F397748
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 209 | 299 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300046519|Ga0495632_0020455|Ga0495632_0020455_2102_2713 |
| Length | 203 |
| Sequence | MMNQQLVDRLAIRETLENWVVWRDAGDWERFATVWHPQGRMMATWFQGTGEEFIHVTKEGWAKGVSILHFLGGSSIDLSECGTRAIAQTKMTISQRGKVEGHDCDVVCTGRFYDFMKKENGQWLVLLRQPIYEKDRVDPVIPGTRIEMQADILESFPEGYRHLAYIQHQIGYKVKKDMPGIRGPVVEALYQRGQQWLARGVLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 2 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 3 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 4 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 5 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 142 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 143 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 162 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 163 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 164 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 165 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 167 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 199 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 205 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 206 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 207 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.36 |
| Metatranscriptomes | 0 |
| Isolates | 1.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.25 |
| Nodule | 0.33 |
| Rhizoplane | 0.33 |
| Rhizosphere | 88.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10068902 | 3300001991 | Bacteria | 736 |
| 2 | Ga0055543_1019181 | 3300004625 | Bacteria | 1268 |
| 3 | Ga0065165_1001753 | 3300005262 | Bacteria | 21608 |
| 4 | Ga0065707_10083180 | 3300005295 | Bacteria | 10104 |
| 5 | Ga0070658_10060413 | 3300005327 | Bacteria | 3087 |
| 6 | Ga0070658_10847044 | 3300005327 | Bacteria | 795 |
| 7 | Ga0070676_10000404 | 3300005328 | Bacteria | 20179 |
| 8 | Ga0070676_10004778 | 3300005328 | Bacteria | 7162 |
| 9 | Ga0070683_100016319 | 3300005329 | Bacteria | 6548 |
| 10 | Ga0070670_100011077 | 3300005331 | Bacteria | 7705 |
| 11 | Ga0070670_100016983 | 3300005331 | Bacteria | 6249 |
| 12 | Ga0070670_100054416 | 3300005331 | Bacteria | 3436 |
| 13 | Ga0070670_100307638 | 3300005331 | Bacteria | 1387 |
| 14 | Ga0070677_10000382 | 3300005333 | Bacteria | 15572 |
| 15 | Ga0068869_100003614 | 3300005334 | Bacteria | 9487 |
| 16 | Ga0068869_100716678 | 3300005334 | Bacteria | 854 |
| 17 | Ga0070666_10006934 | 3300005335 | Bacteria | 6982 |
| 18 | Ga0068868_100005944 | 3300005338 | Bacteria | 8606 |
| 19 | Ga0068868_100010597 | 3300005338 | Bacteria | 6681 |
| 20 | Ga0068868_100139417 | 3300005338 | Bacteria | 1990 |
| 21 | Ga0070661_100058851 | 3300005344 | Bacteria | 2816 |
| 22 | Ga0070668_100003200 | 3300005347 | Bacteria | 12063 |
| 23 | Ga0070668_100014677 | 3300005347 | Bacteria | 5854 |
| 24 | Ga0070669_100109965 | 3300005353 | Bacteria | 2090 |
| 25 | Ga0070669_100121253 | 3300005353 | Bacteria | 1995 |
| 26 | Ga0070675_100001023 | 3300005354 | Bacteria | 20128 |
| 27 | Ga0070675_100038422 | 3300005354 | Bacteria | 3901 |
| 28 | Ga0070671_100000187 | 3300005355 | Bacteria | 41664 |
| 29 | Ga0070671_100257610 | 3300005355 | Bacteria | 1482 |
| 30 | Ga0070671_100499661 | 3300005355 | Bacteria | 1046 |
| 31 | Ga0070674_100007643 | 3300005356 | Bacteria | 6385 |
| 32 | Ga0070674_100045527 | 3300005356 | Bacteria | 2998 |
| 33 | Ga0070673_100001644 | 3300005364 | Bacteria | 13244 |
| 34 | Ga0070673_100002169 | 3300005364 | Bacteria | 11891 |
| 35 | Ga0070667_100002039 | 3300005367 | Bacteria | 17908 |
| 36 | Ga0070667_100044645 | 3300005367 | Bacteria | 3723 |
| 37 | Ga0070713_100000131 | 3300005436 | Bacteria | 49396 |
| 38 | Ga0070713_100087000 | 3300005436 | Bacteria | 2680 |
| 39 | Ga0070710_10159738 | 3300005437 | Bacteria | 1396 |
| 40 | Ga0070711_100229512 | 3300005439 | Bacteria | 1447 |
| 41 | Ga0070663_100003597 | 3300005455 | Bacteria | 8952 |
| 42 | Ga0070678_100001085 | 3300005456 | Bacteria | 14246 |
| 43 | Ga0070678_100800954 | 3300005456 | Bacteria | 856 |
| 44 | Ga0070662_100095389 | 3300005457 | Bacteria | 2242 |
| 45 | Ga0070662_100141311 | 3300005457 | Bacteria | 1866 |
| 46 | Ga0068867_100279903 | 3300005459 | Bacteria | 1368 |
| 47 | Ga0068867_100297666 | 3300005459 | Bacteria | 1329 |
| 48 | Ga0070698_100187086 | 3300005471 | Bacteria | 2008 |
| 49 | Ga0070684_100549307 | 3300005535 | Bacteria | 1072 |
| 50 | Ga0070697_100634460 | 3300005536 | Bacteria | 940 |
| 51 | Ga0068853_100037871 | 3300005539 | Bacteria | 4106 |
| 52 | Ga0068853_100178145 | 3300005539 | Bacteria | 1927 |
| 53 | Ga0070672_100003058 | 3300005543 | Bacteria | 10783 |
| 54 | Ga0070672_100003076 | 3300005543 | Bacteria | 10761 |
| 55 | Ga0070672_100031249 | 3300005543 | Bacteria | 4006 |
| 56 | Ga0070665_100007846 | 3300005548 | Bacteria | 10827 |
| 57 | Ga0070664_100050970 | 3300005564 | Bacteria | 3504 |
| 58 | Ga0070664_100423600 | 3300005564 | Bacteria | 1219 |
| 59 | Ga0068857_100004633 | 3300005577 | Bacteria | 11651 |
| 60 | Ga0068854_100022092 | 3300005578 | Bacteria | 4327 |
| 61 | Ga0068856_100415044 | 3300005614 | Bacteria | 1366 |
| 62 | Ga0068852_100001203 | 3300005616 | Bacteria | 17184 |
| 63 | Ga0068852_100008827 | 3300005616 | Bacteria | 7461 |
| 64 | Ga0068859_100463719 | 3300005617 | Bacteria | 1363 |
