 3300013297 Bacteria 4344
95 Ga0163162_10000066 3300013306 Bacteria 100009
96 Ga0163162_10380264 3300013306 Bacteria 1545
97 Ga0157372_10312198 3300013307 Bacteria 1830
98 Ga0157375_10004387 3300013308 Bacteria 12251
99 Ga0157375_10087862 3300013308 Bacteria 3162
100 Ga0182008_10010113 3300014497 Bacteria 5060
101 Ga0157377_10015289 3300014745 Bacteria 3922
102 Ga0157376_10021299 3300014969 Bacteria 5034
103 Ga0182007_10001161 3300015262 Bacteria 14261
104 Ga0163161_10043034 3300017792 Bacteria 3251
105 Ga0213872_10020246 3300021361 Bacteria 3065
106 Ga0213876_10000013 3300021384 Bacteria 342052
107 Ga0209147_100076 3300025229 Bacteria 207570
108 Ga0207427_100103 3300025231 Bacteria 119618
109 Ga0209437_100085 3300025233 Bacteria 254790
110 Ga0209437_100101 3300025233 Bacteria 226668
111 Ga0209026_1005398 3300025250 Bacteria 3453
112 Ga0209759_1000028 3300025256 Bacteria 298755
113 Ga0209233_1000124 3300025261 Bacteria 226743
114 Ga0209455_1002947 3300025272 Bacteria 6264
115 Ga0207647_10002505 3300025904 Bacteria 13907
116 Ga0207647_10034693 3300025904 Bacteria 3218
117 Ga0207645_10000131 3300025907 Bacteria 56813
118 Ga0207705_10000015 3300025909 Bacteria 382901
119 Ga0207705_10097257 3300025909 Bacteria 2162
120 Ga0207654_10003102 3300025911 Bacteria 8409
121 Ga0207654_10055013 3300025911 Bacteria 2302
122 Ga0207654_10194327 3300025911 Bacteria 1332
123 Ga0207707_10109328 3300025912 Bacteria 2417
124 Ga0207695_10003939 3300025913 Bacteria 20541
125 Ga0207695_10008178 3300025913 Bacteria 13141
126 Ga0207695_10018968 3300025913 Bacteria 7934
127 Ga0207695_10057091 3300025913 Bacteria 4058
128 Ga0207695_10167107 3300025913 Bacteria 2127
129 Ga0207695_10231527 3300025913 Bacteria 1752
130 Ga0207671_10007035 3300025914 Bacteria 9856
131 Ga0207671_10008415 3300025914 Bacteria 8756
132 Ga0207671_10036642 3300025914 Bacteria 3638
133 Ga0207671_10041286 3300025914 Bacteria 3414
134 Ga0207671_10085679 3300025914 Bacteria 2368
135 Ga0207660_10098107 3300025917 Bacteria 2185
136 Ga0207657_10000155 3300025919 Bacteria 70060
137 Ga0207657_10055478 3300025919 Bacteria 3422
138 Ga0207652_10008194 3300025921 Bacteria 8392
139 Ga0207652_10076817 3300025921 Bacteria 2913
140 Ga0207694_10042009 3300025924 Bacteria 3525
141 Ga0207694_10116389 3300025924 Bacteria 2130
142 Ga0207644_10011827 3300025931 Bacteria 5780
143 Ga0207690_10000016 3300025932 Bacteria 256657
144 Ga0207706_10000126 3300025933 Bacteria 82630
145 Ga0207704_10000109 3300025938 Bacteria 45314
146 Ga0207691_10081153 3300025940 Bacteria 2916
147 Ga0207667_10000037 3300025949 Bacteria 297252
148 Ga0207667_10003555 3300025949 Bacteria 19273
149 Ga0207667_10009582 3300025949 Bacteria 11396
150 Ga0207667_10123993 3300025949 Bacteria 2661
151 Ga0207651_10034378 3300025960 Bacteria 3282
152 Ga0207640_10031036 3300025981 Bacteria 3298
153 Ga0207639_10006033 3300026041 Bacteria 8218
154 Ga0207639_10007595 3300026041 Bacteria 7396
155 Ga0207639_10156222 3300026041 Bacteria 1916
156 Ga0207702_10000451 3300026078 Bacteria 46484
