F397748

General Info

Members Datasets Scaffolds Average Seq Length
304 209 299 202

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0020455|Ga0495632_0020455_2102_2713
Length 203
Sequence MMNQQLVDRLAIRETLENWVVWRDAGDWERFATVWHPQGRMMATWFQGTGEEFIHVTKEGWAKGVSILHFLGGSSIDLSECGTRAIAQTKMTISQRGKVEGHDCDVVCTGRFYDFMKKENGQWLVLLRQPIYEKDRVDPVIPGTRIEMQADILESFPEGYRHLAYIQHQIGYKVKKDMPGIRGPVVEALYQRGQQWLARGVLE

Samples

Sample ID Description Type Environment
1 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
2 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
3 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
4 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
5 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
205 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0.33
Rhizoplane 0.33
Rhizosphere 88.16
Stem 0
Stem Tuber 0
Unclassified 4.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10068902 3300001991 Bacteria 736
2 Ga0055543_1019181 3300004625 Bacteria 1268
3 Ga0065165_1001753 3300005262 Bacteria 21608
4 Ga0065707_10083180 3300005295 Bacteria 10104
5 Ga0070658_10060413 3300005327 Bacteria 3087
6 Ga0070658_10847044 3300005327 Bacteria 795
7 Ga0070676_10000404 3300005328 Bacteria 20179
8 Ga0070676_10004778 3300005328 Bacteria 7162
9 Ga0070683_100016319 3300005329 Bacteria 6548
10 Ga0070670_100011077 3300005331 Bacteria 7705
11 Ga0070670_100016983 3300005331 Bacteria 6249
12 Ga0070670_100054416 3300005331 Bacteria 3436
13 Ga0070670_100307638 3300005331 Bacteria 1387
14 Ga0070677_10000382 3300005333 Bacteria 15572
15 Ga0068869_100003614 3300005334 Bacteria 9487
16 Ga0068869_100716678 3300005334 Bacteria 854
17 Ga0070666_10006934 3300005335 Bacteria 6982
18 Ga0068868_100005944 3300005338 Bacteria 8606
19 Ga0068868_100010597 3300005338 Bacteria 6681
20 Ga0068868_100139417 3300005338 Bacteria 1990
21 Ga0070661_100058851 3300005344 Bacteria 2816
22 Ga0070668_100003200 3300005347 Bacteria 12063
23 Ga0070668_100014677 3300005347 Bacteria 5854
24 Ga0070669_100109965 3300005353 Bacteria 2090
25 Ga0070669_100121253 3300005353 Bacteria 1995
26 Ga0070675_100001023 3300005354 Bacteria 20128
27 Ga0070675_100038422 3300005354 Bacteria 3901
28 Ga0070671_100000187 3300005355 Bacteria 41664
29 Ga0070671_100257610 3300005355 Bacteria 1482
30 Ga0070671_100499661 3300005355 Bacteria 1046
31 Ga0070674_100007643 3300005356 Bacteria 6385
32 Ga0070674_100045527 3300005356 Bacteria 2998
33 Ga0070673_100001644 3300005364 Bacteria 13244
34 Ga0070673_100002169 3300005364 Bacteria 11891
35 Ga0070667_100002039 3300005367 Bacteria 17908
36 Ga0070667_100044645 3300005367 Bacteria 3723
37 Ga0070713_100000131 3300005436 Bacteria 49396
38 Ga0070713_100087000 3300005436 Bacteria 2680
39 Ga0070710_10159738 3300005437 Bacteria 1396
40 Ga0070711_100229512 3300005439 Bacteria 1447
41 Ga0070663_100003597 3300005455 Bacteria 8952
42 Ga0070678_100001085 3300005456 Bacteria 14246
43 Ga0070678_100800954 3300005456 Bacteria 856
44 Ga0070662_100095389 3300005457 Bacteria 2242
45 Ga0070662_100141311 3300005457 Bacteria 1866
46 Ga0068867_100279903 3300005459 Bacteria 1368
47 Ga0068867_100297666 3300005459 Bacteria 1329
48 Ga0070698_100187086 3300005471 Bacteria 2008
49 Ga0070684_100549307 3300005535 Bacteria 1072
50 Ga0070697_100634460 3300005536 Bacteria 940
51 Ga0068853_100037871 3300005539 Bacteria 4106
52 Ga0068853_100178145 3300005539 Bacteria 1927
53 Ga0070672_100003058 3300005543 Bacteria 10783
54 Ga0070672_100003076 3300005543 Bacteria 10761
55 Ga0070672_100031249 3300005543 Bacteria 4006
56 Ga0070665_100007846 3300005548 Bacteria 10827
57 Ga0070664_100050970 3300005564 Bacteria 3504
58 Ga0070664_100423600 3300005564 Bacteria 1219
59 Ga0068857_100004633 3300005577 Bacteria 11651
60 Ga0068854_100022092 3300005578 Bacteria 4327
61 Ga0068856_100415044 3300005614 Bacteria 1366
62 Ga0068852_100001203 3300005616 Bacteria 17184
63 Ga0068852_100008827 3300005616 Bacteria 7461
64 Ga0068859_100463719 3300005617 Bacteria 1363
65 Ga0068864_100038314 3300005618 Bacteria 4094
66 Ga0068851_10104688 3300005834 Bacteria 1505
67 Ga0068851_10206802 3300005834 Bacteria 1098
68 Ga0068870_10003134 3300005840 Bacteria 6974
69 Ga0068870_10227491 3300005840 Bacteria 1145
70 Ga0068858_100014317 3300005842 Bacteria 7480
71 Ga0068860_100011292 3300005843 Bacteria 8799
72 Ga0068860_100019618 3300005843 Bacteria 6557
73 Ga0068862_100061968 3300005844 Bacteria 3216