| 65 | Ga0068864_100038314 | 3300005618 | Bacteria | 4094 |
| 66 | Ga0068851_10104688 | 3300005834 | Bacteria | 1505 |
| 67 | Ga0068851_10206802 | 3300005834 | Bacteria | 1098 |
| 68 | Ga0068870_10003134 | 3300005840 | Bacteria | 6974 |
| 69 | Ga0068870_10227491 | 3300005840 | Bacteria | 1145 |
| 70 | Ga0068858_100014317 | 3300005842 | Bacteria | 7480 |
| 71 | Ga0068860_100011292 | 3300005843 | Bacteria | 8799 |
| 72 | Ga0068860_100019618 | 3300005843 | Bacteria | 6557 |
| 73 | Ga0068862_100061968 | 3300005844 | Bacteria | 3216 |
| 74 | Ga0081455_10000120 | 3300005937 | Bacteria | 89920 |
| 75 | Ga0081539_10021758 | 3300005985 | Bacteria | 4269 |
| 76 | Ga0075365_10001106 | 3300006038 | Bacteria | 11756 |
| 77 | Ga0075362_10079142 | 3300006177 | Bacteria | 1513 |
| 78 | Ga0075369_10050366 | 3300006186 | Bacteria | 1801 |
| 79 | Ga0075369_10078504 | 3300006186 | Bacteria | 1462 |
| 80 | Ga0097621_100023758 | 3300006237 | Bacteria | 4777 |
| 81 | Ga0097621_100484179 | 3300006237 | Bacteria | 1119 |
| 82 | Ga0075370_10010782 | 3300006353 | Bacteria | 4791 |
| 83 | Ga0068871_100190017 | 3300006358 | Bacteria | 1768 |
| 84 | Ga0068865_100228143 | 3300006881 | Bacteria | 1459 |
| 85 | Ga0068865_100247271 | 3300006881 | Bacteria | 1406 |
| 86 | Ga0068865_100278180 | 3300006881 | Bacteria | 1331 |
| 87 | Ga0097620_100463722 | 3300006931 | Bacteria | 1363 |
| 88 | Ga0105245_10135854 | 3300009098 | Bacteria | 2311 |
| 89 | Ga0114129_12194661 | 3300009147 | Bacteria | 664 |
| 90 | Ga0105243_10033458 | 3300009148 | Bacteria | 3975 |
| 91 | Ga0105242_10419329 | 3300009176 | Bacteria | 1254 |
| 92 | Ga0105248_10045113 | 3300009177 | Bacteria | 4943 |
| 93 | Ga0105248_10281138 | 3300009177 | Bacteria | 1874 |
| 94 | Ga0105248_10443590 | 3300009177 | Bacteria | 1462 |
| 95 | Ga0105237_10321611 | 3300009545 | Bacteria | 1551 |
| 96 | Ga0105238_10705346 | 3300009551 | Bacteria | 1021 |
| 97 | Ga0105238_11028694 | 3300009551 | Bacteria | 845 |
| 98 | Ga0105239_10423140 | 3300010375 | Bacteria | 1509 |
| 99 | Ga0105246_10140546 | 3300011119 | Bacteria | 1815 |
| 100 | Ga0157316_1016427 | 3300012510 | Bacteria | 760 |
| 101 | Ga0157369_10090661 | 3300013105 | Bacteria | 3264 |
| 102 | Ga0157374_10074354 | 3300013296 | Bacteria | 3209 |
| 103 | Ga0157374_10113321 | 3300013296 | Bacteria | 2610 |
| 104 | Ga0157374_10768752 | 3300013296 | Bacteria | 978 |
| 105 | Ga0163162_10338979 | 3300013306 | Bacteria | 1636 |
| 106 | Ga0157372_10007779 | 3300013307 | Bacteria | 11385 |
| 107 | Ga0157372_10120067 | 3300013307 | Bacteria | 3018 |
| 108 | Ga0157375_10005097 | 3300013308 | Bacteria | 11399 |
| 109 | Ga0157375_10023632 | 3300013308 | Bacteria | 5675 |
| 110 | Ga0157379_10073096 | 3300014968 | Bacteria | 3069 |
| 111 | Ga0157376_10085134 | 3300014969 | Bacteria | 2723 |
| 112 | Ga0182007_10003598 | 3300015262 | Bacteria | 7276 |
| 113 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 114 | Ga0163161_10148318 | 3300017792 | Bacteria | 1781 |
| 115 | Ga0213876_10189341 | 3300021384 | Bacteria | 1094 |
| 116 | Ga0209130_1000080 | 3300025284 | Bacteria | 166684 |
| 117 | Ga0207426_1003963 | 3300025302 | Bacteria | 7556 |
| 118 | Ga0207656_10016365 | 3300025321 | Bacteria | 2886 |
| 119 | Ga0207656_10208739 | 3300025321 | Bacteria | 946 |
| 120 | Ga0207682_10002995 | 3300025893 | Bacteria | 7412 |
| 121 | Ga0207688_10246970 | 3300025901 | Bacteria | 1080 |
| 122 | Ga0207680_10014955 | 3300025903 | Bacteria | 4036 |
| 123 | Ga0207645_10000912 | 3300025907 | Bacteria | 24531 |
| 124 | Ga0207645_10002225 | 3300025907 | Bacteria | 15461 |
| 125 | Ga0207643_10003556 | 3300025908 | Bacteria | 8392 |
| 126 | Ga0207643_10111053 | 3300025908 | Bacteria | 1615 |
| 127 | Ga0207705_10181441 | 3300025909 | Bacteria | 1589 |
| 128 | Ga0207693_10122734 | 3300025915 | Bacteria | 2040 |
| 129 | Ga0207693_10157372 | 3300025915 | Bacteria | 1787 |
| 130 | Ga0207660_10107018 | 3300025917 | Bacteria | 2098 |
| 131 | Ga0207662_10014161 | 3300025918 | Bacteria | 4468 |
| 132 | Ga0207657_10871333 | 3300025919 | Bacteria | 694 |
| 133 | Ga0207681_10041131 | 3300025923 | Bacteria | 3080 |
| 134 | Ga0207694_10313126 | 3300025924 | Bacteria | 1294 |
| 135 | Ga0207694_10837293 | 3300025924 | Bacteria | 777 |
| 136 | Ga0207650_10033963 | 3300025925 | Bacteria | 3698 |
| 137 | Ga0207650_10051172 | 3300025925 | Unclassified | 3056 |
| 138 | Ga0207650_10066878 | 3300025925 | Bacteria | 2696 |
| 139 | Ga0207659_10026667 | 3300025926 | Bacteria | 3902 |
| 140 | Ga0207687_10119177 | 3300025927 | Bacteria | 1971 |
| 141 | Ga0207700_10000691 | 3300025928 | Bacteria | 19639 |
| 142 | Ga0207700_10432693 | 3300025928 | Bacteria | 1157 |
| 143 | Ga0207644_10002419 | 3300025931 | Bacteria | 12030 |
| 144 | Ga0207644_10102490 | 3300025931 | Bacteria | 2152 |
| 145 | Ga0207706_10107938 | 3300025933 | Bacteria | 2450 |
| 146 | Ga0207706_10139167 | 3300025933 | Bacteria | 2135 |
| 147 | Ga0207709_10077702 | 3300025935 | Bacteria | 2129 |
| 148 | Ga0207670_10721143 | 3300025936 | Bacteria | 827 |
| 149 | Ga0207669_10013628 | 3300025937 | Bacteria | 4046 |
| 150 | Ga0207669_10040939 | 3300025937 | Bacteria | 2692 |
| 151 | Ga0207669_10642181 | 3300025937 | Bacteria | 867 |
| 152 | Ga0207704_10227787 | 3300025938 | Bacteria | 1384 |
| 153 | Ga0207691_10000342 | 3300025940 | Bacteria | 46924 |
| 154 | Ga0207691_10007666 | 3300025940 | Bacteria | 10388 |