157 Ga0207702_10061353 3300026078 Bacteria 3207
158 Ga0207702_10186558 3300026078 Bacteria 1913
159 Ga0207648_10000155 3300026089 Bacteria 69524
160 Ga0207698_10036779 3300026142 Bacteria 3598
161 Ga0207698_10037057 3300026142 Bacteria 3587
162 Ga0268266_10000052 3300028379 Bacteria 296230
163 Ga0307515_10001310 3300028794 Bacteria 56561
164 Ga0307515_10002920 3300028794 Bacteria 36261
165 Ga0316176_1186668 3300030732 Bacteria 8909
166 Ga0316579_10010249 3300031691 Bacteria 3957
167 Ga0316579_10038336 3300031691 Bacteria 2216
168 Ga0316579_10048643 3300031691 Bacteria 1981
169 Ga0316576_10069958 3300031727 Bacteria 2588
170 Ga0316576_10152859 3300031727 Bacteria 1739
171 Ga0316576_10158327 3300031727 Bacteria 1708
172 Ga0316578_10003802 3300031728 Bacteria 6990
173 Ga0316578_10003902 3300031728 Bacteria 6936
174 Ga0316578_10043667 3300031728 Bacteria 2604
175 Ga0316577_10092572 3300031733 Bacteria 1692
176 Ga0316583_10002704 3300032133 Bacteria 6196
177 Ga0316583_10030572 3300032133 Bacteria 1917
178 Ga0316585_10006218 3300032137 Bacteria 3407
179 Ga0316580_10003209 3300032139 Bacteria 4625
180 Ga0316580_10013356 3300032139 Bacteria 2503
181 Ga0316580_10040812 3300032139 Bacteria 1433
182 Ga0316593_10001916 3300032168 Bacteria 4773
183 Ga0316593_10002320 3300032168 Bacteria 4472
184 Ga0316593_10014013 3300032168 Bacteria 2384
185 Ga0316593_10015655 3300032168 Bacteria 2286
186 Ga0316593_10020575 3300032168 Bacteria 2053
187 Ga0307507_10000010 3300033179 Bacteria 265208
188 Ga0307510_10012066 3300033180 Bacteria 10244
189 Ga0316592_1000074 3300033524 Bacteria 9173
190 Ga0316592_1000777 3300033524 Bacteria 4751
191 Ga0316588_1000107 3300033528 Bacteria 8038
192 Ga0316588_1000380 3300033528 Bacteria 5824
193 Ga0316587_1005719 3300033529 Bacteria 1875
194 Ga0316596_1011837 3300033541 Bacteria 2139
195 Ga0316574_0004255 3300035398 Bacteria 7478
196 Ga0316574_0020917 3300035398 Bacteria 3878
197 Ga0316582_0001421 3300036647 Bacteria 10479
198 Ga0316582_0041732 3300036647 Bacteria 2869
199 Ga0316584_0000571 3300036712 Bacteria 19864
200 Ga0316584_0003852 3300036712 Bacteria 9839
201 Ga0316584_0062780 3300036712 Bacteria 2782
202 Ga0316584_0093022 3300036712 Bacteria 2257
203 Ga0395899_0000033 3300037312 Bacteria 306589
204 Ga0395899_0002590 3300037312 Bacteria 14580
205 Ga0395900_0000330 3300037418 Bacteria 69819
206 Ga0395900_0000687 3300037418 Bacteria 45125
207 Ga0395900_0010575 3300037418 Bacteria 9436
208 Ga0395898_0017021 3300037466 Bacteria 7424
209 Ga0395898_0075365 3300037466 Bacteria 3259
210 Ga0395905_0000301 3300037471 Bacteria 72121
211 Ga0395905_0000769 3300037471 Bacteria 42306
212 Ga0395905_0241394 3300037471 Bacteria 1688
213 Ga0395901_0002005 3300038443 Bacteria 20948
214 Ga0395901_0071188 3300038443 Bacteria 3624
215 Ga0400483_020601 3300039062 Bacteria 4435
216 Ga0400483_181542 3300039062 Bacteria 5472
217 Ga0436365_0471682 3300039437 Bacteria 352256
218 Ga0436361_0335649 3300039447 Bacteria 9308
219 Ga0453684_0038096 3300044712 Bacteria 6582
220 Ga0495650_0013981 3300046471 Bacteria 4210