74 Ga0081455_10000120 3300005937 Bacteria 89920
75 Ga0081539_10021758 3300005985 Bacteria 4269
76 Ga0075365_10001106 3300006038 Bacteria 11756
77 Ga0075362_10079142 3300006177 Bacteria 1513
78 Ga0075369_10050366 3300006186 Bacteria 1801
79 Ga0075369_10078504 3300006186 Bacteria 1462
80 Ga0097621_100023758 3300006237 Bacteria 4777
81 Ga0097621_100484179 3300006237 Bacteria 1119
82 Ga0075370_10010782 3300006353 Bacteria 4791
83 Ga0068871_100190017 3300006358 Bacteria 1768
84 Ga0068865_100228143 3300006881 Bacteria 1459
85 Ga0068865_100247271 3300006881 Bacteria 1406
86 Ga0068865_100278180 3300006881 Bacteria 1331
87 Ga0097620_100463722 3300006931 Bacteria 1363
88 Ga0105245_10135854 3300009098 Bacteria 2311
89 Ga0114129_12194661 3300009147 Bacteria 664
90 Ga0105243_10033458 3300009148 Bacteria 3975
91 Ga0105242_10419329 3300009176 Bacteria 1254
92 Ga0105248_10045113 3300009177 Bacteria 4943
93 Ga0105248_10281138 3300009177 Bacteria 1874
94 Ga0105248_10443590 3300009177 Bacteria 1462
95 Ga0105237_10321611 3300009545 Bacteria 1551
96 Ga0105238_10705346 3300009551 Bacteria 1021
97 Ga0105238_11028694 3300009551 Bacteria 845
98 Ga0105239_10423140 3300010375 Bacteria 1509
99 Ga0105246_10140546 3300011119 Bacteria 1815
100 Ga0157316_1016427 3300012510 Bacteria 760
101 Ga0157369_10090661 3300013105 Bacteria 3264
102 Ga0157374_10074354 3300013296 Bacteria 3209
103 Ga0157374_10113321 3300013296 Bacteria 2610
104 Ga0157374_10768752 3300013296 Bacteria 978
105 Ga0163162_10338979 3300013306 Bacteria 1636
106 Ga0157372_10007779 3300013307 Bacteria 11385
107 Ga0157372_10120067 3300013307 Bacteria 3018
108 Ga0157375_10005097 3300013308 Bacteria 11399
109 Ga0157375_10023632 3300013308 Bacteria 5675
110 Ga0157379_10073096 3300014968 Bacteria 3069
111 Ga0157376_10085134 3300014969 Bacteria 2723
112 Ga0182007_10003598 3300015262 Bacteria 7276
113 Ga0183362_10002 3300015683 Bacteria 1432711
114 Ga0163161_10148318 3300017792 Bacteria 1781
115 Ga0213876_10189341 3300021384 Bacteria 1094
116 Ga0209130_1000080 3300025284 Bacteria 166684
117 Ga0207426_1003963 3300025302 Bacteria 7556
118 Ga0207656_10016365 3300025321 Bacteria 2886
119 Ga0207656_10208739 3300025321 Bacteria 946
120 Ga0207682_10002995 3300025893 Bacteria 7412
121 Ga0207688_10246970 3300025901 Bacteria 1080
122 Ga0207680_10014955 3300025903 Bacteria 4036
123 Ga0207645_10000912 3300025907 Bacteria 24531
124 Ga0207645_10002225 3300025907 Bacteria 15461
125 Ga0207643_10003556 3300025908 Bacteria 8392
126 Ga0207643_10111053 3300025908 Bacteria 1615
127 Ga0207705_10181441 3300025909 Bacteria 1589
128 Ga0207693_10122734 3300025915 Bacteria 2040
129 Ga0207693_10157372 3300025915 Bacteria 1787
130 Ga0207660_10107018 3300025917 Bacteria 2098
131 Ga0207662_10014161 3300025918 Bacteria 4468
132 Ga0207657_10871333 3300025919 Bacteria 694
133 Ga0207681_10041131 3300025923 Bacteria 3080
134 Ga0207694_10313126 3300025924 Bacteria 1294
135 Ga0207694_10837293 3300025924 Bacteria 777
136 Ga0207650_10033963 3300025925 Bacteria 3698
137 Ga0207650_10051172 3300025925 Unclassified 3056
138 Ga0207650_10066878 3300025925 Bacteria 2696
139 Ga0207659_10026667 3300025926 Bacteria 3902
140 Ga0207687_10119177 3300025927 Bacteria 1971
141 Ga0207700_10000691 3300025928 Bacteria 19639
142 Ga0207700_10432693 3300025928 Bacteria 1157
143 Ga0207644_10002419 3300025931 Bacteria 12030
144 Ga0207644_10102490 3300025931 Bacteria 2152
145 Ga0207706_10107938 3300025933 Bacteria 2450
146 Ga0207706_10139167 3300025933 Bacteria 2135
147 Ga0207709_10077702 3300025935 Bacteria 2129
148 Ga0207670_10721143 3300025936 Bacteria 827
149 Ga0207669_10013628 3300025937 Bacteria 4046
150 Ga0207669_10040939 3300025937 Bacteria 2692
151 Ga0207669_10642181 3300025937 Bacteria 867
152 Ga0207704_10227787 3300025938 Bacteria 1384
153 Ga0207691_10000342 3300025940 Bacteria 46924
154 Ga0207691_10007666 3300025940 Bacteria 10388
155 Ga0207691_10032545 3300025940 Bacteria 4861
156 Ga0207711_10037127 3300025941 Bacteria 4136
157 Ga0207711_10494365 3300025941 Bacteria 1140
158 Ga0207689_10050828 3300025942 Bacteria 3417
159 Ga0207661_10321599 3300025944 Bacteria 1391
160 Ga0207651_10001027 3300025960 Bacteria 12327
161 Ga0207651_10082645 3300025960 Bacteria 2319
162 Ga0207668_10002518 3300025972 Bacteria 10693
163 Ga0207640_10017308 3300025981 Bacteria 4216
164 Ga0207658_10008096 3300025986 Bacteria 7161
165 Ga0207658_10015677 3300025986 Bacteria 5201