| 155 | Ga0207691_10032545 | 3300025940 | Bacteria | 4861 |
| 156 | Ga0207711_10037127 | 3300025941 | Bacteria | 4136 |
| 157 | Ga0207711_10494365 | 3300025941 | Bacteria | 1140 |
| 158 | Ga0207689_10050828 | 3300025942 | Bacteria | 3417 |
| 159 | Ga0207661_10321599 | 3300025944 | Bacteria | 1391 |
| 160 | Ga0207651_10001027 | 3300025960 | Bacteria | 12327 |
| 161 | Ga0207651_10082645 | 3300025960 | Bacteria | 2319 |
| 162 | Ga0207668_10002518 | 3300025972 | Bacteria | 10693 |
| 163 | Ga0207640_10017308 | 3300025981 | Bacteria | 4216 |
| 164 | Ga0207658_10008096 | 3300025986 | Bacteria | 7161 |
| 165 | Ga0207658_10015677 | 3300025986 | Bacteria | 5201 |
| 166 | Ga0207658_10163619 | 3300025986 | Bacteria | 1825 |
| 167 | Ga0207677_10035392 | 3300026023 | Bacteria | 3243 |
| 168 | Ga0207677_10107275 | 3300026023 | Bacteria | 2071 |
| 169 | Ga0207703_10044639 | 3300026035 | Bacteria | 3563 |
| 170 | Ga0207678_10004759 | 3300026067 | Bacteria | 12190 |
| 171 | Ga0207678_10100574 | 3300026067 | Bacteria | 2470 |
| 172 | Ga0207641_10308476 | 3300026088 | Bacteria | 1497 |
| 173 | Ga0207641_10435975 | 3300026088 | Bacteria | 1264 |
| 174 | Ga0207648_10019429 | 3300026089 | Bacteria | 6133 |
| 175 | Ga0207648_10573454 | 3300026089 | Bacteria | 1038 |
| 176 | Ga0207674_10010371 | 3300026116 | Bacteria | 10560 |
| 177 | Ga0207674_10618475 | 3300026116 | Bacteria | 1046 |
| 178 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 179 | Ga0207683_10066425 | 3300026121 | Bacteria | 3180 |
| 180 | Ga0207683_10070087 | 3300026121 | Bacteria | 3097 |
| 181 | Ga0207683_10247778 | 3300026121 | Bacteria | 1625 |
| 182 | Ga0207698_10011424 | 3300026142 | Bacteria | 5758 |
| 183 | Ga0207698_10030282 | 3300026142 | Bacteria | 3889 |
| 184 | Ga0207428_10026980 | 3300027907 | Bacteria | 4785 |
| 185 | Ga0268266_10044697 | 3300028379 | Bacteria | 3786 |
| 186 | Ga0268265_10777357 | 3300028380 | Bacteria | 931 |
| 187 | Ga0268264_10018269 | 3300028381 | Bacteria | 5735 |
| 188 | Ga0307515_10041677 | 3300028794 | Bacteria | 7208 |
| 189 | Ga0307515_10184297 | 3300028794 | Bacteria | 2024 |
| 190 | Ga0265340_10053758 | 3300031247 | Bacteria | 1944 |
| 191 | Ga0265340_10057982 | 3300031247 | Bacteria | 1860 |
| 192 | Ga0265327_10000834 | 3300031251 | Bacteria | 45995 |
| 193 | Ga0307513_10280810 | 3300031456 | Bacteria | 1443 |
| 194 | Ga0307513_10332120 | 3300031456 | Bacteria | 1274 |
| 195 | Ga0307405_10120545 | 3300031731 | Bacteria | 1794 |
| 196 | Ga0307413_10392425 | 3300031824 | Bacteria | 1085 |
| 197 | Ga0307412_10126494 | 3300031911 | Bacteria | 1849 |
| 198 | Ga0307414_11032464 | 3300032004 | Bacteria | 757 |
| 199 | Ga0307411_10523675 | 3300032005 | Bacteria | 1007 |
| 200 | Ga0307415_100363731 | 3300032126 | Bacteria | 1222 |
| 201 | Ga0373949_0000033 | 3300035090 | Bacteria | 49664 |
| 202 | Ga0373941_0013169 | 3300035115 | Bacteria | 2180 |
| 203 | Ga0373953_0062031 | 3300035117 | Bacteria | 1530 |
| 204 | Ga0436365_0941693 | 3300039437 | Bacteria | 2481 |
| 205 | Ga0436362_0551912 | 3300039453 | Bacteria | 1167 |
| 206 | Ga0451853_1776449 | 3300041512 | Bacteria | 903 |
| 207 | Ga0439446_0020279 | 3300042156 | Bacteria | 1872 |
| 208 | Ga0451576_0086422 | 3300045051 | Bacteria | 3262 |
| 209 | Ga0495627_000748 | 3300046453 | Bacteria | 24274 |
| 210 | Ga0495590_0000012 | 3300046457 | Bacteria | 303377 |
| 211 | Ga0495638_0027332 | 3300046460 | Bacteria | 3694 |
| 212 | Ga0495651_0126681 | 3300046462 | Bacteria | 1870 |
| 213 | Ga0495650_0001470 | 3300046471 | Bacteria | 22609 |
| 214 | Ga0495606_0110269 | 3300046507 | Bacteria | 1661 |
| 215 | Ga0495610_0000451 | 3300046512 | Bacteria | 42520 |
| 216 | Ga0495610_0075464 | 3300046512 | Bacteria | 1561 |
| 217 | Ga0495620_0000414 | 3300046515 | Bacteria | 28505 |
| 218 | Ga0495632_0020455 | 3300046519 | Bacteria | 3583 |
| 219 | Ga0495643_0128121 | 3300046522 | Bacteria | 1276 |
| 220 | Ga0495586_0201182 | 3300046535 | Bacteria | 1129 |
| 221 | Ga0495645_0012895 | 3300046543 | Bacteria | 5899 |
| 222 | Ga0495625_0104674 | 3300046660 | Bacteria | 1940 |
| 223 | Ga0495680_0747150 | 3300047322 | Bacteria | 643 |
| 224 | Ga0495681_0000923 | 3300047470 | Bacteria | 22655 |
| 225 | Ga0496108_1199677 | 3300048911 | Bacteria | 642 |
| 226 | Ga0496116_0052274 | 3300048919 | Bacteria | 2708 |
| 227 | Ga0496117_0014332 | 3300048920 | Bacteria | 6837 |
| 228 | Ga0496118_0045436 | 3300048921 | Bacteria | 3429 |
| 229 | Ga0496122_0031425 | 3300048925 | Bacteria | 4419 |
| 230 | Ga0496122_0067785 | 3300048925 | Bacteria | 2567 |
| 231 | Ga0496123_0086062 | 3300048926 | Bacteria | 1887 |
| 232 | Ga0496124_0446305 | 3300048927 | Bacteria | 883 |
| 233 | Ga0496125_0004077 | 3300048928 | Bacteria | 17098 |
| 234 | Ga0495678_000976 | 3300049459 | Bacteria | 24643 |
| 235 | Ga0501031_0050484 | 3300049568 | Bacteria | 2710 |
| 236 | Ga0501032_0000320 | 3300049569 | Bacteria | 40199 |
| 237 | Ga0501032_0028518 | 3300049569 | Bacteria | 3836 |
| 238 | Ga0501033_0000968 | 3300049570 | Bacteria | 26054 |
| 239 | Ga0501033_0018587 | 3300049570 | Bacteria | 5253 |
| 240 | Ga0501033_0133443 | 3300049570 | Bacteria | 1797 |
| 241 | Ga0501034_0000058 | 3300049571 | Bacteria | 198554 |
| 242 | Ga0501034_0411943 | 3300049571 | Bacteria | 1273 |
| 243 | Ga0501036_0001143 | 3300049572 | Bacteria | 20195 |
| 244 | Ga0501036_0102154 | 3300049572 | Bacteria | 2425 |
| 245 | Ga0501036_0183824 | 3300049572 | Bacteria | 1759 |
