F397773

General Info

Members Datasets Scaffolds Average Seq Length
304 214 608 495

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0004573|Ga0496106_0004573_7162_8784
Length 540
Sequence MRAPDLAFELRARVGCHLSGFGPALILEKTPTERWEETTMNVITAVRAASDTTTVEHFDVLIVGAGISGIGSAYQLTKQLPDRSFVILESQDSFGGTWLTHRYPGIRSDSDLHTFGYSFKPWIGPPIATSDEIKSYMGDVIAENDLAGHIRYRHRIERASWSSETNLWTVEAVRTDSQEPVAFTANFLWMCQGYYRHSEGYTPDWKDVDKFKGRIVHPQLWPGDIELKDKTVLVIGSGATAATLIPSIADTCAHVTMLQRSPTYFRIGRNAIELAETLRQLQVKEEWVHEIVRRKILFEQDAFTKRCLAEPEQVKKELIGQISAILGPDYDVTTHFTPSYRPWRQRIAFVPDADLFEGIRSGKASVVTDEIDRFTEKGVLLKSGRELAADIIVTATGFNLCMLGDIAIEIDGKPLDFADTVTYRGMMFTGVPNMAWVFGYFRASWTLRTDLVADFVCRLLTHMKTKGVQKVVPTLRPEDHNMPLLSWIDPDNFNPGYMMRNMHLLPRRGDKPEWQHSQDYWTEKDEFPKIDLDDAAFVYG