221 Ga0495585_0004119 3300046492 Bacteria 9520
222 Ga0495596_0026327 3300046500 Bacteria 2345
223 Ga0495606_0013409 3300046507 Bacteria 6474
224 Ga0495606_0022029 3300046507 Bacteria 4656
225 Ga0495606_0023396 3300046507 Bacteria 4477
226 Ga0495610_0075843 3300046512 Bacteria 1556
227 Ga0495616_0022633 3300046513 Bacteria 3393
228 Ga0495631_0013264 3300046518 Bacteria 4003
229 Ga0495648_0002486 3300046524 Bacteria 16923
230 Ga0495648_0046913 3300046524 Bacteria 2675
231 Ga0495648_0090076 3300046524 Unclassified 1720
232 Ga0495663_0000139 3300046525 Bacteria 29591
233 Ga0495597_0000134 3300046542 Bacteria 67108
234 Ga0495633_0001770 3300046558 Bacteria 16011
235 Ga0495668_0000044 3300046616 Bacteria 227585
236 Ga0495625_0000937 3300046660 Bacteria 39137
237 Ga0495625_0012021 3300046660 Bacteria 7026
238 Ga0495625_0016686 3300046660 Bacteria 5769
239 Ga0495625_0028361 3300046660 Bacteria 4199
240 Ga0495625_0171894 3300046660 Bacteria 1446
241 Ga0495599_0004235 3300046678 Bacteria 8478
242 Ga0495672_0001180 3300047320 Bacteria 26503
243 Ga0495683_0015215 3300047323 Bacteria 4006
244 Ga0495687_001680 3300047443 Bacteria 19763
245 Ga0495686_0000292 3300047472 Bacteria 87838
246 Ga0495614_0004955 3300048089 Bacteria 6009
247 Ga0495626_0014591 3300048091 Unclassified 4047
248 Ga0496100_0275682 3300048903 Bacteria 1252
249 Ga0496101_0146309 3300048904 Bacteria 1804
250 Ga0496102_0035403 3300048905 Bacteria 4494
251 Ga0496102_0092388 3300048905 Bacteria 2802
252 Ga0496104_0001437 3300048907 Bacteria 20591
253 Ga0496104_0034063 3300048907 Bacteria 4747
254 Ga0496105_0011491 3300048908 Bacteria 6997
255 Ga0496105_0192616 3300048908 Bacteria 1666
256 Ga0496111_0127706 3300048914 Bacteria 1880
257 Ga0496116_0000861 3300048919 Bacteria 37888
258 Ga0496118_0010738 3300048921 Bacteria 9028
259 Ga0496119_0005272 3300048922 Bacteria 12466
260 Ga0496119_0024269 3300048922 Bacteria 4269
261 Ga0496120_0006207 3300048923 Bacteria 9237
262 Ga0496123_0020260 3300048926 Bacteria 5208
263 Ga0496123_0025001 3300048926 Bacteria 4517
264 Ga0496124_0013727 3300048927 Bacteria 7887
265 Ga0496124_0257113 3300048927 Bacteria 1288
266 Ga0496125_0023802 3300048928 Bacteria 5645
267 Ga0496126_0009896 3300048929 Bacteria 10075
268 Ga0496126_0248538 3300048929 Bacteria 1483
269 Ga0495678_018855 3300049459 Bacteria 3092
270 Ga0495682_0013814 3300049460 Bacteria 3069
271 Ga0501034_0000128 3300049571 Bacteria 140568
272 nmdc:mga00v17_2699_c1 3300050491 Bacteria 9103
273 Ga0500647_0039487 3300053091 Bacteria 2263
274 Ga0500608_011302 3300053122 Bacteria 3871
275 Ga0500618_000001 3300053125 Bacteria 538477
276 Ga0500618_000279 3300053125 Bacteria 39056
277 Ga0500616_0001996 3300053153 Bacteria 18105
278 Ga0500622_0000199 3300053156 Bacteria 63518
279 2919137917 2919134579 Bacteria 4480386
280 2513566848 2513237083 Bacteria 8410967
281 2513952301 2513237150 Bacteria 6553639
282 2514041805 2513237165 Bacteria 6771773
283 2521557965 2521172590 Bacteria 5047645
284 2553003096 2551306416 Bacteria 6152985