| 246 | Ga0501037_0000700 | 3300049573 | Bacteria | 25505 |
| 247 | Ga0501037_0028390 | 3300049573 | Bacteria | 4132 |
| 248 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 249 | Ga0501038_0067500 | 3300049574 | Bacteria | 3042 |
| 250 | Ga0501039_0001176 | 3300049575 | Bacteria | 19201 |
| 251 | Ga0501039_0076720 | 3300049575 | Bacteria | 2598 |
| 252 | Ga0501042_0029640 | 3300049578 | Bacteria | 3860 |
| 253 | Ga0501042_0049201 | 3300049578 | Bacteria | 3007 |
| 254 | Ga0501043_0008489 | 3300049579 | Bacteria | 8086 |
| 255 | Ga0501043_0041059 | 3300049579 | Bacteria | 3635 |
| 256 | Ga0501046_0002041 | 3300049580 | Bacteria | 19193 |
| 257 | Ga0501046_0021955 | 3300049580 | Bacteria | 5260 |
| 258 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 259 | Ga0501048_0001669 | 3300049582 | Bacteria | 16903 |
| 260 | Ga0501048_0085949 | 3300049582 | Bacteria | 2218 |
| 261 | Ga0501067_0004416 | 3300049583 | Bacteria | 7752 |
| 262 | Ga0501067_0006382 | 3300049583 | Bacteria | 6532 |
| 263 | Ga0501068_0002467 | 3300049584 | Bacteria | 9824 |
| 264 | Ga0501069_0006753 | 3300049585 | Bacteria | 6009 |
| 265 | Ga0501069_0011231 | 3300049585 | Bacteria | 4751 |
| 266 | Ga0501070_0003309 | 3300049586 | Bacteria | 13993 |
| 267 | Ga0501070_0066608 | 3300049586 | Bacteria | 2982 |
| 268 | Ga0501072_0000449 | 3300049588 | Bacteria | 29627 |
| 269 | Ga0501073_0000604 | 3300049589 | Bacteria | 25323 |
| 270 | Ga0501073_0026034 | 3300049589 | Bacteria | 4192 |
| 271 | Ga0501074_0000028 | 3300049590 | Bacteria | 67595 |
| 272 | Ga0501076_0323144 | 3300049592 | Bacteria | 1266 |
| 273 | Ga0501079_0001041 | 3300049741 | Bacteria | 19211 |
| 274 | Ga0501080_0012552 | 3300049742 | Bacteria | 7768 |
| 275 | Ga0501080_0038783 | 3300049742 | Bacteria | 4446 |
| 276 | Ga0501083_0001278 | 3300049744 | Bacteria | 17040 |
| 277 | Ga0501083_0235057 | 3300049744 | Bacteria | 1193 |
| 278 | Ga0501035_0000240 | 3300049822 | Bacteria | 65635 |
| 279 | Ga0501035_0096767 | 3300049822 | Bacteria | 2593 |
| 280 | Ga0501044_0006000 | 3300049823 | Bacteria | 13417 |
| 281 | Ga0501044_0649442 | 3300049823 | Bacteria | 944 |
| 282 | Ga0501045_0025677 | 3300049824 | Bacteria | 4236 |
| 283 | nmdc:mga03683_145024_c1 | 3300050489 | Bacteria | 1069 |
| 284 | nmdc:mga0yw44_2563_c1 | 3300050492 | Bacteria | 7800 |
| 285 | nmdc:mga0k408_323887_c1 | 3300050493 | Bacteria | 920 |
| 286 | nmdc:mga0k408_78204_c1 | 3300050493 | Bacteria | 1935 |
| 287 | nmdc:mga07m45_197021_c1 | 3300050496 | Bacteria | 1171 |
| 288 | nmdc:mga07m45_7212_c1 | 3300050496 | Bacteria | 5668 |
| 289 | nmdc:mga05p37_140_c1 | 3300050507 | Bacteria | 67571 |
| 290 | nmdc:mga09592_1169_c1 | 3300050508 | Bacteria | 20970 |
| 291 | nmdc:mga06r32_1552_c1 | 3300050510 | Bacteria | 20702 |
| 292 | nmdc:mga08y16_104_c1 | 3300050511 | Bacteria | 70280 |
| 293 | nmdc:mga0sz30_106965_c1 | 3300050516 | Bacteria | 1224 |
| 294 | Ga0500583_0075796 | 3300053092 | Bacteria | 1617 |
| 295 | Ga0500622_0000265 | 3300053156 | Bacteria | 53529 |
| 296 | Ga0500637_0360694 | 3300053178 | Bacteria | 769 |
| 297 | Ga0501084_0011310 | 3300054114 | Bacteria | 7390 |
| 298 | Ga0501082_0001427 | 3300060353 | Bacteria | 20991 |
| 299 | Ga0501082_0130638 | 3300060353 | Bacteria | 2179 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046543 | Ga0495645_0012895 | Ga0495645_0012895_1664_2212 | 180 |
| 2 | 3300005937 | Ga0081455_10000120 | Ga0081455_1000012068 | 194 |
| 3 | iso_pu_bacteria | 2919100787 | 2919106741 | 194 |
| 4 | 3300005295 | Ga0065707_10083180 | Ga0065707_100831807 | 195 |
| 5 | 3300006881 | Ga0068865_100278180 | Ga0068865_1002781802 | 195 |
| 6 | 3300014969 | Ga0157376_10085134 | Ga0157376_100851342 | 195 |
| 7 | 3300026121 | Ga0207683_10066425 | Ga0207683_100664253 | 195 |
| 8 | 3300041512 | Ga0451853_1776449 | Ga0451853_1776449_209_805 | 195 |
| 9 | 3300046507 | Ga0495606_0110269 | Ga0495606_0110269_519_1106 | 195 |
| 10 | 3300046535 | Ga0495586_0201182 | Ga0495586_0201182_422_1018 | 195 |
| 11 | 3300046660 | Ga0495625_0104674 | Ga0495625_0104674_1282_1875 | 195 |
| 12 | 3300047322 | Ga0495680_0747150 | Ga0495680_0747150_40_633 | 195 |
| 13 | 3300049568 | Ga0501031_0050484 | Ga0501031_0050484_1068_1664 | 196 |
| 14 | 3300049569 | Ga0501032_0028518 | Ga0501032_0028518_2154_2750 | 196 |
| 15 | 3300049570 | Ga0501033_0018587 | Ga0501033_0018587_1266_1862 | 196 |
| 16 | 3300049571 | Ga0501034_0411943 | Ga0501034_0411943_189_785 | 196 |
| 17 | 3300049572 | Ga0501036_0102154 | Ga0501036_0102154_608_1204 | 196 |
| 18 | 3300049573 | Ga0501037_0028390 | Ga0501037_0028390_1912_2508 | 196 |
| 19 | 3300049574 | Ga0501038_0067500 | Ga0501038_0067500_1528_2124 | 196 |
| 20 | 3300049575 | Ga0501039_0076720 | Ga0501039_0076720_1440_2036 | 196 |
| 21 | 3300049578 | Ga0501042_0049201 | Ga0501042_0049201_1658_2254 | 196 |
| 22 | 3300049579 | Ga0501043_0041059 | Ga0501043_0041059_1267_1863 | 196 |
| 23 | 3300049580 | Ga0501046_0021955 | Ga0501046_0021955_3265_3861 | 196 |
| 24 | 3300049582 | Ga0501048_0085949 | Ga0501048_0085949_319_915 | 196 |
| 25 | 3300049583 | Ga0501067_0006382 | Ga0501067_0006382_4726_5322 | 196 |
| 26 | 3300049585 | Ga0501069_0011231 | Ga0501069_0011231_364_960 | 196 |
| 27 | 3300049586 | Ga0501070_0066608 | Ga0501070_0066608_2067_2663 | 196 |
| 28 | 3300049589 | Ga0501073_0026034 | Ga0501073_0026034_3471_4067 | 196 |