166 Ga0207658_10163619 3300025986 Bacteria 1825
167 Ga0207677_10035392 3300026023 Bacteria 3243
168 Ga0207677_10107275 3300026023 Bacteria 2071
169 Ga0207703_10044639 3300026035 Bacteria 3563
170 Ga0207678_10004759 3300026067 Bacteria 12190
171 Ga0207678_10100574 3300026067 Bacteria 2470
172 Ga0207641_10308476 3300026088 Bacteria 1497
173 Ga0207641_10435975 3300026088 Bacteria 1264
174 Ga0207648_10019429 3300026089 Bacteria 6133
175 Ga0207648_10573454 3300026089 Bacteria 1038
176 Ga0207674_10010371 3300026116 Bacteria 10560
177 Ga0207674_10618475 3300026116 Bacteria 1046
178 Ga0207683_10000020 3300026121 Bacteria 118805
179 Ga0207683_10066425 3300026121 Bacteria 3180
180 Ga0207683_10070087 3300026121 Bacteria 3097
181 Ga0207683_10247778 3300026121 Bacteria 1625
182 Ga0207698_10011424 3300026142 Bacteria 5758
183 Ga0207698_10030282 3300026142 Bacteria 3889
184 Ga0207428_10026980 3300027907 Bacteria 4785
185 Ga0268266_10044697 3300028379 Bacteria 3786
186 Ga0268265_10777357 3300028380 Bacteria 931
187 Ga0268264_10018269 3300028381 Bacteria 5735
188 Ga0307515_10041677 3300028794 Bacteria 7208
189 Ga0307515_10184297 3300028794 Bacteria 2024
190 Ga0265340_10053758 3300031247 Bacteria 1944
191 Ga0265340_10057982 3300031247 Bacteria 1860
192 Ga0265327_10000834 3300031251 Bacteria 45995
193 Ga0307513_10280810 3300031456 Bacteria 1443
194 Ga0307513_10332120 3300031456 Bacteria 1274
195 Ga0307405_10120545 3300031731 Bacteria 1794
196 Ga0307413_10392425 3300031824 Bacteria 1085
197 Ga0307412_10126494 3300031911 Bacteria 1849
198 Ga0307414_11032464 3300032004 Bacteria 757
199 Ga0307411_10523675 3300032005 Bacteria 1007
200 Ga0307415_100363731 3300032126 Bacteria 1222
201 Ga0373949_0000033 3300035090 Bacteria 49664
202 Ga0373941_0013169 3300035115 Bacteria 2180
203 Ga0373953_0062031 3300035117 Bacteria 1530
204 Ga0436365_0941693 3300039437 Bacteria 2481
205 Ga0436362_0551912 3300039453 Bacteria 1167
206 Ga0451853_1776449 3300041512 Bacteria 903
207 Ga0439446_0020279 3300042156 Bacteria 1872
208 Ga0451576_0086422 3300045051 Bacteria 3262
209 Ga0495627_000748 3300046453 Bacteria 24274
210 Ga0495590_0000012 3300046457 Bacteria 303377
211 Ga0495638_0027332 3300046460 Bacteria 3694
212 Ga0495651_0126681 3300046462 Bacteria 1870
213 Ga0495650_0001470 3300046471 Bacteria 22609
214 Ga0495606_0110269 3300046507 Bacteria 1661
215 Ga0495610_0000451 3300046512 Bacteria 42520
216 Ga0495610_0075464 3300046512 Bacteria 1561
217 Ga0495620_0000414 3300046515 Bacteria 28505
218 Ga0495632_0020455 3300046519 Bacteria 3583
219 Ga0495643_0128121 3300046522 Bacteria 1276
220 Ga0495586_0201182 3300046535 Bacteria 1129
221 Ga0495645_0012895 3300046543 Bacteria 5899
222 Ga0495625_0104674 3300046660 Bacteria 1940
223 Ga0495680_0747150 3300047322 Bacteria 643
224 Ga0495681_0000923 3300047470 Bacteria 22655
225 Ga0496108_1199677 3300048911 Bacteria 642
226 Ga0496116_0052274 3300048919 Bacteria 2708
227 Ga0496117_0014332 3300048920 Bacteria 6837
228 Ga0496118_0045436 3300048921 Bacteria 3429
229 Ga0496122_0031425 3300048925 Bacteria 4419
230 Ga0496122_0067785 3300048925 Bacteria 2567
231 Ga0496123_0086062 3300048926 Bacteria 1887
232 Ga0496124_0446305 3300048927 Bacteria 883
233 Ga0496125_0004077 3300048928 Bacteria 17098
234 Ga0495678_000976 3300049459 Bacteria 24643
235 Ga0501031_0050484 3300049568 Bacteria 2710
236 Ga0501032_0000320 3300049569 Bacteria 40199
237 Ga0501032_0028518 3300049569 Bacteria 3836
238 Ga0501033_0000968 3300049570 Bacteria 26054
239 Ga0501033_0018587 3300049570 Bacteria 5253
240 Ga0501033_0133443 3300049570 Bacteria 1797
241 Ga0501034_0000058 3300049571 Bacteria 198554
242 Ga0501034_0411943 3300049571 Bacteria 1273
243 Ga0501036_0001143 3300049572 Bacteria 20195
244 Ga0501036_0102154 3300049572 Bacteria 2425
245 Ga0501036_0183824 3300049572 Bacteria 1759
246 Ga0501037_0000700 3300049573 Bacteria 25505
247 Ga0501037_0028390 3300049573 Bacteria 4132
248 Ga0501038_0000059 3300049574 Bacteria 92319
249 Ga0501038_0067500 3300049574 Bacteria 3042
250 Ga0501039_0001176 3300049575 Bacteria 19201
251 Ga0501039_0076720 3300049575 Bacteria 2598
252 Ga0501042_0029640 3300049578 Bacteria 3860
253 Ga0501042_0049201 3300049578 Bacteria 3007
254 Ga0501043_0008489 3300049579 Bacteria 8086
255 Ga0501043_0041059 3300049579 Bacteria 3635
256 Ga0501046_0002041 3300049580 Bacteria 19193
257 Ga0501046_0021955 3300049580 Bacteria 5260
258 Ga0501047_0000022 3300049581 Bacteria 249062
259 Ga0501048_0001669 3300049582 Bacteria 16903
260 Ga0501048_0085949 3300049582 Bacteria 2218
261 Ga0501067_0004416 3300049583 Bacteria 7752
262 Ga0501067_0006382 3300049583 Bacteria 6532
263 Ga0501068_0002467 3300049584 Bacteria 9824
264 Ga0501069_0006753 3300049585 Bacteria 6009
265 Ga0501069_0011231 3300049585 Bacteria 4751
266 Ga0501070_0003309 3300049586 Bacteria 13993
267 Ga0501070_0066608 3300049586 Bacteria 2982
268 Ga0501072_0000449 3300049588 Bacteria 29627
269 Ga0501073_0000604 3300049589 Bacteria 25323
270 Ga0501073_0026034 3300049589 Bacteria 4192
271 Ga0501074_0000028 3300049590 Bacteria 67595
272 Ga0501076_0323144 3300049592 Bacteria 1266
273 Ga0501079_0001041 3300049741 Bacteria 19211
274 Ga0501080_0012552 3300049742 Bacteria 7768
275 Ga0501080_0038783 3300049742 Bacteria 4446
276 Ga0501083_0001278 3300049744 Bacteria 17040
277 Ga0501083_0235057 3300049744 Bacteria 1193
278 Ga0501035_0000240 3300049822 Bacteria 65635
279 Ga0501035_0096767 3300049822 Bacteria 2593
280 Ga0501044_0006000 3300049823 Bacteria 13417
281 Ga0501044_0649442 3300049823 Bacteria 944
282 Ga0501045_0025677 3300049824 Bacteria 4236
283 nmdc:mga03683_145024_c1 3300050489 Bacteria 1069
284 nmdc:mga0yw44_2563_c1 3300050492 Bacteria 7800
285 nmdc:mga0k408_323887_c1 3300050493 Bacteria 920
286 nmdc:mga0k408_78204_c1 3300050493 Bacteria 1935
287 nmdc:mga07m45_197021_c1 3300050496 Bacteria 1171
288 nmdc:mga07m45_7212_c1 3300050496 Bacteria 5668
289 nmdc:mga05p37_140_c1 3300050507 Bacteria 67571
290 nmdc:mga09592_1169_c1 3300050508 Bacteria 20970
291 nmdc:mga06r32_1552_c1 3300050510 Bacteria 20702
292 nmdc:mga08y16_104_c1 3300050511 Bacteria 70280
293 nmdc:mga0sz30_106965_c1 3300050516 Bacteria 1224
294 Ga0500583_0075796 3300053092 Bacteria 1617
295 Ga0500622_0000265 3300053156 Bacteria 53529
296 Ga0500637_0360694 3300053178 Bacteria 769
297 Ga0501084_0011310 3300054114 Bacteria 7390
298 Ga0501082_0001427 3300060353 Bacteria 20991
299 Ga0501082_0130638 3300060353 Bacteria 2179

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0012895 Ga0495645_0012895_1664_2212 180
2 3300005937 Ga0081455_10000120 Ga0081455_1000012068 194
3 iso_pu_bacteria 2919100787 2919106741 194
4 3300005295 Ga0065707_10083180 Ga0065707_100831807 195
5 3300006881 Ga0068865_100278180 Ga0068865_1002781802 195
6 3300014969 Ga0157376_10085134 Ga0157376_100851342 195
7 3300026121 Ga0207683_10066425 Ga0207683_100664253 195
8 3300041512 Ga0451853_1776449 Ga0451853_1776449_209_805 195
9 3300046507 Ga0495606_0110269 Ga0495606_0110269_519_1106 195
10 3300046535 Ga0495586_0201182 Ga0495586_0201182_422_1018 195
11 3300046660 Ga0495625_0104674 Ga0495625_0104674_1282_1875 195
12 3300047322 Ga0495680_0747150 Ga0495680_0747150_40_633 195
13 3300049568 Ga0501031_0050484 Ga0501031_0050484_1068_1664 196
14 3300049569 Ga0501032_0028518 Ga0501032_0028518_2154_2750 196
15 3300049570 Ga0501033_0018587 Ga0501033_0018587_1266_1862 196
16 3300049571 Ga0501034_0411943 Ga0501034_0411943_189_785 196
17 3300049572 Ga0501036_0102154 Ga0501036_0102154_608_1204 196
18 3300049573 Ga0501037_0028390 Ga0501037_0028390_1912_2508 196
19 3300049574 Ga0501038_0067500 Ga0501038_0067500_1528_2124 196
20 3300049575 Ga0501039_0076720 Ga0501039_0076720_1440_2036 196
21 3300049578 Ga0501042_0049201 Ga0501042_0049201_1658_2254 196
22 3300049579 Ga0501043_0041059 Ga0501043_0041059_1267_1863 196
23 3300049580 Ga0501046_0021955 Ga0501046_0021955_3265_3861 196
24 3300049582 Ga0501048_0085949 Ga0501048_0085949_319_915 196
25 3300049583 Ga0501067_0006382 Ga0501067_0006382_4726_5322 196
26 3300049585 Ga0501069_0011231 Ga0501069_0011231_364_960 196
27 3300049586 Ga0501070_0066608 Ga0501070_0066608_2067_2663 196
28 3300049589 Ga0501073_0026034 Ga0501073_0026034_3471_4067 196
29 3300049742 Ga0501080_0038783 Ga0501080_0038783_2719_3315 196
30 3300049744 Ga0501083_0235057 Ga0501083_0235057_319_915 196
31 3300049822 Ga0501035_0096767 Ga0501035_0096767_1656_2252 196
32 3300060353 Ga0501082_0130638 Ga0501082_0130638_977_1573 196
33 iso_pu_bacteria 2894772417 2894773058 196
34 3300006186 Ga0075369_10050366 Ga0075369_100503662 197
35 3300009147 Ga0114129_12194661 Ga0114129_121946611 197
36 3300039453 Ga0436362_0551912 Ga0436362_0551912_213_833 197
37 3300046453 Ga0495627_000748 Ga0495627_000748_12185_12793 197
38 3300046471 Ga0495650_0001470 Ga0495650_0001470_11221_11829 197
39 3300046512 Ga0495610_0000451 Ga0495610_0000451_30355_30963 197
40 3300046512 Ga0495610_0075464 Ga0495610_0075464_337_960 197
41 3300046515 Ga0495620_0000414 Ga0495620_0000414_9187_9795 197
42 3300046522 Ga0495643_0128121 Ga0495643_0128121_407_1030 197
43 3300047470 Ga0495681_0000923 Ga0495681_0000923_11239_11847 197
44 3300048919 Ga0496116_0052274 Ga0496116_0052274_1675_2298 197
45 3300048920 Ga0496117_0014332 Ga0496117_0014332_1863_2486 197
46 3300048921 Ga0496118_0045436 Ga0496118_0045436_614_1237 197
47 3300048925 Ga0496122_0067785 Ga0496122_0067785_1526_2149 197
48 3300048926 Ga0496123_0086062 Ga0496123_0086062_550_1173 197
49 3300048927 Ga0496124_0446305 Ga0496124_0446305_213_836 197
50 3300048928 Ga0496125_0004077 Ga0496125_0004077_11112_11735 197
51 3300053156 Ga0500622_0000265 Ga0500622_0000265_45428_46051 197
52 iso_pu_bacteria 2878035449 2878037433 197
53 3300005459 Ga0068867_100297666 Ga0068867_1002976662 198
54 3300005840 Ga0068870_10227491 Ga0068870_102274912 198
55 3300012510 Ga0157316_1016427 Ga0157316_10164272 198
56 3300025908 Ga0207643_10111053 Ga0207643_101110532 198
57 3300026089 Ga0207648_10573454 Ga0207648_105734541 198
58 3300001991 JGI24743J22301_10068902 JGI24743J22301_100689021 199
59 3300004625 Ga0055543_1019181 Ga0055543_10191812 199
60 3300005262 Ga0065165_1001753 Ga0065165_100175312 199
61 3300005327 Ga0070658_10060413 Ga0070658_100604132 199
62 3300005327 Ga0070658_10847044 Ga0070658_108470441 199
63 3300005328 Ga0070676_10000404 Ga0070676_1000040419 199
64 3300005328 Ga0070676_10004778 Ga0070676_100047782 199
65 3300005329 Ga0070683_100016319 Ga0070683_1000163197 199
66 3300005331 Ga0070670_100011077 Ga0070670_1000110778 199
67 3300005331 Ga0070670_100016983 Ga0070670_1000169837 199
68 3300005331 Ga0070670_100054416 Ga0070670_1000544163 199
69 3300005331 Ga0070670_100307638 Ga0070670_1003076382 199
70 3300005333 Ga0070677_10000382 Ga0070677_100003822 199
71 3300005334 Ga0068869_100003614 Ga0068869_1000036147 199
72 3300005334 Ga0068869_100716678 Ga0068869_1007166781 199
73 3300005335 Ga0070666_10006934 Ga0070666_100069342 199
74 3300005338 Ga0068868_100005944 Ga0068868_1000059444 199
75 3300005338 Ga0068868_100010597 Ga0068868_1000105972 199
76 3300005338 Ga0068868_100139417 Ga0068868_1001394172 199
77 3300005344 Ga0070661_100058851 Ga0070661_1000588513 199
78 3300005347 Ga0070668_100003200 Ga0070668_10000320013 199
79 3300005347 Ga0070668_100014677 Ga0070668_1000146775 199
80 3300005353 Ga0070669_100109965 Ga0070669_1001099651 199
81 3300005353 Ga0070669_100121253 Ga0070669_1001212532 199
82 3300005354 Ga0070675_100001023 Ga0070675_10000102311 199
83 3300005354 Ga0070675_100038422 Ga0070675_1000384225 199
84 3300005355 Ga0070671_100000187 Ga0070671_10000018712 199
85 3300005355 Ga0070671_100257610 Ga0070671_1002576101 199
86 3300005355 Ga0070671_100499661 Ga0070671_1004996612 199
87 3300005356 Ga0070674_100007643 Ga0070674_1000076431 199
88 3300005356 Ga0070674_100045527 Ga0070674_1000455272 199
89 3300005364 Ga0070673_100001644 Ga0070673_10000164413 199
90 3300005364 Ga0070673_100002169 Ga0070673_1000021695 199
91 3300005367 Ga0070667_100002039 Ga0070667_10000203912 199
92 3300005367 Ga0070667_100044645 Ga0070667_1000446455 199
93 3300005436 Ga0070713_100000131 Ga0070713_10000013123 199
94 3300005436 Ga0070713_100087000 Ga0070713_1000870003 199
95 3300005437 Ga0070710_10159738 Ga0070710_101597381 199
96 3300005439 Ga0070711_100229512 Ga0070711_1002295122 199
97 3300005455 Ga0070663_100003597 Ga0070663_1000035979 199
98 3300005456 Ga0070678_100001085 Ga0070678_1000010854 199
99 3300005456 Ga0070678_100800954 Ga0070678_1008009541 199
100 3300005457 Ga0070662_100095389 Ga0070662_1000953894 199
101 3300005457 Ga0070662_100141311 Ga0070662_1001413112 199
102 3300005459 Ga0068867_100279903 Ga0068867_1002799032 199
103 3300005471 Ga0070698_100187086 Ga0070698_1001870863 199
104 3300005535 Ga0070684_100549307 Ga0070684_1005493071 199
105 3300005536 Ga0070697_100634460 Ga0070697_1006344601 199
106 3300005539 Ga0068853_100037871 Ga0068853_1000378715 199
107 3300005539 Ga0068853_100178145 Ga0068853_1001781452 199
108 3300005543 Ga0070672_100003058 Ga0070672_10000305811 199
109 3300005543 Ga0070672_100003076 Ga0070672_1000030768 199
110 3300005543 Ga0070672_100031249 Ga0070672_1000312492 199
111 3300005548 Ga0070665_100007846 Ga0070665_1000078464 199
112 3300005564 Ga0070664_100050970 Ga0070664_1000509702 199
113 3300005564 Ga0070664_100423600 Ga0070664_1004236002 199
114 3300005577 Ga0068857_100004633 Ga0068857_1000046337 199
115 3300005578 Ga0068854_100022092 Ga0068854_1000220922 199
116 3300005614 Ga0068856_100415044 Ga0068856_1004150442 199
117 3300005616 Ga0068852_100001203 Ga0068852_10000120317 199
118 3300005616 Ga0068852_100008827 Ga0068852_1000088272 199
119 3300005617 Ga0068859_100463719 Ga0068859_1004637192 199
120 3300005618 Ga0068864_100038314 Ga0068864_1000383142 199
121 3300005834 Ga0068851_10104688 Ga0068851_101046882 199
122 3300005834 Ga0068851_10206802 Ga0068851_102068022 199
123 3300005840 Ga0068870_10003134 Ga0068870_100031347 199
124 3300005842 Ga0068858_100014317 Ga0068858_1000143176 199
125 3300005843 Ga0068860_100011292 Ga0068860_1000112929 199
126 3300005843 Ga0068860_100019618 Ga0068860_1000196186 199
127 3300005844 Ga0068862_100061968 Ga0068862_1000619683 199
128 3300005985 Ga0081539_10021758 Ga0081539_100217583 199
129 3300006038 Ga0075365_10001106 Ga0075365_100011068 199
130 3300006177 Ga0075362_10079142 Ga0075362_100791423 199
131 3300006186 Ga0075369_10078504 Ga0075369_100785042 199
132 3300006237 Ga0097621_100023758 Ga0097621_1000237586 199
133 3300006237 Ga0097621_100484179 Ga0097621_1004841792 199
134 3300006353 Ga0075370_10010782 Ga0075370_100107825 199
135 3300006358 Ga0068871_100190017 Ga0068871_1001900172 199
136 3300006881 Ga0068865_100228143 Ga0068865_1002281432 199
137 3300006881 Ga0068865_100247271 Ga0068865_1002472712 199
138 3300006931 Ga0097620_100463722 Ga0097620_1004637221 199
139 3300009098 Ga0105245_10135854 Ga0105245_101358542 199
140 3300009148 Ga0105243_10033458 Ga0105243_100334583 199
141 3300009176 Ga0105242_10419329 Ga0105242_104193292 199
142 3300009177 Ga0105248_10045113 Ga0105248_100451132 199
143 3300009177 Ga0105248_10281138 Ga0105248_102811382 199
144 3300009177 Ga0105248_10443590 Ga0105248_104435902 199
145 3300009545 Ga0105237_10321611 Ga0105237_103216112 199
146 3300009551 Ga0105238_10705346 Ga0105238_107053462 199
147 3300009551 Ga0105238_11028694 Ga0105238_110286942 199
148 3300010375 Ga0105239_10423140 Ga0105239_104231402 199
149 3300011119 Ga0105246_10140546 Ga0105246_101405462 199
150 3300013105 Ga0157369_10090661 Ga0157369_100906612 199
151 3300013296 Ga0157374_10074354 Ga0157374_100743544 199
152 3300013296 Ga0157374_10113321 Ga0157374_101133215 199
153 3300013296 Ga0157374_10768752 Ga0157374_107687521 199
154 3300013306 Ga0163162_10338979 Ga0163162_103389792 199
155 3300013307 Ga0157372_10007779 Ga0157372_100077799 199
156 3300013307 Ga0157372_10120067 Ga0157372_101200672 199
157 3300013308 Ga0157375_10005097 Ga0157375_1000509713 199
158 3300013308 Ga0157375_10023632 Ga0157375_100236323 199
159 3300014968 Ga0157379_10073096 Ga0157379_100730962 199
160 3300015262 Ga0182007_10003598 Ga0182007_100035983 199
161 3300015683 Ga0183362_10002 Ga0183362_10002897 199
162 3300017792 Ga0163161_10148318 Ga0163161_101483182 199
163 3300021384 Ga0213876_10189341 Ga0213876_101893411 199
164 3300025284 Ga0209130_1000080 Ga0209130_100008074 199
165 3300025302 Ga0207426_1003963 Ga0207426_10039633 199
166 3300025321 Ga0207656_10016365 Ga0207656_100163651 199
167 3300025321 Ga0207656_10208739 Ga0207656_102087392 199
168 3300025893 Ga0207682_10002995 Ga0207682_100029959 199
169 3300025901 Ga0207688_10246970 Ga0207688_102469702 199
170 3300025903 Ga0207680_10014955 Ga0207680_100149554 199
171 3300025907 Ga0207645_10000912 Ga0207645_1000091219 199
172 3300025907 Ga0207645_10002225 Ga0207645_1000222511 199
173 3300025908 Ga0207643_10003556 Ga0207643_100035566 199
174 3300025909 Ga0207705_10181441 Ga0207705_101814412 199
175 3300025915 Ga0207693_10122734 Ga0207693_101227341 199
176 3300025915 Ga0207693_10157372 Ga0207693_101573721 199
177 3300025917 Ga0207660_10107018 Ga0207660_101070181 199
178 3300025918 Ga0207662_10014161 Ga0207662_100141612 199
179 3300025919 Ga0207657_10871333 Ga0207657_108713332 199
180 3300025923 Ga0207681_10041131 Ga0207681_100411312 199
181 3300025924 Ga0207694_10313126 Ga0207694_103131261 199
182 3300025924 Ga0207694_10837293 Ga0207694_108372931 199
183 3300025925 Ga0207650_10033963 Ga0207650_100339633 199
184 3300025925 Ga0207650_10051172 Ga0207650_100511723 199
185 3300025925 Ga0207650_10066878 Ga0207650_100668782 199
186 3300025926 Ga0207659_10026667 Ga0207659_100266675 199
187 3300025927 Ga0207687_10119177 Ga0207687_101191772 199