285 2578458569 2576861471 Bacteria 4648976
286 2808972539 2808606384 Bacteria 8474373
287 2809007468 2808606390 Bacteria 8476311
288 2809014506 2808606391 Bacteria 8308166
289 2852625254 2852623160 Bacteria 4376875
290 2856291869 2856287931 Bacteria 7223934
291 2857360420 2857357740 Bacteria 9937880
292 2884934267 2884933994 Bacteria 4535041
293 2900639951 2900634093 Bacteria 10263517
294 2919046432 2919046199 Bacteria 5567169
295 2919441166 2919437846 Bacteria 6199444
296 2923511212 2923510766 Bacteria 5926163
297 2937612273 2937610967 Bacteria 4618818
298 2952252724 2952252522 Bacteria 4171745
299 2977233012 2977232053 Bacteria 5485925
300 2981995492 2981990288 Bacteria 7590678
301 642617312 642555113 Bacteria 8214658
302 644751134 644736347 Bacteria 6476522
303 8003963027 8003955200 Bacteria 8601927
304 8018847629 8018845410 Bacteria 8933938
305 JGI24736J21556_1006228
306 JGI24744J21845_10006339
307 JGI25156J39149_1000244
308 JGI25162J39368_1000020
309 JGI25162J39368_1000749
310 JGI25164J39214_1000901
311 JGI25165J46597_1000519
312 rootH1_10149881
313 rootH2_10006302
314 rootL2_10066343
315 rootH1_10006920
316 rootH1_10189115
317 Ga0055532_1000123
318 Ga0058863_11945642
319 Ga0058862_10072258
320 Ga0065714_10008876
321 Ga0065714_10080719
322 Ga0065714_10088918
323 Ga0070658_10003203
324 Ga0070658_10255137
325 Ga0070676_10000121
326 Ga0070680_100008599
327 Ga0070660_100000026
328 Ga0070660_100022538
329 Ga0070671_100004458
330 Ga0070673_100002402
331 Ga0070659_100000054
332 Ga0070678_100002279
333 Ga0070662_100000559
334 Ga0070681_10114124
335 Ga0068867_100003937
336 Ga0070679_100065850
337 Ga0070679_100138029
338 Ga0068853_100013381
339 Ga0068853_100032664
340 Ga0068853_100039178
341 Ga0070672_100066521
342 Ga0070665_100000003
343 Ga0068855_100000240
344 Ga0068855_100002853
345 Ga0068855_100009372
346 Ga0068855_100036996
347 Ga0068855_100058731
348 Ga0068855_100101904
349 Ga0068855_100399140
350 Ga0068856_100000092
351 Ga0068856_100147638
352 Ga0068856_100630936
353 Ga0068852_100000264
354 Ga0068852_100008969
355 Ga0075364_10002576
356 Ga0075432_10007381
357 Ga0075432_10011624
358 Ga0075366_10000615
359 Ga0075366_10000739
360 Ga0097621_100000152
361 Ga0068871_100000020
362 Ga0068865_100000138
363 Ga0105244_10005099
364 Ga0105250_10007731
365 Ga0105240_10010038
366 Ga0105240_10015889
367 Ga0105240_10025077
368 Ga0105240_10053765
369 Ga0105240_10325148
370 Ga0105240_10356858
371 Ga0105240_10363226
372 Ga0105241_10001146
373 Ga0105241_10234007
374 Ga0105241_10320451
375 Ga0105237_10000803
376 Ga0105237_10003112
377 Ga0105237_10005064
378 Ga0105237_10008443
379 Ga0105237_10058187
380 Ga0105237_10133942
381 Ga0105238_10029875
382 Ga0105238_10047090
383 Ga0105238_10225804
384 Ga0105239_10000010
385 Ga0105239_10000178
386 Ga0105239_10003299
387 Ga0105239_10008401
388 Ga0105239_10011430
389 Ga0105239_10012536
390 Ga0105239_10013700
391 Ga0157373_10014445
392 Ga0157370_10152709
393 Ga0157369_10018596
394 Ga0157369_10292620
395 Ga0157374_10000349
396 Ga0157374_10009334
397 Ga0157374_10013797