| 29 | 3300049742 | Ga0501080_0038783 | Ga0501080_0038783_2719_3315 | 196 |
| 30 | 3300049744 | Ga0501083_0235057 | Ga0501083_0235057_319_915 | 196 |
| 31 | 3300049822 | Ga0501035_0096767 | Ga0501035_0096767_1656_2252 | 196 |
| 32 | 3300060353 | Ga0501082_0130638 | Ga0501082_0130638_977_1573 | 196 |
| 33 | iso_pu_bacteria | 2894772417 | 2894773058 | 196 |
| 34 | 3300006186 | Ga0075369_10050366 | Ga0075369_100503662 | 197 |
| 35 | 3300009147 | Ga0114129_12194661 | Ga0114129_121946611 | 197 |
| 36 | 3300039453 | Ga0436362_0551912 | Ga0436362_0551912_213_833 | 197 |
| 37 | 3300046453 | Ga0495627_000748 | Ga0495627_000748_12185_12793 | 197 |
| 38 | 3300046471 | Ga0495650_0001470 | Ga0495650_0001470_11221_11829 | 197 |
| 39 | 3300046512 | Ga0495610_0000451 | Ga0495610_0000451_30355_30963 | 197 |
| 40 | 3300046512 | Ga0495610_0075464 | Ga0495610_0075464_337_960 | 197 |
| 41 | 3300046515 | Ga0495620_0000414 | Ga0495620_0000414_9187_9795 | 197 |
| 42 | 3300046522 | Ga0495643_0128121 | Ga0495643_0128121_407_1030 | 197 |
| 43 | 3300047470 | Ga0495681_0000923 | Ga0495681_0000923_11239_11847 | 197 |
| 44 | 3300048919 | Ga0496116_0052274 | Ga0496116_0052274_1675_2298 | 197 |
| 45 | 3300048920 | Ga0496117_0014332 | Ga0496117_0014332_1863_2486 | 197 |
| 46 | 3300048921 | Ga0496118_0045436 | Ga0496118_0045436_614_1237 | 197 |
| 47 | 3300048925 | Ga0496122_0067785 | Ga0496122_0067785_1526_2149 | 197 |
| 48 | 3300048926 | Ga0496123_0086062 | Ga0496123_0086062_550_1173 | 197 |
| 49 | 3300048927 | Ga0496124_0446305 | Ga0496124_0446305_213_836 | 197 |
| 50 | 3300048928 | Ga0496125_0004077 | Ga0496125_0004077_11112_11735 | 197 |
| 51 | 3300053156 | Ga0500622_0000265 | Ga0500622_0000265_45428_46051 | 197 |
| 52 | iso_pu_bacteria | 2878035449 | 2878037433 | 197 |
| 53 | 3300005459 | Ga0068867_100297666 | Ga0068867_1002976662 | 198 |
| 54 | 3300005840 | Ga0068870_10227491 | Ga0068870_102274912 | 198 |
| 55 | 3300012510 | Ga0157316_1016427 | Ga0157316_10164272 | 198 |
| 56 | 3300025908 | Ga0207643_10111053 | Ga0207643_101110532 | 198 |
| 57 | 3300026089 | Ga0207648_10573454 | Ga0207648_105734541 | 198 |
| 58 | 3300001991 | JGI24743J22301_10068902 | JGI24743J22301_100689021 | 199 |
| 59 | 3300004625 | Ga0055543_1019181 | Ga0055543_10191812 | 199 |
| 60 | 3300005262 | Ga0065165_1001753 | Ga0065165_100175312 | 199 |
| 61 | 3300005327 | Ga0070658_10060413 | Ga0070658_100604132 | 199 |
| 62 | 3300005327 | Ga0070658_10847044 | Ga0070658_108470441 | 199 |
| 63 | 3300005328 | Ga0070676_10000404 | Ga0070676_1000040419 | 199 |
| 64 | 3300005328 | Ga0070676_10004778 | Ga0070676_100047782 | 199 |
| 65 | 3300005329 | Ga0070683_100016319 | Ga0070683_1000163197 | 199 |
| 66 | 3300005331 | Ga0070670_100011077 | Ga0070670_1000110778 | 199 |
| 67 | 3300005331 | Ga0070670_100016983 | Ga0070670_1000169837 | 199 |
| 68 | 3300005331 | Ga0070670_100054416 | Ga0070670_1000544163 | 199 |
| 69 | 3300005331 | Ga0070670_100307638 | Ga0070670_1003076382 | 199 |
| 70 | 3300005333 | Ga0070677_10000382 | Ga0070677_100003822 | 199 |
| 71 | 3300005334 | Ga0068869_100003614 | Ga0068869_1000036147 | 199 |
| 72 | 3300005334 | Ga0068869_100716678 | Ga0068869_1007166781 | 199 |
| 73 | 3300005335 | Ga0070666_10006934 | Ga0070666_100069342 | 199 |
| 74 | 3300005338 | Ga0068868_100005944 | Ga0068868_1000059444 | 199 |
| 75 | 3300005338 | Ga0068868_100010597 | Ga0068868_1000105972 | 199 |
| 76 | 3300005338 | Ga0068868_100139417 | Ga0068868_1001394172 | 199 |
| 77 | 3300005344 | Ga0070661_100058851 | Ga0070661_1000588513 | 199 |
| 78 | 3300005347 | Ga0070668_100003200 | Ga0070668_10000320013 | 199 |
| 79 | 3300005347 | Ga0070668_100014677 | Ga0070668_1000146775 | 199 |
| 80 | 3300005353 | Ga0070669_100109965 | Ga0070669_1001099651 | 199 |
| 81 | 3300005353 | Ga0070669_100121253 | Ga0070669_1001212532 | 199 |
| 82 | 3300005354 | Ga0070675_100001023 | Ga0070675_10000102311 | 199 |
| 83 | 3300005354 | Ga0070675_100038422 | Ga0070675_1000384225 | 199 |
| 84 | 3300005355 | Ga0070671_100000187 | Ga0070671_10000018712 | 199 |
| 85 | 3300005355 | Ga0070671_100257610 | Ga0070671_1002576101 | 199 |
| 86 | 3300005355 | Ga0070671_100499661 | Ga0070671_1004996612 | 199 |
| 87 | 3300005356 | Ga0070674_100007643 | Ga0070674_1000076431 | 199 |
| 88 | 3300005356 | Ga0070674_100045527 | Ga0070674_1000455272 | 199 |
| 89 | 3300005364 | Ga0070673_100001644 | Ga0070673_10000164413 | 199 |
| 90 | 3300005364 | Ga0070673_100002169 | Ga0070673_1000021695 | 199 |
| 91 | 3300005367 | Ga0070667_100002039 | Ga0070667_10000203912 | 199 |
| 92 | 3300005367 | Ga0070667_100044645 | Ga0070667_1000446455 | 199 |
| 93 | 3300005436 | Ga0070713_100000131 | Ga0070713_10000013123 | 199 |
| 94 | 3300005436 | Ga0070713_100087000 | Ga0070713_1000870003 | 199 |
| 95 | 3300005437 | Ga0070710_10159738 | Ga0070710_101597381 | 199 |
| 96 | 3300005439 | Ga0070711_100229512 | Ga0070711_1002295122 | 199 |
| 97 | 3300005455 | Ga0070663_100003597 | Ga0070663_1000035979 | 199 |
| 98 | 3300005456 | Ga0070678_100001085 | Ga0070678_1000010854 | 199 |
| 99 | 3300005456 | Ga0070678_100800954 | Ga0070678_1008009541 | 199 |
| 100 | 3300005457 | Ga0070662_100095389 | Ga0070662_1000953894 | 199 |
| 101 | 3300005457 | Ga0070662_100141311 | Ga0070662_1001413112 | 199 |
| 102 | 3300005459 | Ga0068867_100279903 | Ga0068867_1002799032 | 199 |
| 103 | 3300005471 | Ga0070698_100187086 | Ga0070698_1001870863 | 199 |