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
211 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
212 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
213 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
214 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0.99
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.92
Nodule 0.33
Rhizoplane 9.21
Rhizosphere 78.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0004573 3300048909 Bacteria 10262
2 JGI25404J52841_10012414 3300003659 Bacteria 1844
3 Ga0065712_10076258 3300005290 Bacteria 3699
4 Ga0070658_10002114 3300005327 Bacteria 16673
5 Ga0070683_100016150 3300005329 Bacteria 6574
6 Ga0070683_100027248 3300005329 Bacteria 5152
7 Ga0068869_100067907 3300005334 Bacteria 2632
8 Ga0070680_100000403 3300005336 Bacteria 29539
9 Ga0070680_100016395 3300005336 Bacteria 5831
10 Ga0070682_100003426 3300005337 Bacteria 8793
11 Ga0068868_100104911 3300005338 Bacteria 2291
12 Ga0070660_100138289 3300005339 Bacteria 1952
13 Ga0070667_100074352 3300005367 Bacteria 2899
14 Ga0070667_100092630 3300005367 Bacteria 2601
15 Ga0070709_10000661 3300005434 Bacteria 19635
16 Ga0070714_100017002 3300005435 Bacteria 5885
17 Ga0070714_100052886 3300005435 Bacteria 3465
18 Ga0070714_100101239 3300005435 Bacteria 2538
19 Ga0070713_100010039 3300005436 Bacteria 6825
20 Ga0070713_100049731 3300005436 Bacteria 3460
21 Ga0070713_100088342 3300005436 Bacteria 2660
22 Ga0070710_10000458 3300005437 Bacteria 19101
23 Ga0070711_100000807 3300005439 Bacteria 16389
24 Ga0070711_100038050 3300005439 Bacteria 3232
25 Ga0070678_100081619 3300005456 Bacteria 2452
26 Ga0070678_100117505 3300005456 Bacteria 2091
27 Ga0070681_10000330 3300005458 Bacteria 38500
28 Ga0070681_10021130 3300005458 Bacteria 6522
29 Ga0068867_100139184 3300005459 Bacteria 1895
30 Ga0070707_100043759 3300005468 Bacteria 4285
31 Ga0070679_100000591 3300005530 Bacteria 30747
32 Ga0070679_100021644 3300005530 Bacteria 6278
33 Ga0070684_100017524 3300005535 Bacteria 5881
34 Ga0070684_100017690 3300005535 Bacteria 5859
35 Ga0070684_100060429 3300005535 Bacteria 3315
36 Ga0068853_100054116 3300005539 Bacteria 3459
37 Ga0070665_100005949 3300005548 Bacteria 12494
38 Ga0070665_100062887 3300005548 Bacteria 3721
39 Ga0070665_100206740 3300005548 Bacteria 1964
40 Ga0068855_100027941 3300005563 Bacteria 6748
41 Ga0068855_100029816 3300005563 Bacteria 6523
42 Ga0070664_100122193 3300005564 Bacteria 2281
43 Ga0068859_100020684 3300005617 Bacteria 6605
44 Ga0068863_100096422 3300005841 Bacteria 2807
45 Ga0068858_100141370 3300005842 Bacteria 2260
46 Ga0068860_100002123 3300005843 Bacteria 20911
47 Ga0068860_100064054 3300005843 Bacteria 3492
48 Ga0081455_10005612 3300005937 Bacteria 13712
49 Ga0081455_10005940 3300005937 Bacteria 13251
50 Ga0081455_10035318 3300005937 Bacteria 4470
51 Ga0081455_10040839 3300005937 Bacteria 4088
52 Ga0081540_1005409 3300005983 Bacteria 9534
53 Ga0081540_1014245 3300005983 Bacteria 5107
54 Ga0081540_1028031 3300005983 Bacteria 3174
55 Ga0081540_1028579 3300005983 Bacteria 3128
56 Ga0081539_10003299 3300005985 Bacteria 20183
57 Ga0081539_10010818 3300005985 Bacteria 7339
58 Ga0081539_10021057 3300005985 Bacteria 4374
59 Ga0070717_10022548 3300006028 Bacteria 4977
60 Ga0070717_10028445 3300006028 Bacteria 4475
61 Ga0070717_10104500 3300006028 Bacteria 2409
62 Ga0070716_100000669 3300006173 Bacteria 14592
63 Ga0070712_100000734 3300006175 Bacteria 19339
64 Ga0070712_100002086 3300006175 Bacteria 12280
65 Ga0070712_100018002 3300006175 Bacteria 4582
66 Ga0075362_10004582 3300006177 Bacteria 4980
67 Ga0097621_100039351 3300006237 Bacteria 3797
68 Ga0068871_100014151 3300006358 Bacteria 5936