398 Ga0157378_10036594
399 Ga0163162_10000066
400 Ga0163162_10380264
401 Ga0157372_10312198
402 Ga0157375_10004387
403 Ga0157375_10087862
404 Ga0182008_10010113
405 Ga0157377_10015289
406 Ga0157376_10021299
407 Ga0182007_10001161
408 Ga0163161_10043034
409 Ga0213872_10020246
410 Ga0213876_10000013
411 Ga0209147_100076
412 Ga0207427_100103
413 Ga0209437_100085
414 Ga0209437_100101
415 Ga0209026_1005398
416 Ga0209759_1000028
417 Ga0209233_1000124
418 Ga0209455_1002947
419 Ga0207647_10002505
420 Ga0207647_10034693
421 Ga0207645_10000131
422 Ga0207705_10000015
423 Ga0207705_10097257
424 Ga0207654_10003102
425 Ga0207654_10055013
426 Ga0207654_10194327
427 Ga0207707_10109328
428 Ga0207695_10003939
429 Ga0207695_10008178
430 Ga0207695_10018968
431 Ga0207695_10057091
432 Ga0207695_10167107
433 Ga0207695_10231527
434 Ga0207671_10007035
435 Ga0207671_10008415
436 Ga0207671_10036642
437 Ga0207671_10041286
438 Ga0207671_10085679
439 Ga0207660_10098107
440 Ga0207657_10000155
441 Ga0207657_10055478
442 Ga0207652_10008194
443 Ga0207652_10076817
444 Ga0207694_10042009
445 Ga0207694_10116389
446 Ga0207644_10011827
447 Ga0207690_10000016
448 Ga0207706_10000126
449 Ga0207704_10000109
450 Ga0207691_10081153
451 Ga0207667_10000037
452 Ga0207667_10003555
453 Ga0207667_10009582
454 Ga0207667_10123993
455 Ga0207651_10034378
456 Ga0207640_10031036
457 Ga0207639_10006033
458 Ga0207639_10007595
459 Ga0207639_10156222
460 Ga0207702_10000451
461 Ga0207702_10061353
462 Ga0207702_10186558
463 Ga0207648_10000155
464 Ga0207698_10036779
465 Ga0207698_10037057
466 Ga0268266_10000052
467 Ga0307515_10001310
468 Ga0307515_10002920
469 Ga0316176_1186668
470 Ga0316579_10010249
471 Ga0316579_10038336
472 Ga0316579_10048643
473 Ga0316576_10069958
474 Ga0316576_10152859
475 Ga0316576_10158327
476 Ga0316578_10003802
477 Ga0316578_10003902
478 Ga0316578_10043667
479 Ga0316577_10092572
480 Ga0316583_10002704
481 Ga0316583_10030572
482 Ga0316585_10006218
483 Ga0316580_10003209
484 Ga0316580_10013356
485 Ga0316580_10040812
486 Ga0316593_10001916
487 Ga0316593_10002320
488 Ga0316593_10014013
489 Ga0316593_10015655
490 Ga0316593_10020575
491 Ga0307507_10000010
492 Ga0307510_10012066
493 Ga0316592_1000074
494 Ga0316592_1000777
495 Ga0316588_1000107
496 Ga0316588_1000380
497 Ga0316587_1005719
498 Ga0316596_1011837
499 Ga0316574_0004255
500 Ga0316574_0020917
501 Ga0316582_0001421
502 Ga0316582_0041732
503 Ga0316584_0000571
504 Ga0316584_0003852
505 Ga0316584_0062780
506 Ga0316584_0093022
507 Ga0395899_0000033
508 Ga0395899_0002590
509 Ga0395900_0000330
510 Ga0395900_0000687
511 Ga0395900_0010575
512 Ga0395898_0017021
513 Ga0395898_0075365
514 Ga0395905_0000301
515 Ga0395905_0000769
516 Ga0395905_0241394
517 Ga0395901_0002005
518 Ga0395901_0071188
519 Ga0400483_020601
520 Ga0400483_181542
521 Ga0436365_0471682
522 Ga0436361_0335649
523 Ga0453684_0038096
524 Ga0495650_0013981
525 Ga0495585_0004119
526 Ga0495596_0026327
527 Ga0495606_0013409
528 Ga0495606_0022029
529 Ga0495606_0023396
530 Ga0495610_0075843
531 Ga0495616_0022633
532 Ga0495631_0013264
533 Ga0495648_0002486
534 Ga0495648_0046913
535 Ga0495648_0090076
536 Ga0495663_0000139
537 Ga0495597_0000134
538 Ga0495633_0001770
539 Ga0495668_0000044
540 Ga0495625_0000937
541 Ga0495625_0012021
542 Ga0495625_0016686
543 Ga0495625_0028361
544 Ga0495625_0171894
545 Ga0495599_0004235
546 Ga0495672_0001180
547 Ga0495683_0015215
548 Ga0495687_001680
549 Ga0495686_0000292
550 Ga0495614_0004955
551 Ga0495626_0014591
552 Ga0496100_0275682
553 Ga0496101_0146309
554 Ga0496102_0035403
555 Ga0496102_0092388
556 Ga0496104_0001437
557 Ga0496104_0034063
558 Ga0496105_0011491
559 Ga0496105_0192616
560 Ga0496111_0127706
561 Ga0496116_0000861
562 Ga0496118_0010738
563 Ga0496119_0005272
564 Ga0496119_0024269
565 Ga0496120_0006207
566 Ga0496123_0020260
567 Ga0496123_0025001
568 Ga0496124_0013727
569 Ga0496124_0257113
570 Ga0496125_0023802
571 Ga0496126_0009896
572 Ga0496126_0248538
573 Ga0495678_018855
574 Ga0495682_0013814
575 Ga0501034_0000128
576 nmdc:mga00v17_2699_c1
577 Ga0500647_0039487
578 Ga0500608_011302
579 Ga0500618_000001
580 Ga0500618_000279
581 Ga0500616_0001996
582 Ga0500622_0000199
583 2919137917
584 2513566848
585 2513952301
586 2514041805
587 2521557965
588 2553003096
589 2578458569
590 2808972539
591 2809007468
592 2809014506
593 2852625254
594 2856291869
595 2857360420
596 2884934267
597 2900639951
598 2919046432
599 2919441166
600 2923511212
601 2937612273
602 2952252724
603 2977233012
604 2981995492
605 642617312
606 644751134
607 8003963027
608 8018847629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

76

207

0.98

PF00571

CBS

CBS domain

301

347

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9814 2 171
5uqi-assembly1.cif.gz_A e. coli cft073 c3406 in complex with a5p 0.9717 3 183
3fxa-assembly1.cif.gz_D crystal structure of a putative sugar-phosphate isomerase (lmof2365_0531) from listeria monocytogenes str. 4b f2365 at 1.60 a resolution 0.9641 3 184
3etn-assembly1.cif.gz_C crystal structure of putative phosphosugar isomerase involved in capsule formation (yp_209877.1) from bacteroides fragilis nctc 9343 at 1.70 a resolution 0.9583 1 182
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9537 2 171
ID Description Score Start End Superfamily
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.983 2 190 3.40.50.10490
5vhuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9724 3 183 3.40.50.10490
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9679 2 190 3.40.50.10490
af_I1N9R7_21_211_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9617 1 188 3.40.50.10490
3fxaD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9518 3 184 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A7G3ELT6-F1-model_v4 deleted 0.9886 1 183
AF-A0A656SJ60-F1-model_v4 deleted 0.987 34 115
AF-A0A7C1G239-F1-model_v4 SIS domain-containing protein 0.9854 5 104 GO:0097367
GO:1901135
AF-A0A259R762-F1-model_v4 deleted 0.9791 3 132
AF-A0A353N0A6-F1-model_v4 KpsF/GutQ family sugar-phosphate isomerase 0.9788 3 136 GO:0016853
GO:0097367
GO:1901135

Map