| 104 | 3300005535 | Ga0070684_100549307 | Ga0070684_1005493071 | 199 |
| 105 | 3300005536 | Ga0070697_100634460 | Ga0070697_1006344601 | 199 |
| 106 | 3300005539 | Ga0068853_100037871 | Ga0068853_1000378715 | 199 |
| 107 | 3300005539 | Ga0068853_100178145 | Ga0068853_1001781452 | 199 |
| 108 | 3300005543 | Ga0070672_100003058 | Ga0070672_10000305811 | 199 |
| 109 | 3300005543 | Ga0070672_100003076 | Ga0070672_1000030768 | 199 |
| 110 | 3300005543 | Ga0070672_100031249 | Ga0070672_1000312492 | 199 |
| 111 | 3300005548 | Ga0070665_100007846 | Ga0070665_1000078464 | 199 |
| 112 | 3300005564 | Ga0070664_100050970 | Ga0070664_1000509702 | 199 |
| 113 | 3300005564 | Ga0070664_100423600 | Ga0070664_1004236002 | 199 |
| 114 | 3300005577 | Ga0068857_100004633 | Ga0068857_1000046337 | 199 |
| 115 | 3300005578 | Ga0068854_100022092 | Ga0068854_1000220922 | 199 |
| 116 | 3300005614 | Ga0068856_100415044 | Ga0068856_1004150442 | 199 |
| 117 | 3300005616 | Ga0068852_100001203 | Ga0068852_10000120317 | 199 |
| 118 | 3300005616 | Ga0068852_100008827 | Ga0068852_1000088272 | 199 |
| 119 | 3300005617 | Ga0068859_100463719 | Ga0068859_1004637192 | 199 |
| 120 | 3300005618 | Ga0068864_100038314 | Ga0068864_1000383142 | 199 |
| 121 | 3300005834 | Ga0068851_10104688 | Ga0068851_101046882 | 199 |
| 122 | 3300005834 | Ga0068851_10206802 | Ga0068851_102068022 | 199 |
| 123 | 3300005840 | Ga0068870_10003134 | Ga0068870_100031347 | 199 |
| 124 | 3300005842 | Ga0068858_100014317 | Ga0068858_1000143176 | 199 |
| 125 | 3300005843 | Ga0068860_100011292 | Ga0068860_1000112929 | 199 |
| 126 | 3300005843 | Ga0068860_100019618 | Ga0068860_1000196186 | 199 |
| 127 | 3300005844 | Ga0068862_100061968 | Ga0068862_1000619683 | 199 |
| 128 | 3300005985 | Ga0081539_10021758 | Ga0081539_100217583 | 199 |
| 129 | 3300006038 | Ga0075365_10001106 | Ga0075365_100011068 | 199 |
| 130 | 3300006177 | Ga0075362_10079142 | Ga0075362_100791423 | 199 |
| 131 | 3300006186 | Ga0075369_10078504 | Ga0075369_100785042 | 199 |
| 132 | 3300006237 | Ga0097621_100023758 | Ga0097621_1000237586 | 199 |
| 133 | 3300006237 | Ga0097621_100484179 | Ga0097621_1004841792 | 199 |
| 134 | 3300006353 | Ga0075370_10010782 | Ga0075370_100107825 | 199 |
| 135 | 3300006358 | Ga0068871_100190017 | Ga0068871_1001900172 | 199 |
| 136 | 3300006881 | Ga0068865_100228143 | Ga0068865_1002281432 | 199 |
| 137 | 3300006881 | Ga0068865_100247271 | Ga0068865_1002472712 | 199 |
| 138 | 3300006931 | Ga0097620_100463722 | Ga0097620_1004637221 | 199 |
| 139 | 3300009098 | Ga0105245_10135854 | Ga0105245_101358542 | 199 |
| 140 | 3300009148 | Ga0105243_10033458 | Ga0105243_100334583 | 199 |
| 141 | 3300009176 | Ga0105242_10419329 | Ga0105242_104193292 | 199 |
| 142 | 3300009177 | Ga0105248_10045113 | Ga0105248_100451132 | 199 |
| 143 | 3300009177 | Ga0105248_10281138 | Ga0105248_102811382 | 199 |
| 144 | 3300009177 | Ga0105248_10443590 | Ga0105248_104435902 | 199 |
| 145 | 3300009545 | Ga0105237_10321611 | Ga0105237_103216112 | 199 |
| 146 | 3300009551 | Ga0105238_10705346 | Ga0105238_107053462 | 199 |
| 147 | 3300009551 | Ga0105238_11028694 | Ga0105238_110286942 | 199 |
| 148 | 3300010375 | Ga0105239_10423140 | Ga0105239_104231402 | 199 |
| 149 | 3300011119 | Ga0105246_10140546 | Ga0105246_101405462 | 199 |
| 150 | 3300013105 | Ga0157369_10090661 | Ga0157369_100906612 | 199 |
| 151 | 3300013296 | Ga0157374_10074354 | Ga0157374_100743544 | 199 |
| 152 | 3300013296 | Ga0157374_10113321 | Ga0157374_101133215 | 199 |
| 153 | 3300013296 | Ga0157374_10768752 | Ga0157374_107687521 | 199 |
| 154 | 3300013306 | Ga0163162_10338979 | Ga0163162_103389792 | 199 |
| 155 | 3300013307 | Ga0157372_10007779 | Ga0157372_100077799 | 199 |
| 156 | 3300013307 | Ga0157372_10120067 | Ga0157372_101200672 | 199 |
| 157 | 3300013308 | Ga0157375_10005097 | Ga0157375_1000509713 | 199 |
| 158 | 3300013308 | Ga0157375_10023632 | Ga0157375_100236323 | 199 |
| 159 | 3300014968 | Ga0157379_10073096 | Ga0157379_100730962 | 199 |
| 160 | 3300015262 | Ga0182007_10003598 | Ga0182007_100035983 | 199 |
| 161 | 3300015683 | Ga0183362_10002 | Ga0183362_10002897 | 199 |
| 162 | 3300017792 | Ga0163161_10148318 | Ga0163161_101483182 | 199 |
| 163 | 3300021384 | Ga0213876_10189341 | Ga0213876_101893411 | 199 |
| 164 | 3300025284 | Ga0209130_1000080 | Ga0209130_100008074 | 199 |
| 165 | 3300025302 | Ga0207426_1003963 | Ga0207426_10039633 | 199 |
| 166 | 3300025321 | Ga0207656_10016365 | Ga0207656_100163651 | 199 |
| 167 | 3300025321 | Ga0207656_10208739 | Ga0207656_102087392 | 199 |
| 168 | 3300025893 | Ga0207682_10002995 | Ga0207682_100029959 | 199 |
| 169 | 3300025901 | Ga0207688_10246970 | Ga0207688_102469702 | 199 |
| 170 | 3300025903 | Ga0207680_10014955 | Ga0207680_100149554 | 199 |
| 171 | 3300025907 | Ga0207645_10000912 | Ga0207645_1000091219 | 199 |
| 172 | 3300025907 | Ga0207645_10002225 | Ga0207645_1000222511 | 199 |
| 173 | 3300025908 | Ga0207643_10003556 | Ga0207643_100035566 | 199 |
| 174 | 3300025909 | Ga0207705_10181441 | Ga0207705_101814412 | 199 |
| 175 | 3300025915 | Ga0207693_10122734 | Ga0207693_101227341 | 199 |
| 176 | 3300025915 | Ga0207693_10157372 | Ga0207693_101573721 | 199 |
| 177 | 3300025917 | Ga0207660_10107018 | Ga0207660_101070181 | 199 |
| 178 | 3300025918 | Ga0207662_10014161 | Ga0207662_100141612 | 199 |
| 179 | 3300025919 | Ga0207657_10871333 | Ga0207657_108713332 | 199 |
| 180 | 3300025923 | Ga0207681_10041131 | Ga0207681_100411312 | 199 |