69 Ga0075428_100019991 3300006844 Bacteria 7416
70 Ga0075430_100039944 3300006846 Bacteria 3972
71 Ga0075431_100026108 3300006847 Bacteria 5990
72 Ga0075431_100036647 3300006847 Bacteria 5052
73 Ga0075434_100011521 3300006871 Bacteria 8343
74 Ga0075429_100012130 3300006880 Bacteria 7468
75 Ga0068865_100011547 3300006881 Bacteria 5534
76 Ga0097620_100020684 3300006931 Bacteria 6605
77 Ga0075435_100134665 3300007076 Bacteria 2069
78 Ga0099795_10013736 3300007788 Bacteria 2493
79 Ga0099795_10029381 3300007788 Bacteria 1878
80 Ga0105240_10036002 3300009093 Bacteria 6373
81 Ga0111539_10040763 3300009094 Bacteria 5588
82 Ga0105245_10004065 3300009098 Bacteria 12996
83 Ga0114129_10176894 3300009147 Bacteria 2906
84 Ga0114129_10321810 3300009147 Bacteria 2056
85 Ga0105243_10037667 3300009148 Bacteria 3761
86 Ga0105241_10146229 3300009174 Bacteria 1929
87 Ga0105248_10015275 3300009177 Bacteria 8465
88 Ga0105248_10078038 3300009177 Bacteria 3724
89 Ga0105237_10057357 3300009545 Bacteria 3897
90 Ga0105237_10057405 3300009545 Bacteria 3896
91 Ga0105249_10028153 3300009553 Bacteria 5073
92 Ga0105249_10050894 3300009553 Bacteria 3777
93 Ga0105249_10151231 3300009553 Bacteria 2235
94 Ga0105249_10239038 3300009553 Bacteria 1795
95 Ga0105239_10001986 3300010375 Bacteria 26599
96 Ga0163162_10172970 3300013306 Bacteria 2284
97 Ga0157372_10052875 3300013307 Bacteria 4525
98 Ga0157375_10020884 3300013308 Bacteria 5994
99 Ga0182008_10007493 3300014497 Bacteria 6022
100 Ga0157379_10018509 3300014968 Bacteria 6144
101 Ga0206351_10188815 3300020077 Bacteria 1754
102 Ga0206354_11287406 3300020081 Bacteria 4314
103 Ga0206353_10531133 3300020082 Bacteria 12645
104 Ga0213872_10059426 3300021361 Bacteria 1730
105 Ga0213876_10017261 3300021384 Bacteria 3810
106 Ga0213871_10001479 3300021441 Bacteria 3957
107 Ga0209148_1004493 3300025254 Bacteria 3425
108 Ga0209455_1001057 3300025272 Bacteria 13627
109 Ga0209455_1006216 3300025272 Bacteria 3559
110 Ga0207692_10000398 3300025898 Bacteria 15067
111 Ga0207692_10029538 3300025898 Bacteria 2606
112 Ga0207685_10002722 3300025905 Bacteria 4118
113 Ga0207705_10023843 3300025909 Bacteria 4366
114 Ga0207684_10048903 3300025910 Bacteria 3588
115 Ga0207707_10000764 3300025912 Bacteria 31604
116 Ga0207707_10001007 3300025912 Bacteria 27013
117 Ga0207693_10005127 3300025915 Bacteria 10971
118 Ga0207693_10014223 3300025915 Bacteria 6402
119 Ga0207663_10021939 3300025916 Bacteria 3642
120 Ga0207660_10000513 3300025917 Bacteria 25855
121 Ga0207652_10000504 3300025921 Bacteria 39783
122 Ga0207652_10010012 3300025921 Bacteria 7636
123 Ga0207646_10058603 3300025922 Bacteria 3439
124 Ga0207700_10003446 3300025928 Bacteria 9202
125 Ga0207700_10122283 3300025928 Bacteria 2112
126 Ga0207700_10125275 3300025928 Bacteria 2089
127 Ga0207704_10045436 3300025938 Bacteria 2609
128 Ga0207704_10073903 3300025938 Bacteria 2173
129 Ga0207665_10001236 3300025939 Bacteria 17212
130 Ga0207711_10060322 3300025941 Bacteria 3268
131 Ga0207689_10002168 3300025942 Bacteria 18474
132 Ga0207679_10112408 3300025945 Bacteria 2153
133 Ga0207667_10026662 3300025949 Bacteria 6307
134 Ga0207667_10071046 3300025949 Bacteria 3621
135 Ga0207667_10187466 3300025949 Bacteria 2123
136 Ga0207712_10021722 3300025961 Bacteria 4216
137 Ga0207712_10159703 3300025961 Bacteria 1750
138 Ga0207703_10122120 3300026035 Bacteria 2237
139 Ga0207703_10171476 3300026035 Bacteria 1909
140 Ga0207702_10055396 3300026078 Bacteria 3363
141 Ga0207641_10031362 3300026088 Bacteria 4409
142 Ga0207641_10046203 3300026088 Bacteria 3670
143 Ga0207641_10180510 3300026088 Bacteria 1933
144 Ga0207648_10021422 3300026089 Bacteria 5810
145 Ga0207683_10022495 3300026121 Bacteria 5412
146 Ga0207683_10075926 3300026121 Bacteria 2975
147 Ga0207698_10129596 3300026142 Bacteria 2153
148 Ga0207428_10038626 3300027907 Bacteria 3880
149 Ga0268266_10009347 3300028379 Bacteria 8640
150 Ga0268266_10013770 3300028379 Bacteria 6964
151 Ga0268265_10074002 3300028380 Bacteria 2663
152 Ga0268264_10000427 3300028381 Bacteria 58342
153 Ga0265326_10012923 3300028558 Bacteria 2447
154 Ga0265319_1001952 3300028563 Bacteria 11674
155 Ga0265334_10000603 3300028573 Bacteria 18160
156 Ga0265334_10020033 3300028573 Bacteria 2744
157 Ga0265323_10000037 3300028653 Bacteria 71088
158 Ga0265322_10006968 3300028654 Bacteria 3312
159 Ga0265336_10000392 3300028666 Bacteria 27552
160 Ga0265338_10000024 3300028800 Bacteria 297778
161 Ga0265338_10000403 3300028800 Bacteria 77459
162 Ga0265324_10003350 3300029957 Bacteria 7675
163 Ga0307511_10051012 3300030521 Bacteria 3324
164 Ga0265332_10015912 3300031238 Bacteria 3320
165 Ga0265325_10000261 3300031241 Bacteria 37422
166 Ga0265340_10015257 3300031247 Bacteria 3996
167 Ga0265339_10001037 3300031249 Bacteria 21166
168 Ga0265339_10010365 3300031249 Bacteria 5792
169 Ga0265331_10060548 3300031250 Bacteria 1788
170 Ga0307509_10008331 3300031507 Bacteria 13242
171 Ga0265313_10007081 3300031595 Bacteria 7746
172 Ga0307508_10000005 3300031616 Bacteria 286511
173 Ga0316575_10002104 3300031665 Bacteria 6658
174 Ga0316579_10005734 3300031691 Bacteria 5029
175 Ga0316578_10034393 3300031728 Bacteria 2910
176 Ga0307516_10003162 3300031730 Bacteria 21427
177 Ga0316583_10002002 3300032133 Bacteria 6972
178 Ga0307507_10101348 3300033179 Bacteria 2408
179 Ga0307510_10001843 3300033180 Bacteria 23753
180 Ga0373953_0006482 3300035117 Bacteria 3858
181 Ga0373954_0007691 3300035118 Bacteria 4716
182 Ga0373957_0006568 3300035120 Bacteria 3671
183 Ga0373955_0009082 3300035172 Bacteria 4642
184 Ga0373927_0019055 3300035695 Bacteria 4500
185 Ga0373933_0000095 3300035724 Bacteria 55331
186 Ga0373933_0005204 3300035724 Bacteria 7097
187 Ga0373933_0006353 3300035724 Bacteria 6433
188 Ga0373937_0019346 3300036401 Bacteria 6093
189 Ga0373937_0045183 3300036401 Bacteria 4024
190 Ga0373937_0098252 3300036401 Bacteria 2715
191 Ga0316582_0009149 3300036647 Bacteria 5361
192 Ga0373925_0052374 3300037068 Bacteria 3049
193 Ga0400483_030540 3300039062 Bacteria 35909
194 Ga0400483_224736 3300039062 Bacteria 11112
195 Ga0436365_0650112 3300039437 Bacteria 58550
196 Ga0436365_0691555 3300039437 Bacteria 3842
197 Ga0436360_0801775 3300039438 Bacteria 3402
198 Ga0436360_1064405 3300039438 Bacteria 11115
199 Ga0436361_1009089 3300039447 Bacteria 4354
200 Ga0436362_0628703 3300039453 Bacteria 7529
201 Ga0466961_0162652 3300044693 Bacteria 1391
202 Ga0466963_0033715 3300044694 Bacteria 3327
203 Ga0466963_0090467 3300044694 Bacteria 2084
204 Ga0466968_0062829 3300044735 Bacteria 1604
205 Ga0495592_0001349 3300046454 Bacteria 17005
206 Ga0495592_0086854 3300046454 Bacteria 2252
207 Ga0495629_0000114 3300046459 Bacteria 72778
208 Ga0495653_0001693 3300046463 Bacteria 17348
209 Ga0495580_0099255 3300046472 Bacteria 2025
210 Ga0495580_0112212 3300046472 Bacteria 1893
211 Ga0495664_0035165 3300046477 Bacteria 2949
212 Ga0495584_0098837 3300046491 Bacteria 1475
213 Ga0495608_0009888 3300046511 Bacteria 6657
214 Ga0495628_0027426 3300046516 Bacteria 4634
215 Ga0495652_0122650 3300046529 Bacteria 2069
216 Ga0495640_0011419 3300046533 Bacteria 6836
217 Ga0495587_0003240 3300046536 Bacteria 10877
218 Ga0495587_0017748 3300046536 Bacteria 4416
219 Ga0495645_0026269 3300046543 Bacteria 4226
220 Ga0495634_0005378 3300046642 Bacteria 9865
221 Ga0495635_0002589 3300046663 Bacteria 12378