188 3300025928 Ga0207700_10000691 Ga0207700_100006913 199
189 3300025928 Ga0207700_10432693 Ga0207700_104326931 199
190 3300025931 Ga0207644_10002419 Ga0207644_100024197 199
191 3300025931 Ga0207644_10102490 Ga0207644_101024902 199
192 3300025933 Ga0207706_10107938 Ga0207706_101079382 199
193 3300025933 Ga0207706_10139167 Ga0207706_101391672 199
194 3300025935 Ga0207709_10077702 Ga0207709_100777022 199
195 3300025936 Ga0207670_10721143 Ga0207670_107211431 199
196 3300025937 Ga0207669_10013628 Ga0207669_100136282 199
197 3300025937 Ga0207669_10040939 Ga0207669_100409392 199
198 3300025937 Ga0207669_10642181 Ga0207669_106421812 199
199 3300025938 Ga0207704_10227787 Ga0207704_102277872 199
200 3300025940 Ga0207691_10000342 Ga0207691_1000034238 199
201 3300025940 Ga0207691_10007666 Ga0207691_1000766610 199
202 3300025940 Ga0207691_10032545 Ga0207691_100325452 199
203 3300025941 Ga0207711_10037127 Ga0207711_100371272 199
204 3300025941 Ga0207711_10494365 Ga0207711_104943652 199
205 3300025942 Ga0207689_10050828 Ga0207689_100508282 199
206 3300025944 Ga0207661_10321599 Ga0207661_103215992 199
207 3300025960 Ga0207651_10001027 Ga0207651_100010279 199
208 3300025960 Ga0207651_10082645 Ga0207651_100826451 199
209 3300025972 Ga0207668_10002518 Ga0207668_100025182 199
210 3300025981 Ga0207640_10017308 Ga0207640_100173084 199
211 3300025986 Ga0207658_10008096 Ga0207658_100080965 199
212 3300025986 Ga0207658_10015677 Ga0207658_100156774 199
213 3300025986 Ga0207658_10163619 Ga0207658_101636192 199
214 3300026023 Ga0207677_10035392 Ga0207677_100353924 199
215 3300026023 Ga0207677_10107275 Ga0207677_101072752 199
216 3300026035 Ga0207703_10044639 Ga0207703_100446394 199
217 3300026067 Ga0207678_10004759 Ga0207678_100047599 199
218 3300026067 Ga0207678_10100574 Ga0207678_101005741 199
219 3300026088 Ga0207641_10308476 Ga0207641_103084761 199
220 3300026088 Ga0207641_10435975 Ga0207641_104359752 199
221 3300026089 Ga0207648_10019429 Ga0207648_100194292 199
222 3300026116 Ga0207674_10010371 Ga0207674_100103719 199
223 3300026116 Ga0207674_10618475 Ga0207674_106184752 199
224 3300026121 Ga0207683_10000020 Ga0207683_1000002087 199
225 3300026121 Ga0207683_10070087 Ga0207683_100700872 199
226 3300026121 Ga0207683_10247778 Ga0207683_102477783 199
227 3300026142 Ga0207698_10011424 Ga0207698_100114243 199
228 3300026142 Ga0207698_10030282 Ga0207698_100302825 199
229 3300027907 Ga0207428_10026980 Ga0207428_100269803 199
230 3300028379 Ga0268266_10044697 Ga0268266_100446972 199
231 3300028380 Ga0268265_10777357 Ga0268265_107773572 199
232 3300028381 Ga0268264_10018269 Ga0268264_100182693 199
233 3300028794 Ga0307515_10041677 Ga0307515_100416776 199
234 3300028794 Ga0307515_10184297 Ga0307515_101842972 199
235 3300031247 Ga0265340_10053758 Ga0265340_100537582 199
236 3300031247 Ga0265340_10057982 Ga0265340_100579822 199
237 3300031251 Ga0265327_10000834 Ga0265327_1000083434 199
238 3300031456 Ga0307513_10280810 Ga0307513_102808102 199
239 3300031456 Ga0307513_10332120 Ga0307513_103321202 199
240 3300031731 Ga0307405_10120545 Ga0307405_101205454 199
241 3300031824 Ga0307413_10392425 Ga0307413_103924251 199
242 3300031911 Ga0307412_10126494 Ga0307412_101264943 199
243 3300032004 Ga0307414_11032464 Ga0307414_110324642 199
244 3300032005 Ga0307411_10523675 Ga0307411_105236751 199
245 3300032126 Ga0307415_100363731 Ga0307415_1003637312 199
246 3300035090 Ga0373949_0000033 Ga0373949_0000033_8993_9595 199
247 3300035115 Ga0373941_0013169 Ga0373941_0013169_1202_1807 199
248 3300035117 Ga0373953_0062031 Ga0373953_0062031_541_1191 199
249 3300039437 Ga0436365_0941693 Ga0436365_0941693_1635_2234 199
250 3300042156 Ga0439446_0020279 Ga0439446_0020279_497_1108 199
251 3300045051 Ga0451576_0086422 Ga0451576_0086422_1352_1954 199
252 3300046457 Ga0495590_0000012 Ga0495590_0000012_70560_71159 199
253 3300046460 Ga0495638_0027332 Ga0495638_0027332_519_1130 199
254 3300046462 Ga0495651_0126681 Ga0495651_0126681_396_995 199
255 3300046519 Ga0495632_0020455 Ga0495632_0020455_2102_2713 199
256 3300048911 Ga0496108_1199677 Ga0496108_1199677_26_631 199
257 3300048925 Ga0496122_0031425 Ga0496122_0031425_1011_1640 199
258 3300049459 Ga0495678_000976 Ga0495678_000976_10056_10655 199
259 3300049569 Ga0501032_0000320 Ga0501032_0000320_1117_1740 199
260 3300049570 Ga0501033_0000968 Ga0501033_0000968_15773_16396 199
261 3300049570 Ga0501033_0133443 Ga0501033_0133443_360_965 199
262 3300049571 Ga0501034_0000058 Ga0501034_0000058_182159_182782 199
263 3300049572 Ga0501036_0001143 Ga0501036_0001143_16098_16721 199
264 3300049572 Ga0501036_0183824 Ga0501036_0183824_189_794 199
265 3300049573 Ga0501037_0000700 Ga0501037_0000700_15773_16396 199
266 3300049574 Ga0501038_0000059 Ga0501038_0000059_82517_83140 199
267 3300049575 Ga0501039_0001176 Ga0501039_0001176_2806_3429 199
268 3300049578 Ga0501042_0029640 Ga0501042_0029640_1052_1675 199
269 3300049579 Ga0501043_0008489 Ga0501043_0008489_4086_4709 199
270 3300049580 Ga0501046_0002041 Ga0501046_0002041_3475_4098 199
271 3300049581 Ga0501047_0000022 Ga0501047_0000022_89566_90189 199
272 3300049582 Ga0501048_0001669 Ga0501048_0001669_1507_2130 199
273 3300049583 Ga0501067_0004416 Ga0501067_0004416_3655_4278 199
274 3300049584 Ga0501068_0002467 Ga0501068_0002467_5728_6351 199
275 3300049585 Ga0501069_0006753 Ga0501069_0006753_3315_3938 199
276 3300049586 Ga0501070_0003309 Ga0501070_0003309_165_788 199
277 3300049588 Ga0501072_0000449 Ga0501072_0000449_23715_24338 199
278 3300049589 Ga0501073_0000604 Ga0501073_0000604_24309_24932 199
279 3300049590 Ga0501074_0000028 Ga0501074_0000028_51200_51823 199
280 3300049592 Ga0501076_0323144 Ga0501076_0323144_322_930 199
281 3300049741 Ga0501079_0001041 Ga0501079_0001041_2826_3449 199
282 3300049742 Ga0501080_0012552 Ga0501080_0012552_3064_3687 199
283 3300049744 Ga0501083_0001278 Ga0501083_0001278_446_1069 199
284 3300049822 Ga0501035_0000240 Ga0501035_0000240_56149_56772 199
285 3300049823 Ga0501044_0006000 Ga0501044_0006000_4086_4709 199
286 3300049823 Ga0501044_0649442 Ga0501044_0649442_292_930 199
287 3300049824 Ga0501045_0025677 Ga0501045_0025677_783_1406 199
288 3300050489 nmdc:mga03683_145024_c1 nmdc:mga03683_145024_c1_181_780 199
289 3300050492 nmdc:mga0yw44_2563_c1 nmdc:mga0yw44_2563_c1_6388_6993 199
290 3300050493 nmdc:mga0k408_323887_c1 nmdc:mga0k408_323887_c1_266_865 199
291 3300050493 nmdc:mga0k408_78204_c1 nmdc:mga0k408_78204_c1_133_792 199
292 3300050496 nmdc:mga07m45_197021_c1 nmdc:mga07m45_197021_c1_468_1073 199
293 3300050496 nmdc:mga07m45_7212_c1 nmdc:mga07m45_7212_c1_4561_5160 199
294 3300050507 nmdc:mga05p37_140_c1 nmdc:mga05p37_140_c1_49543_50142 199
295 3300050508 nmdc:mga09592_1169_c1 nmdc:mga09592_1169_c1_16792_17391 199
296 3300050510 nmdc:mga06r32_1552_c1 nmdc:mga06r32_1552_c1_17381_17980 199
297 3300050511 nmdc:mga08y16_104_c1 nmdc:mga08y16_104_c1_1455_2054 199
298 3300050516 nmdc:mga0sz30_106965_c1 nmdc:mga0sz30_106965_c1_569_1168 199
299 3300053092 Ga0500583_0075796 Ga0500583_0075796_780_1394 199
300 3300053178 Ga0500637_0360694 Ga0500637_0360694_125_730 199
301 3300054114 Ga0501084_0011310 Ga0501084_0011310_961_1584 199
302 3300060353 Ga0501082_0001427 Ga0501082_0001427_18209_18832 199
303 iso_pu_bacteria 2954691527 2954692157 199
304 iso_pu_bacteria 2954701450 2954707223 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13577

SnoaL_4

SnoaL-like domain

4

129

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jmv-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol 0.9617 1 198
7jmr-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis 0.9561 1 198
7jmv-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol 0.9523 1 198
7jmr-assembly1.cif.gz_A crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis 0.9467 1 198
7kd9-assembly2.cif.gz_C crystal structure of gallic acid decarboxylase from arxula adeninivorans 0.9368 1 199
ID Description Score Start End Superfamily
af_P9WL25_11_145_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8512 4 127 3.10.450.50
4gb5A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8509 3 127 3.10.450.50
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8185 10 127 3.10.450.50
3a76A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8154 4 137 3.10.450.50
af_Q7KPV8_5_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7891 9 125 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1Y0BLM0-F1-model_v4 J507 0.9952 3 198
AF-A0A1H6NW08-F1-model_v4 deleted 0.9936 1 199
AF-A0A2P7B700-F1-model_v4 SnoaL-like domain-containing protein 0.9934 1 199
AF-A0A2Z5FZI3-F1-model_v4 SnoaL-like domain-containing protein 0.9933 1 195
AF-H0A5J9-F1-model_v4 SnoaL-like domain-containing protein 0.9931 6 199

Feature Viewer

pLDDT pTM Quality
96.2 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map