| 181 | 3300025924 | Ga0207694_10313126 | Ga0207694_103131261 | 199 |
| 182 | 3300025924 | Ga0207694_10837293 | Ga0207694_108372931 | 199 |
| 183 | 3300025925 | Ga0207650_10033963 | Ga0207650_100339633 | 199 |
| 184 | 3300025925 | Ga0207650_10051172 | Ga0207650_100511723 | 199 |
| 185 | 3300025925 | Ga0207650_10066878 | Ga0207650_100668782 | 199 |
| 186 | 3300025926 | Ga0207659_10026667 | Ga0207659_100266675 | 199 |
| 187 | 3300025927 | Ga0207687_10119177 | Ga0207687_101191772 | 199 |
| 188 | 3300025928 | Ga0207700_10000691 | Ga0207700_100006913 | 199 |
| 189 | 3300025928 | Ga0207700_10432693 | Ga0207700_104326931 | 199 |
| 190 | 3300025931 | Ga0207644_10002419 | Ga0207644_100024197 | 199 |
| 191 | 3300025931 | Ga0207644_10102490 | Ga0207644_101024902 | 199 |
| 192 | 3300025933 | Ga0207706_10107938 | Ga0207706_101079382 | 199 |
| 193 | 3300025933 | Ga0207706_10139167 | Ga0207706_101391672 | 199 |
| 194 | 3300025935 | Ga0207709_10077702 | Ga0207709_100777022 | 199 |
| 195 | 3300025936 | Ga0207670_10721143 | Ga0207670_107211431 | 199 |
| 196 | 3300025937 | Ga0207669_10013628 | Ga0207669_100136282 | 199 |
| 197 | 3300025937 | Ga0207669_10040939 | Ga0207669_100409392 | 199 |
| 198 | 3300025937 | Ga0207669_10642181 | Ga0207669_106421812 | 199 |
| 199 | 3300025938 | Ga0207704_10227787 | Ga0207704_102277872 | 199 |
| 200 | 3300025940 | Ga0207691_10000342 | Ga0207691_1000034238 | 199 |
| 201 | 3300025940 | Ga0207691_10007666 | Ga0207691_1000766610 | 199 |
| 202 | 3300025940 | Ga0207691_10032545 | Ga0207691_100325452 | 199 |
| 203 | 3300025941 | Ga0207711_10037127 | Ga0207711_100371272 | 199 |
| 204 | 3300025941 | Ga0207711_10494365 | Ga0207711_104943652 | 199 |
| 205 | 3300025942 | Ga0207689_10050828 | Ga0207689_100508282 | 199 |
| 206 | 3300025944 | Ga0207661_10321599 | Ga0207661_103215992 | 199 |
| 207 | 3300025960 | Ga0207651_10001027 | Ga0207651_100010279 | 199 |
| 208 | 3300025960 | Ga0207651_10082645 | Ga0207651_100826451 | 199 |
| 209 | 3300025972 | Ga0207668_10002518 | Ga0207668_100025182 | 199 |
| 210 | 3300025981 | Ga0207640_10017308 | Ga0207640_100173084 | 199 |
| 211 | 3300025986 | Ga0207658_10008096 | Ga0207658_100080965 | 199 |
| 212 | 3300025986 | Ga0207658_10015677 | Ga0207658_100156774 | 199 |
| 213 | 3300025986 | Ga0207658_10163619 | Ga0207658_101636192 | 199 |
| 214 | 3300026023 | Ga0207677_10035392 | Ga0207677_100353924 | 199 |
| 215 | 3300026023 | Ga0207677_10107275 | Ga0207677_101072752 | 199 |
| 216 | 3300026035 | Ga0207703_10044639 | Ga0207703_100446394 | 199 |
| 217 | 3300026067 | Ga0207678_10004759 | Ga0207678_100047599 | 199 |
| 218 | 3300026067 | Ga0207678_10100574 | Ga0207678_101005741 | 199 |
| 219 | 3300026088 | Ga0207641_10308476 | Ga0207641_103084761 | 199 |
| 220 | 3300026088 | Ga0207641_10435975 | Ga0207641_104359752 | 199 |
| 221 | 3300026089 | Ga0207648_10019429 | Ga0207648_100194292 | 199 |
| 222 | 3300026116 | Ga0207674_10010371 | Ga0207674_100103719 | 199 |
| 223 | 3300026116 | Ga0207674_10618475 | Ga0207674_106184752 | 199 |
| 224 | 3300026121 | Ga0207683_10000020 | Ga0207683_1000002087 | 199 |
| 225 | 3300026121 | Ga0207683_10070087 | Ga0207683_100700872 | 199 |
| 226 | 3300026121 | Ga0207683_10247778 | Ga0207683_102477783 | 199 |
| 227 | 3300026142 | Ga0207698_10011424 | Ga0207698_100114243 | 199 |
| 228 | 3300026142 | Ga0207698_10030282 | Ga0207698_100302825 | 199 |
| 229 | 3300027907 | Ga0207428_10026980 | Ga0207428_100269803 | 199 |
| 230 | 3300028379 | Ga0268266_10044697 | Ga0268266_100446972 | 199 |
| 231 | 3300028380 | Ga0268265_10777357 | Ga0268265_107773572 | 199 |
| 232 | 3300028381 | Ga0268264_10018269 | Ga0268264_100182693 | 199 |
| 233 | 3300028794 | Ga0307515_10041677 | Ga0307515_100416776 | 199 |
| 234 | 3300028794 | Ga0307515_10184297 | Ga0307515_101842972 | 199 |
| 235 | 3300031247 | Ga0265340_10053758 | Ga0265340_100537582 | 199 |
| 236 | 3300031247 | Ga0265340_10057982 | Ga0265340_100579822 | 199 |
| 237 | 3300031251 | Ga0265327_10000834 | Ga0265327_1000083434 | 199 |
| 238 | 3300031456 | Ga0307513_10280810 | Ga0307513_102808102 | 199 |
| 239 | 3300031456 | Ga0307513_10332120 | Ga0307513_103321202 | 199 |
| 240 | 3300031731 | Ga0307405_10120545 | Ga0307405_101205454 | 199 |
| 241 | 3300031824 | Ga0307413_10392425 | Ga0307413_103924251 | 199 |
| 242 | 3300031911 | Ga0307412_10126494 | Ga0307412_101264943 | 199 |
| 243 | 3300032004 | Ga0307414_11032464 | Ga0307414_110324642 | 199 |
| 244 | 3300032005 | Ga0307411_10523675 | Ga0307411_105236751 | 199 |
| 245 | 3300032126 | Ga0307415_100363731 | Ga0307415_1003637312 | 199 |
| 246 | 3300035090 | Ga0373949_0000033 | Ga0373949_0000033_8993_9595 | 199 |
| 247 | 3300035115 | Ga0373941_0013169 | Ga0373941_0013169_1202_1807 | 199 |
| 248 | 3300035117 | Ga0373953_0062031 | Ga0373953_0062031_541_1191 | 199 |
| 249 | 3300039437 | Ga0436365_0941693 | Ga0436365_0941693_1635_2234 | 199 |
| 250 | 3300042156 | Ga0439446_0020279 | Ga0439446_0020279_497_1108 | 199 |
| 251 | 3300045051 | Ga0451576_0086422 | Ga0451576_0086422_1352_1954 | 199 |
| 252 | 3300046457 | Ga0495590_0000012 | Ga0495590_0000012_70560_71159 | 199 |
| 253 | 3300046460 | Ga0495638_0027332 | Ga0495638_0027332_519_1130 | 199 |
| 254 | 3300046462 | Ga0495651_0126681 | Ga0495651_0126681_396_995 | 199 |
| 255 | 3300046519 | Ga0495632_0020455 | Ga0495632_0020455_2102_2713 | 199 |