222 Ga0495599_0000800 3300046678 Bacteria 17670
223 Ga0495623_0008330 3300046679 Bacteria 6741
224 Ga0495646_0000456 3300046680 Bacteria 21662
225 Ga0495669_0040019 3300046684 Bacteria 2077
226 Ga0495613_0125245 3300046689 Bacteria 1843
227 Ga0495604_0025806 3300047317 Bacteria 4679
228 Ga0495674_0020500 3300047319 Bacteria 6118
229 Ga0495680_0021844 3300047322 Bacteria 5347
230 Ga0495675_0009492 3300047444 Bacteria 6057
231 Ga0495684_0000739 3300047471 Bacteria 26356
232 Ga0495686_0003525 3300047472 Bacteria 13495
233 Ga0495686_0020863 3300047472 Bacteria 4364
234 Ga0495593_0003301 3300047673 Bacteria 9668
235 Ga0495602_0083090 3300048088 Bacteria 2684
236 Ga0495602_0161215 3300048088 Bacteria 1751
237 Ga0496101_0016373 3300048904 Bacteria 5008
238 Ga0496102_0017979 3300048905 Bacteria 6203
239 Ga0496102_0039601 3300048905 Bacteria 4259
240 Ga0496102_0047970 3300048905 Bacteria 3883
241 Ga0496103_0072049 3300048906 Bacteria 2163
242 Ga0496104_0000742 3300048907 Bacteria 27980
243 Ga0496105_0008895 3300048908 Bacteria 7826
244 Ga0496105_0071422 3300048908 Bacteria 2869
245 Ga0496106_0009966 3300048909 Bacteria 7016
246 Ga0496107_0003951 3300048910 Bacteria 9972
247 Ga0496107_0025466 3300048910 Bacteria 4188
248 Ga0496108_0226445 3300048911 Bacteria 1625
249 Ga0496109_0008682 3300048912 Bacteria 8650
250 Ga0496109_0010262 3300048912 Bacteria 7997
251 Ga0496110_0045723 3300048913 Bacteria 3828
252 Ga0496110_0049670 3300048913 Bacteria 3681
253 Ga0496110_0076877 3300048913 Bacteria 2969
254 Ga0496111_0003687 3300048914 Bacteria 9519
255 Ga0496111_0043298 3300048914 Bacteria 3235
256 Ga0496112_0049532 3300048915 Bacteria 4119
257 Ga0496112_0108680 3300048915 Bacteria 2744
258 Ga0496114_0005366 3300048917 Bacteria 10022
259 Ga0496114_0021224 3300048917 Bacteria 5281
260 Ga0496115_0008372 3300048918 Bacteria 7652
261 Ga0496115_0011127 3300048918 Bacteria 6742
262 Ga0496115_0058540 3300048918 Bacteria 3101
263 Ga0496115_0062195 3300048918 Bacteria 3011
264 Ga0496117_0022077 3300048920 Bacteria 5115
265 Ga0496118_0009370 3300048921 Bacteria 9913
266 Ga0496121_0007387 3300048924 Bacteria 13280
267 Ga0496121_0037383 3300048924 Bacteria 4313
268 Ga0496124_0009342 3300048927 Bacteria 10103
269 Ga0496125_0090169 3300048928 Bacteria 2302
270 Ga0501044_0065036 3300049823 Bacteria 3720
271 nmdc:mga03683_3896_c1 3300050489 Bacteria 4881
272 nmdc:mga06z11_54112_c1 3300050494 Bacteria 2067
273 nmdc:mga05p37_71678_c1 3300050507 Bacteria 4263
274 nmdc:mga09592_43230_c1 3300050508 Bacteria 3792
275 nmdc:mga0qj67_44009_c1 3300050509 Bacteria 3517
276 nmdc:mga06r32_12343_c1 3300050510 Bacteria 7705
277 nmdc:mga06r32_14291_c1 3300050510 Bacteria 7201
278 nmdc:mga08y16_26461_c1 3300050511 Bacteria 6117
279 nmdc:mga0n895_20271_c1 3300050512 Bacteria 6197
280 nmdc:mga0rr50_2315_c1 3300050513 Bacteria 10688
281 nmdc:mga0rr50_45451_c1 3300050513 Bacteria 3227
282 nmdc:mga08x19_32217_c1 3300050514 Bacteria 3302
283 nmdc:mga0a205_2058_c1 3300050515 Bacteria 17586
284 nmdc:mga0sz30_529_c1 3300050516 Bacteria 14206
285 Ga0500635_0017044 3300053080 Bacteria 2170
286 Ga0495595_0000846 3300053084 Bacteria 11723
287 Ga0495595_0009178 3300053084 Bacteria 4086
288 Ga0495619_0000641 3300053085 Bacteria 23059
289 Ga0495619_0003456 3300053085 Bacteria 10193
290 Ga0495619_0022713 3300053085 Bacteria 4017
291 Ga0500651_0085204 3300053093 Bacteria 1953
292 Ga0500566_0002570 3300053094 Bacteria 10806
293 Ga0500566_0062943 3300053094 Bacteria 2096
294 Ga0500641_0001132 3300053096 Bacteria 9472
295 Ga0500595_009063 3300053119 Bacteria 4038
296 Ga0500658_0006110 3300053134 Bacteria 4479
297 Ga0500559_0000178 3300053136 Bacteria 50273
298 Ga0500603_018096 3300053150 Bacteria 1693
299 Ga0500616_0001083 3300053153 Bacteria 28382
300 Ga0500637_0148043 3300053178 Bacteria 1357
301 2513889829 2513237141 Bacteria 8496279
302 2857485853 2857481737 Bacteria 4761446
303 2883295270 2883291878 Bacteria 5894118
304 2894776148 2894772417 Bacteria 5305674
305 Ga0496106_0004573
306 JGI25404J52841_10012414
307 Ga0065712_10076258
308 Ga0070658_10002114
309 Ga0070683_100016150
310 Ga0070683_100027248
311 Ga0068869_100067907
312 Ga0070680_100000403
313 Ga0070680_100016395
314 Ga0070682_100003426
315 Ga0068868_100104911
316 Ga0070660_100138289
317 Ga0070667_100074352
318 Ga0070667_100092630
319 Ga0070709_10000661
320 Ga0070714_100017002
321 Ga0070714_100052886
322 Ga0070714_100101239
323 Ga0070713_100010039
324 Ga0070713_100049731
325 Ga0070713_100088342
326 Ga0070710_10000458
327 Ga0070711_100000807
328 Ga0070711_100038050
329 Ga0070678_100081619
330 Ga0070678_100117505
331 Ga0070681_10000330
332 Ga0070681_10021130
333 Ga0068867_100139184
334 Ga0070707_100043759
335 Ga0070679_100000591
336 Ga0070679_100021644
337 Ga0070684_100017524
338 Ga0070684_100017690
339 Ga0070684_100060429
340 Ga0068853_100054116
341 Ga0070665_100005949
342 Ga0070665_100062887
343 Ga0070665_100206740
344 Ga0068855_100027941
345 Ga0068855_100029816
346 Ga0070664_100122193
347 Ga0068859_100020684
348 Ga0068863_100096422
349 Ga0068858_100141370
350 Ga0068860_100002123
351 Ga0068860_100064054
352 Ga0081455_10005612
353 Ga0081455_10005940
354 Ga0081455_10035318
355 Ga0081455_10040839
356 Ga0081540_1005409
357 Ga0081540_1014245
358 Ga0081540_1028031
359 Ga0081540_1028579
360 Ga0081539_10003299
361 Ga0081539_10010818
362 Ga0081539_10021057
363 Ga0070717_10022548
364 Ga0070717_10028445
365 Ga0070717_10104500
366 Ga0070716_100000669
367 Ga0070712_100000734
368 Ga0070712_100002086
369 Ga0070712_100018002
370 Ga0075362_10004582
371 Ga0097621_100039351
372 Ga0068871_100014151
373 Ga0075428_100019991
374 Ga0075430_100039944
375 Ga0075431_100026108
376 Ga0075431_100036647
377 Ga0075434_100011521
378 Ga0075429_100012130
379 Ga0068865_100011547
380 Ga0097620_100020684
381 Ga0075435_100134665
382 Ga0099795_10013736
383 Ga0099795_10029381
384 Ga0105240_10036002
385 Ga0111539_10040763
386 Ga0105245_10004065
387 Ga0114129_10176894
388 Ga0114129_10321810
389 Ga0105243_10037667
390 Ga0105241_10146229
391 Ga0105248_10015275
392 Ga0105248_10078038
393 Ga0105237_10057357
394 Ga0105237_10057405
395 Ga0105249_10028153
396 Ga0105249_10050894
397 Ga0105249_10151231
398 Ga0105249_10239038
399 Ga0105239_10001986
400 Ga0163162_10172970
401 Ga0157372_10052875
402 Ga0157375_10020884
403 Ga0182008_10007493
404 Ga0157379_10018509
405 Ga0206351_10188815
406 Ga0206354_11287406
407 Ga0206353_10531133
408 Ga0213872_10059426
409 Ga0213876_10017261
410 Ga0213871_10001479
411 Ga0209148_1004493
412 Ga0209455_1001057
413 Ga0209455_1006216
414 Ga0207692_10000398
415 Ga0207692_10029538
416 Ga0207685_10002722
417 Ga0207705_10023843
418 Ga0207684_10048903
419 Ga0207707_10000764
420 Ga0207707_10001007
421 Ga0207693_10005127
422 Ga0207693_10014223
423 Ga0207663_10021939
424 Ga0207660_10000513
425 Ga0207652_10000504
426 Ga0207652_10010012
427 Ga0207646_10058603
428 Ga0207700_10003446
429 Ga0207700_10122283
430 Ga0207700_10125275
431 Ga0207704_10045436
432 Ga0207704_10073903
433 Ga0207665_10001236
434 Ga0207711_10060322
435 Ga0207689_10002168
436 Ga0207679_10112408
437 Ga0207667_10026662
438 Ga0207667_10071046
439 Ga0207667_10187466
440 Ga0207712_10021722
441 Ga0207712_10159703
442 Ga0207703_10122120
443 Ga0207703_10171476
444 Ga0207702_10055396
445 Ga0207641_10031362
446 Ga0207641_10046203
447 Ga0207641_10180510
448 Ga0207648_10021422
449 Ga0207683_10022495
450 Ga0207683_10075926
451 Ga0207698_10129596
452 Ga0207428_10038626
453 Ga0268266_10009347
454 Ga0268266_10013770
455 Ga0268265_10074002
456 Ga0268264_10000427
457 Ga0265326_10012923
458 Ga0265319_1001952
459 Ga0265334_10000603
460 Ga0265334_10020033
461 Ga0265323_10000037
462 Ga0265322_10006968
463 Ga0265336_10000392
464 Ga0265338_10000024
465 Ga0265338_10000403
466 Ga0265324_10003350
467 Ga0307511_10051012
468 Ga0265332_10015912
469 Ga0265325_10000261
470 Ga0265340_10015257
471 Ga0265339_10001037
472 Ga0265339_10010365
473 Ga0265331_10060548
474 Ga0307509_10008331
475 Ga0265313_10007081
476 Ga0307508_10000005
477 Ga0316575_10002104
478 Ga0316579_10005734
479 Ga0316578_10034393
480 Ga0307516_10003162
481 Ga0316583_10002002
482 Ga0307507_10101348
483 Ga0307510_10001843
484 Ga0373953_0006482
485 Ga0373954_0007691
486 Ga0373957_0006568
487 Ga0373955_0009082
488 Ga0373927_0019055
489 Ga0373933_0000095
490 Ga0373933_0005204
491 Ga0373933_0006353
492 Ga0373937_0019346
493 Ga0373937_0045183
494 Ga0373937_0098252
495 Ga0316582_0009149
496 Ga0373925_0052374
497 Ga0400483_030540
498 Ga0400483_224736
499 Ga0436365_0650112
500 Ga0436365_0691555
501 Ga0436360_0801775
502 Ga0436360_1064405
503 Ga0436361_1009089
504 Ga0436362_0628703
505 Ga0466961_0162652
506 Ga0466963_0033715
507 Ga0466963_0090467
508 Ga0466968_0062829
509 Ga0495592_0001349
510 Ga0495592_0086854
511 Ga0495629_0000114
512 Ga0495653_0001693
513 Ga0495580_0099255
514 Ga0495580_0112212
515 Ga0495664_0035165
516 Ga0495584_0098837
517 Ga0495608_0009888
518 Ga0495628_0027426
519 Ga0495652_0122650
520 Ga0495640_0011419
521 Ga0495587_0003240
522 Ga0495587_0017748
523 Ga0495645_0026269
524 Ga0495634_0005378
525 Ga0495635_0002589
526 Ga0495599_0000800
527 Ga0495623_0008330
528 Ga0495646_0000456
529 Ga0495669_0040019
530 Ga0495613_0125245
531 Ga0495604_0025806
532 Ga0495674_0020500
533 Ga0495680_0021844
534 Ga0495675_0009492
535 Ga0495684_0000739
536 Ga0495686_0003525
537 Ga0495686_0020863
538 Ga0495593_0003301
539 Ga0495602_0083090
540 Ga0495602_0161215
541 Ga0496101_0016373
542 Ga0496102_0017979
543 Ga0496102_0039601
544 Ga0496102_0047970
545 Ga0496103_0072049
546 Ga0496104_0000742
547 Ga0496105_0008895
548 Ga0496105_0071422
549 Ga0496106_0009966
550 Ga0496107_0003951
551 Ga0496107_0025466
552 Ga0496108_0226445
553 Ga0496109_0008682
554 Ga0496109_0010262
555 Ga0496110_0045723
556 Ga0496110_0049670
557 Ga0496110_0076877
558 Ga0496111_0003687
559 Ga0496111_0043298
560 Ga0496112_0049532
561 Ga0496112_0108680
562 Ga0496114_0005366
563 Ga0496114_0021224
564 Ga0496115_0008372
565 Ga0496115_0011127
566 Ga0496115_0058540
567 Ga0496115_0062195
568 Ga0496117_0022077
569 Ga0496118_0009370
570 Ga0496121_0007387
571 Ga0496121_0037383
572 Ga0496124_0009342
573 Ga0496125_0090169
574 Ga0501044_0065036
575 nmdc:mga03683_3896_c1
576 nmdc:mga06z11_54112_c1
577 nmdc:mga05p37_71678_c1
578 nmdc:mga09592_43230_c1
579 nmdc:mga0qj67_44009_c1
580 nmdc:mga06r32_12343_c1
581 nmdc:mga06r32_14291_c1
582 nmdc:mga08y16_26461_c1
583 nmdc:mga0n895_20271_c1
584 nmdc:mga0rr50_2315_c1
585 nmdc:mga0rr50_45451_c1
586 nmdc:mga08x19_32217_c1
587 nmdc:mga0a205_2058_c1
588 nmdc:mga0sz30_529_c1
589 Ga0500635_0017044
590 Ga0495595_0000846
591 Ga0495595_0009178
592 Ga0495619_0000641
593 Ga0495619_0003456
594 Ga0495619_0022713
595 Ga0500651_0085204
596 Ga0500566_0002570
597 Ga0500566_0062943
598 Ga0500641_0001132
599 Ga0500595_009063
600 Ga0500658_0006110
601 Ga0500559_0000178
602 Ga0500603_018096
603 Ga0500616_0001083
604 Ga0500637_0148043
605 2513889829
606 2857485853
607 2883295270
608 2894776148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

62

123

0.94

PF00743

FMO-like

Flavin-binding monooxygenase-like

116

272

0.89

PF01946

Thi4

Thi4 family

42

103

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eef-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to octopamine 0.9193 20 58
4gde-assembly1.cif.gz_C crystal structure of nadph-reduced aspergillus fumigatus udp-galactopyranose 0.8946 17 59
4u8i-assembly1.cif.gz_A structure of aspergillus fumigatus udp-galactopyranose mutase mutant f66a 0.8927 17 59
4u8o-assembly1.cif.gz_A structure of aspergillus fumigatus udp-galactopyranose mutase mutant n207a complexed with udp 0.8926 17 59
4u8j-assembly1.cif.gz_D structure of aspergillus fumigatus udp-galactopyranose mutase mutant y104a 0.8911 17 59
ID Description Score Start End Superfamily
af_A0A0G2K6D5_23_292_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9607 115 146 3.30.830.10
af_P9WNF7_1_267_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9549 15 273 3.50.50.60
af_P9WNF9_1_152_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9489 15 167 3.50.50.60
af_O53762_6_249_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9448 15 254 3.50.50.60
af_P9WNF9_1_152_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9429 15 167 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A430KWX5-F1-model_v4 FAD-containing monooxygenase EthA 0.9777 369 497 GO:0004497
AF-A0A358ZC53-F1-model_v4 deleted 0.9746 361 496
AF-A0A383BUQ0-F1-model_v4 FAD-containing monooxygenase EthA 0.9734 148 385 GO:0004499
GO:0050660
GO:0050661
AF-A0A1X6WWS2-F1-model_v4 Monooxygenase, flavin-binding family 0.972 11 497 GO:0004497
AF-A0A382FX63-F1-model_v4 FAD-containing monooxygenase EthA 0.972 17 374 GO:0004499
GO:0050660
GO:0050661

Map