| 256 | 3300048911 | Ga0496108_1199677 | Ga0496108_1199677_26_631 | 199 |
| 257 | 3300048925 | Ga0496122_0031425 | Ga0496122_0031425_1011_1640 | 199 |
| 258 | 3300049459 | Ga0495678_000976 | Ga0495678_000976_10056_10655 | 199 |
| 259 | 3300049569 | Ga0501032_0000320 | Ga0501032_0000320_1117_1740 | 199 |
| 260 | 3300049570 | Ga0501033_0000968 | Ga0501033_0000968_15773_16396 | 199 |
| 261 | 3300049570 | Ga0501033_0133443 | Ga0501033_0133443_360_965 | 199 |
| 262 | 3300049571 | Ga0501034_0000058 | Ga0501034_0000058_182159_182782 | 199 |
| 263 | 3300049572 | Ga0501036_0001143 | Ga0501036_0001143_16098_16721 | 199 |
| 264 | 3300049572 | Ga0501036_0183824 | Ga0501036_0183824_189_794 | 199 |
| 265 | 3300049573 | Ga0501037_0000700 | Ga0501037_0000700_15773_16396 | 199 |
| 266 | 3300049574 | Ga0501038_0000059 | Ga0501038_0000059_82517_83140 | 199 |
| 267 | 3300049575 | Ga0501039_0001176 | Ga0501039_0001176_2806_3429 | 199 |
| 268 | 3300049578 | Ga0501042_0029640 | Ga0501042_0029640_1052_1675 | 199 |
| 269 | 3300049579 | Ga0501043_0008489 | Ga0501043_0008489_4086_4709 | 199 |
| 270 | 3300049580 | Ga0501046_0002041 | Ga0501046_0002041_3475_4098 | 199 |
| 271 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_89566_90189 | 199 |
| 272 | 3300049582 | Ga0501048_0001669 | Ga0501048_0001669_1507_2130 | 199 |
| 273 | 3300049583 | Ga0501067_0004416 | Ga0501067_0004416_3655_4278 | 199 |
| 274 | 3300049584 | Ga0501068_0002467 | Ga0501068_0002467_5728_6351 | 199 |
| 275 | 3300049585 | Ga0501069_0006753 | Ga0501069_0006753_3315_3938 | 199 |
| 276 | 3300049586 | Ga0501070_0003309 | Ga0501070_0003309_165_788 | 199 |
| 277 | 3300049588 | Ga0501072_0000449 | Ga0501072_0000449_23715_24338 | 199 |
| 278 | 3300049589 | Ga0501073_0000604 | Ga0501073_0000604_24309_24932 | 199 |
| 279 | 3300049590 | Ga0501074_0000028 | Ga0501074_0000028_51200_51823 | 199 |
| 280 | 3300049592 | Ga0501076_0323144 | Ga0501076_0323144_322_930 | 199 |
| 281 | 3300049741 | Ga0501079_0001041 | Ga0501079_0001041_2826_3449 | 199 |
| 282 | 3300049742 | Ga0501080_0012552 | Ga0501080_0012552_3064_3687 | 199 |
| 283 | 3300049744 | Ga0501083_0001278 | Ga0501083_0001278_446_1069 | 199 |
| 284 | 3300049822 | Ga0501035_0000240 | Ga0501035_0000240_56149_56772 | 199 |
| 285 | 3300049823 | Ga0501044_0006000 | Ga0501044_0006000_4086_4709 | 199 |
| 286 | 3300049823 | Ga0501044_0649442 | Ga0501044_0649442_292_930 | 199 |
| 287 | 3300049824 | Ga0501045_0025677 | Ga0501045_0025677_783_1406 | 199 |
| 288 | 3300050489 | nmdc:mga03683_145024_c1 | nmdc:mga03683_145024_c1_181_780 | 199 |
| 289 | 3300050492 | nmdc:mga0yw44_2563_c1 | nmdc:mga0yw44_2563_c1_6388_6993 | 199 |
| 290 | 3300050493 | nmdc:mga0k408_323887_c1 | nmdc:mga0k408_323887_c1_266_865 | 199 |
| 291 | 3300050493 | nmdc:mga0k408_78204_c1 | nmdc:mga0k408_78204_c1_133_792 | 199 |
| 292 | 3300050496 | nmdc:mga07m45_197021_c1 | nmdc:mga07m45_197021_c1_468_1073 | 199 |
| 293 | 3300050496 | nmdc:mga07m45_7212_c1 | nmdc:mga07m45_7212_c1_4561_5160 | 199 |
| 294 | 3300050507 | nmdc:mga05p37_140_c1 | nmdc:mga05p37_140_c1_49543_50142 | 199 |
| 295 | 3300050508 | nmdc:mga09592_1169_c1 | nmdc:mga09592_1169_c1_16792_17391 | 199 |
| 296 | 3300050510 | nmdc:mga06r32_1552_c1 | nmdc:mga06r32_1552_c1_17381_17980 | 199 |
| 297 | 3300050511 | nmdc:mga08y16_104_c1 | nmdc:mga08y16_104_c1_1455_2054 | 199 |
| 298 | 3300050516 | nmdc:mga0sz30_106965_c1 | nmdc:mga0sz30_106965_c1_569_1168 | 199 |
| 299 | 3300053092 | Ga0500583_0075796 | Ga0500583_0075796_780_1394 | 199 |
| 300 | 3300053178 | Ga0500637_0360694 | Ga0500637_0360694_125_730 | 199 |
| 301 | 3300054114 | Ga0501084_0011310 | Ga0501084_0011310_961_1584 | 199 |
| 302 | 3300060353 | Ga0501082_0001427 | Ga0501082_0001427_18209_18832 | 199 |
| 303 | iso_pu_bacteria | 2954691527 | 2954692157 | 199 |
| 304 | iso_pu_bacteria | 2954701450 | 2954707223 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jmv-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol | 0.9617 | 1 | 198 |
| 7jmr-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis | 0.9561 | 1 | 198 |
| 7jmv-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis complexed with 4-nitrocatechol | 0.9523 | 1 | 198 |
| 7jmr-assembly1.cif.gz_A | crystal structure of the pea pathogenicity protein 2 from madurella mycetomatis | 0.9467 | 1 | 198 |
| 7kd9-assembly2.cif.gz_C | crystal structure of gallic acid decarboxylase from arxula adeninivorans | 0.9368 | 1 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WL25_11_145_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8512 | 4 | 127 | 3.10.450.50 |
| 4gb5A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8509 | 3 | 127 | 3.10.450.50 |
| af_G5ECA7_6_124_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8185 | 10 | 127 | 3.10.450.50 |
| 3a76A01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8154 | 4 | 137 | 3.10.450.50 |
| af_Q7KPV8_5_124_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7891 | 9 | 125 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Y0BLM0-F1-model_v4 | J507 | 0.9952 | 3 | 198 |
|
| AF-A0A1H6NW08-F1-model_v4 | deleted | 0.9936 | 1 | 199 |
|
| AF-A0A2P7B700-F1-model_v4 | SnoaL-like domain-containing protein | 0.9934 | 1 | 199 |
|
| AF-A0A2Z5FZI3-F1-model_v4 | SnoaL-like domain-containing protein | 0.9933 | 1 | 195 |
|
| AF-H0A5J9-F1-model_v4 | SnoaL-like domain-containing protein | 0.9931 | 6 | 199 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar