F397643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 178 | 304 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10151696|Ga0265338_101516962 |
| Length | 366 |
| Sequence | VAQHNRRDYYEILEVTKSASQEEVKSAYRKAALKWHPDRNPEKKETAEAKFREATEAYSVLSDAEKRSAYDRFGHAGVSSAGGAGGFNRTIFEEFQDVFGDFFGFEXXXGRGAAAAGGARGRARVQRGSDLRYDMRLTFDEAAAGVSTKIRLPRQDFCEACKGTGGKSGTGVVACETCGGRGQLHYQQGFFAISRTCPNCQGAGQVTIDVRIPPGVDSQTRIRVPGEGEPGANGGPAGDLYIVLEVKEHAFFERRGADLYCTIPVSIAQAALGTDITVPGITAEEKVSIPEGTQTGSIIRLKGKGLPDPHGGGKGDLYVCIRVITPTKLTREQRRMLQQLGETLGVENRPADRNSSFFEKVKDIFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 27 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 32 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 33 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 52 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 73 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 75 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 76 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 78 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 80 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 85 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 87 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 88 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 89 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 90 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 91 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 92 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 93 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 96 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 98 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 102 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 103 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 105 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 106 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 115 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 116 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.64 |
| Rhizosphere | 98.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070692_10024988 | 3300005345 | Bacteria | 2941 |
| 2 | Ga0070669_100002919 | 3300005353 | Bacteria | 12314 |
| 3 | Ga0070671_100132907 | 3300005355 | Bacteria | 2096 |
| 4 | Ga0070709_10017635 | 3300005434 | Bacteria | 4099 |
| 5 | Ga0070709_10036240 | 3300005434 | Unclassified | 3004 |
| 6 | Ga0070709_10181679 | 3300005434 | Archaea | 1478 |
| 7 | Ga0070709_10246400 | 3300005434 | Archaea | 1285 |
| 8 | Ga0070714_100218172 | 3300005435 | Bacteria | 1752 |
| 9 | Ga0070714_100300650 | 3300005435 | Bacteria | 1496 |
| 10 | Ga0070713_100038467 | 3300005436 | Bacteria | 3877 |
| 11 | Ga0070713_100047041 | 3300005436 | Unclassified | 3544 |
| 12 | Ga0070713_100089253 | 3300005436 | Bacteria | 2647 |
| 13 | Ga0070713_100215880 | 3300005436 | Bacteria | 1738 |
| 14 | Ga0070710_10070197 | 3300005437 | Archaea | 2017 |
| 15 | Ga0070701_10024411 | 3300005438 | Bacteria | 2924 |
| 16 | Ga0070711_100052158 | 3300005439 | Bacteria | 2814 |
| 17 | Ga0070711_100089461 | 3300005439 | Bacteria | 2215 |
| 18 | Ga0070711_100128001 | 3300005439 | Archaea | 1887 |
| 19 | Ga0070705_100088226 | 3300005440 | Bacteria | 1925 |
| 20 | Ga0070708_100079394 | 3300005445 | Bacteria | 2968 |
| 21 | Ga0070678_100065504 | 3300005456 | Bacteria | 2698 |
| 22 | Ga0070681_10004696 | 3300005458 | Archaea | 13072 |
| 23 | Ga0070706_100095505 | 3300005467 | Bacteria | 2759 |
| 24 | Ga0070707_100000031 | 3300005468 | Bacteria | 120203 |
| 25 | Ga0070707_100006797 | 3300005468 | Bacteria | 10589 |
| 26 | Ga0070707_100009356 | 3300005468 | Bacteria | 9095 |
| 27 | Ga0070707_100103282 | 3300005468 | Bacteria | 2762 |
| 28 | Ga0070698_100055146 | 3300005471 | Bacteria | 4033 |
| 29 | Ga0070698_100063410 | 3300005471 | Bacteria | 3727 |
| 30 | Ga0070698_100316570 | 3300005471 | Bacteria | 1491 |
| 31 | Ga0070699_100100896 | 3300005518 | Bacteria | 2530 |
| 32 | Ga0070697_100268596 | 3300005536 | Unclassified | 1462 |
| 33 | Ga0070695_100045259 | 3300005545 | Unclassified | 2804 |
| 34 | Ga0070665_100003010 | 3300005548 | Bacteria | 18176 |
| 35 | Ga0068859_100339075 | 3300005617 | Bacteria | 1597 |
| 36 | Ga0068863_100010229 | 3300005841 | Bacteria | 9118 |
| 37 | Ga0068858_100064937 | 3300005842 | Bacteria | 3378 |
| 38 | Ga0068862_100102457 | 3300005844 | Bacteria | 2506 |
| 39 | Ga0081455_10008627 | 3300005937 | Bacteria | 10568 |
| 40 | Ga0081455_10021728 | 3300005937 | Bacteria | 6011 |
| 41 | Ga0081539_10000494 | 3300005985 | Bacteria | 82708 |
| 42 | Ga0081539_10072389 | 3300005985 | Bacteria | 1842 |
| 43 | Ga0070717_10040876 | 3300006028 | Bacteria | 3779 |
| 44 | Ga0070712_100043186 | 3300006175 | Bacteria | 3103 |
| 45 | Ga0097621_100039553 | 3300006237 | Bacteria | 3788 |
| 46 | Ga0068871_100001278 | 3300006358 | Bacteria | 16815 |
| 47 | Ga0075428_100013979 | 3300006844 | Bacteria | 8936 |
| 48 | Ga0075428_100101853 | 3300006844 | Bacteria | 3131 |
| 49 | Ga0075428_100355600 | 3300006844 | Bacteria | 1572 |
| 50 | Ga0075430_100179443 | 3300006846 | Bacteria | 1761 |
| 51 | Ga0075430_100373870 | 3300006846 | Unclassified | 1176 |
| 52 | Ga0075431_100079062 | 3300006847 | Bacteria | 3395 |
| 53 | Ga0075431_100290455 | 3300006847 | Unclassified | 1654 |
| 54 | Ga0075433_10011405 | 3300006852 | Bacteria | 7157 |
| 55 | Ga0075433_10031263 | 3300006852 | Bacteria | 4550 |
| 56 | Ga0075433_10117182 | 3300006852 | Bacteria | 2363 |
| 57 | Ga0075434_100000527 | 3300006871 | Bacteria | 29136 |
| 58 | Ga0075434_100006816 | 3300006871 | Bacteria | 10508 |
| 59 | Ga0075434_100078972 | 3300006871 | Bacteria | 3287 |
| 60 | Ga0075436_100025537 | 3300006914 | Bacteria | 4067 |
| 61 | Ga0075436_100099175 | 3300006914 | Archaea | 2028 |
| 62 | Ga0097620_100339074 | 3300006931 | Bacteria | 1597 |
| 63 | Ga0075435_100016329 | 3300007076 | Bacteria | 5597 |
| 64 | Ga0099794_10005531 | 3300007265 | Bacteria | 5072 |
| 65 | Ga0105240_10012563 | 3300009093 | Archaea | 11681 |
| 66 | Ga0105240_10069565 | 3300009093 | Unclassified | 4356 |
| 67 | Ga0111539_10002668 | 3300009094 | Bacteria | 23630 |
| 68 | Ga0114129_10008808 | 3300009147 | Bacteria | 14398 |
| 69 | Ga0114129_10096576 | 3300009147 | Bacteria | 4091 |
| 70 | Ga0105243_10086568 | 3300009148 | Bacteria | 2570 |
| 71 | Ga0105242_10224881 | 3300009176 | Bacteria | 1679 |
| 72 | Ga0157373_10234658 | 3300013100 | Bacteria | 1296 |
| 73 | Ga0157374_10071818 | 3300013296 | Bacteria | 3265 |
| 74 | Ga0157378_10003816 | 3300013297 | Bacteria | 13331 |
| 75 | Ga0157378_10005703 | 3300013297 | Bacteria | 10894 |
| 76 | Ga0157375_10076526 | 3300013308 | Bacteria | 3374 |
| 77 | Ga0157379_10117000 | 3300014968 | Bacteria | 2398 |
| 78 | Ga0157376_10000004 | 3300014969 | Bacteria | 508493 |
| 79 | Ga0157376_10002854 | 3300014969 | Bacteria | 11831 |
| 80 | Ga0228598_1001648 | 3300024227 | Unclassified | 4881 |
| 81 | Ga0207692_10008834 | 3300025898 | Archaea | 4186 |
| 82 | Ga0207692_10013410 | 3300025898 | Archaea | 3555 |
| 83 | Ga0207699_10025727 | 3300025906 | Bacteria | 3235 |
| 84 | Ga0207699_10116542 | 3300025906 | Unclassified | 1720 |
| 85 | Ga0207705_10004576 | 3300025909 | Bacteria | 10447 |
| 86 | Ga0207684_10104096 | 3300025910 | Archaea | 2426 |
| 87 | Ga0207684_10194311 | 3300025910 | Bacteria | 1750 |
| 88 | Ga0207707_10008333 | 3300025912 | Archaea | 8992 |
| 89 | Ga0207695_10053722 | 3300025913 | Archaea | 4211 |
| 90 | Ga0207695_10197859 | 3300025913 | Unclassified | 1925 |
| 91 | Ga0207693_10046843 | 3300025915 | Bacteria | 3397 |
| 92 | Ga0207663_10009316 | 3300025916 | Archaea | 5182 |
| 93 | Ga0207663_10028616 | 3300025916 | Archaea | 3263 |
| 94 | Ga0207663_10034782 | 3300025916 | Archaea | 3017 |
| 95 | Ga0207646_10000012 | 3300025922 | Bacteria | 367049 |
| 96 | Ga0207646_10000046 | 3300025922 | Bacteria | 177239 |
| 97 | Ga0207646_10004238 | 3300025922 | Bacteria | 15671 |
| 98 | Ga0207646_10076221 | 3300025922 | Bacteria | 2997 |
| 99 | Ga0207687_10080289 | 3300025927 | Bacteria | 2354 |
| 100 | Ga0207700_10001548 | 3300025928 | Archaea | 13040 |
| 101 | Ga0207700_10092996 | 3300025928 | Bacteria | 2385 |
| 102 | Ga0207664_10043736 | 3300025929 | Archaea | 3505 |
| 103 | Ga0207664_10323401 | 3300025929 | Bacteria | 1361 |
| 104 | Ga0207665_10006643 | 3300025939 | Bacteria | 7674 |
| 105 | Ga0207665_10033074 | 3300025939 | Bacteria | 3426 |
| 106 | Ga0207711_10124035 | 3300025941 | Bacteria | 2309 |
| 107 | Ga0207667_10087004 | 3300025949 | Bacteria | 3233 |
| 108 | Ga0207640_10184618 | 3300025981 | Bacteria | 1567 |
| 109 | Ga0207703_10285448 | 3300026035 | Bacteria | 1500 |
| 110 | Ga0207708_10083064 | 3300026075 | Bacteria | 2462 |
| 111 | Ga0207641_10025119 | 3300026088 | Bacteria | 4911 |
| 112 | Ga0207641_10216689 | 3300026088 | Bacteria | 1773 |
| 113 | Ga0207683_10087637 | 3300026121 | Bacteria | 2768 |
| 114 | Ga0207428_10002609 | 3300027907 | Bacteria | 18000 |
| 115 | Ga0207428_10007573 | 3300027907 | Bacteria | 9897 |
| 116 | Ga0268266_10000470 | 3300028379 | Bacteria | 58333 |
| 117 | Ga0265337_1043419 | 3300028556 | Archaea | 1285 |
| 118 | Ga0265326_10000233 | 3300028558 | Archaea | 26740 |
| 119 | Ga0265326_10000234 | 3300028558 | Archaea | 26730 |
| 120 | Ga0265319_1000970 | 3300028563 | Bacteria | 18050 |
| 121 | Ga0265334_10000746 | 3300028573 | Archaea | 16291 |
| 122 | Ga0265318_10000424 | 3300028577 | Bacteria | 32313 |
| 123 | Ga0265322_10000018 | 3300028654 | Archaea | 112105 |
| 124 | Ga0265336_10000035 | 3300028666 | Archaea | 158710 |
| 125 | Ga0265336_10000817 | 3300028666 | Archaea | 16330 |
| 126 | Ga0265338_10000361 | 3300028800 | Archaea | 82062 |
| 127 | Ga0265338_10000362 | 3300028800 | Archaea | 82041 |
| 128 | Ga0265338_10006280 | 3300028800 | Bacteria | 15195 |
| 129 | Ga0265338_10021761 | 3300028800 | Bacteria | 6667 |
| 130 | Ga0265338_10052701 | 3300028800 | Bacteria | 3647 |
| 131 | Ga0265338_10151696 | 3300028800 | Unclassified | 1800 |
| 132 | Ga0265324_10000463 | 3300029957 | Archaea | 28562 |
| 133 | Ga0265324_10000655 | 3300029957 | Archaea | 23366 |
| 134 | Ga0265332_10002602 | 3300031238 | Archaea | 9126 |
| 135 | Ga0265332_10006469 | 3300031238 | Bacteria | 5313 |
| 136 | Ga0265328_10056216 | 3300031239 | Bacteria | 1444 |
| 137 | Ga0265320_10000131 | 3300031240 | Bacteria | 64956 |
| 138 | Ga0265320_10006778 | 3300031240 | Bacteria | 7182 |
| 139 | Ga0265325_10000528 | 3300031241 | Archaea | 27612 |
| 140 | Ga0265325_10004101 | 3300031241 | Bacteria | 9280 |
| 141 | Ga0265325_10005365 | 3300031241 | Bacteria | 7930 |
| 142 | Ga0265325_10051070 | 3300031241 | Archaea | 2127 |
| 143 | Ga0265329_10006292 | 3300031242 | Archaea | 4719 |
| 144 | Ga0265340_10000978 | 3300031247 | Archaea | 16330 |
| 145 | Ga0265340_10000980 | 3300031247 | Archaea | 16319 |
| 146 | Ga0265340_10002645 | 3300031247 | Bacteria | 10180 |
| 147 | Ga0265340_10023569 | 3300031247 | Bacteria | 3137 |
| 148 | Ga0265339_10000642 | 3300031249 | Archaea | 26990 |
| 149 | Ga0265339_10005286 | 3300031249 | Bacteria | 8611 |
| 150 | Ga0265339_10042405 | 3300031249 | Archaea | 2519 |
| 151 | Ga0265331_10000016 | 3300031250 | Archaea | 273855 |
| 152 | Ga0265331_10000246 | 3300031250 | Bacteria | 64957 |
| 153 | Ga0265331_10000890 | 3300031250 | Archaea | 24279 |
| 154 | Ga0265331_10003861 | 3300031250 | Bacteria | 9482 |
| 155 | Ga0265331_10049358 | 3300031250 | Bacteria | 2021 |
| 156 | Ga0265316_10000602 | 3300031344 | Bacteria | 40145 |
| 157 | Ga0265316_10003098 | 3300031344 | Archaea | 16940 |
| 158 | Ga0265316_10006470 | 3300031344 | Bacteria | 11183 |
| 159 | Ga0265316_10007613 | 3300031344 | Bacteria | 10177 |
| 160 | Ga0265316_10039576 | 3300031344 | Bacteria | 3785 |
| 161 | Ga0265316_10062693 | 3300031344 | Bacteria | 2885 |
| 162 | Ga0307408_100266269 | 3300031548 | Bacteria | 1421 |
| 163 | Ga0265313_10001486 | 3300031595 | Bacteria | 21862 |
| 164 | Ga0265314_10001616 | 3300031711 | Archaea | 24718 |
| 165 | Ga0265314_10020331 | 3300031711 | Bacteria | 5125 |
| 166 | Ga0265342_10000218 | 3300031712 | Bacteria | 64950 |
| 167 | Ga0265342_10034981 | 3300031712 | Bacteria | 3079 |
| 168 | Ga0307405_10216731 | 3300031731 | Bacteria | 1401 |
| 169 | Ga0307410_10005178 | 3300031852 | Bacteria | 6867 |
| 170 | Ga0307407_10165299 | 3300031903 | Bacteria | 1452 |
| 171 | Ga0307409_100020613 | 3300031995 | Bacteria | 4498 |
| 172 | Ga0307416_100042102 | 3300032002 | Bacteria | 3562 |
| 173 | Ga0307411_10133321 | 3300032005 | Bacteria | 1819 |
| 174 | Ga0307415_100054866 | 3300032126 | Bacteria | 2723 |
| 175 | Ga0307415_100131157 | 3300032126 | Bacteria | 1897 |
| 176 | Ga0316593_10026724 | 3300032168 | Unclassified | 1847 |
| 177 | Ga0373939_0009963 | 3300035114 | Bacteria | 2366 |
| 178 | Ga0373954_0060955 | 3300035118 | Unclassified | 1780 |
| 179 | Ga0373960_0034965 | 3300035121 | Archaea | 1424 |
| 180 | Ga0373931_0066453 | 3300035691 | Unclassified | 1957 |
| 181 | Ga0373935_0032180 | 3300035692 | Unclassified | 3258 |
| 182 | Ga0373947_0024015 | 3300035725 | Unclassified | 3549 |
| 183 | Ga0373937_0041127 | 3300036401 | Unclassified | 4217 |
| 184 | Ga0373937_0053719 | 3300036401 | Unclassified | 3695 |
| 185 | Ga0395900_0024683 | 3300037418 | Bacteria | 6152 |
| 186 | Ga0395900_0177602 | 3300037418 | Bacteria | 2165 |
| 187 | Ga0395905_0001373 | 3300037471 | Bacteria | 29537 |
| 188 | Ga0395905_0155582 | 3300037471 | Bacteria | 2150 |
| 189 | Ga0395905_0417066 | 3300037471 | Bacteria | 1238 |
| 190 | Ga0395901_0003598 | 3300038443 | Bacteria | 15633 |
| 191 | Ga0395901_0130038 | 3300038443 | Bacteria | 2645 |
| 192 | Ga0395901_0138068 | 3300038443 | Bacteria | 2562 |
| 193 | Ga0436363_0224992 | 3300039450 | Bacteria | 2953 |
| 194 | Ga0451577_0085296 | 3300042876 | Bacteria | 2817 |
| 195 | Ga0451577_0268751 | 3300042876 | Bacteria | 1544 |
| 196 | Ga0453683_0011305 | 3300044673 | Bacteria | 5888 |
| 197 | Ga0453684_0027949 | 3300044712 | Bacteria | 8068 |
| 198 | Ga0451576_0008447 | 3300045051 | Bacteria | 12090 |
| 199 | Ga0451576_0009712 | 3300045051 | Bacteria | 11127 |
| 200 | Ga0451576_0407816 | 3300045051 | Bacteria | 1425 |
| 201 | Ga0495592_0007262 | 3300046454 | Bacteria | 8288 |
| 202 | Ga0495603_0018086 | 3300046455 | Bacteria | 4264 |
| 203 | Ga0495629_0000006 | 3300046459 | Bacteria | 389181 |
| 204 | Ga0495651_0000132 | 3300046462 | Bacteria | 55295 |
| 205 | Ga0495651_0003699 | 3300046462 | Bacteria | 11720 |
| 206 | Ga0495651_0009783 | 3300046462 | Bacteria | 7372 |
| 207 | Ga0495653_0002178 | 3300046463 | Bacteria | 15492 |
| 208 | Ga0495653_0030213 | 3300046463 | Unclassified | 4318 |
| 209 | Ga0495580_0007808 | 3300046472 | Bacteria | 8568 |
| 210 | Ga0495582_0038665 | 3300046473 | Bacteria | 2626 |
| 211 | Ga0495639_0007146 | 3300046475 | Bacteria | 4793 |
| 212 | Ga0495639_0057547 | 3300046475 | Bacteria | 1776 |
| 213 | Ga0495662_0018989 | 3300046476 | Bacteria | 3327 |
| 214 | Ga0495594_0005608 | 3300046499 | Bacteria | 6450 |
| 215 | Ga0495594_0080879 | 3300046499 | Bacteria | 1814 |
| 216 | Ga0495608_0043203 | 3300046511 | Bacteria | 3012 |
| 217 | Ga0495618_0065301 | 3300046514 | Unclassified | 2313 |
| 218 | Ga0495628_0000278 | 3300046516 | Bacteria | 45948 |
| 219 | Ga0495628_0374934 | 3300046516 | Unclassified | 1043 |
| 220 | Ga0495630_0014659 | 3300046517 | Bacteria | 5714 |
| 221 | Ga0495630_0024161 | 3300046517 | Unclassified | 4495 |
| 222 | Ga0495666_0008362 | 3300046526 | Bacteria | 5187 |
| 223 | Ga0495652_0001155 | 3300046529 | Bacteria | 29749 |
| 224 | Ga0495652_0023471 | 3300046529 | Bacteria | 5467 |
| 225 | Ga0495652_0149474 | 3300046529 | Bacteria | 1827 |
| 226 | Ga0495665_0066909 | 3300046531 | Unclassified | 1895 |
| 227 | Ga0495587_0001436 | 3300046536 | Bacteria | 15864 |
| 228 | Ga0495667_0008760 | 3300046559 | Bacteria | 6876 |
| 229 | Ga0495667_0014061 | 3300046559 | Bacteria | 5401 |
| 230 | Ga0495634_0051222 | 3300046642 | Unclassified | 2771 |
| 231 | Ga0495634_0117213 | 3300046642 | Bacteria | 1708 |
| 232 | Ga0495635_0008581 | 3300046663 | Bacteria | 7136 |
| 233 | Ga0495635_0025627 | 3300046663 | Unclassified | 4108 |
| 234 | Ga0495635_0030693 | 3300046663 | Bacteria | 3734 |
| 235 | Ga0495588_0019872 | 3300046674 | Bacteria | 3295 |
| 236 | Ga0495657_0036562 | 3300046675 | Bacteria | 3393 |
| 237 | Ga0495657_0056343 | 3300046675 | Unclassified | 2617 |
| 238 | Ga0495657_0178880 | 3300046675 | Bacteria | 1303 |
| 239 | Ga0495623_0036146 | 3300046679 | Unclassified | 3165 |
| 240 | Ga0495646_0022275 | 3300046680 | Unclassified | 3997 |
| 241 | Ga0495646_0099999 | 3300046680 | Unclassified | 1664 |
| 242 | Ga0495647_0023792 | 3300046681 | Bacteria | 2224 |
| 243 | Ga0495658_0000739 | 3300046683 | Bacteria | 17610 |
| 244 | Ga0495613_0002121 | 3300046689 | Bacteria | 15056 |
| 245 | Ga0495613_0036024 | 3300046689 | Bacteria | 3669 |
| 246 | Ga0495624_0023217 | 3300046690 | Unclassified | 4091 |
| 247 | Ga0495624_0069799 | 3300046690 | Bacteria | 2188 |
| 248 | Ga0495600_0003416 | 3300046809 | Bacteria | 9339 |
| 249 | Ga0495581_0007095 | 3300047315 | Bacteria | 6488 |
| 250 | Ga0495604_0001652 | 3300047317 | Bacteria | 18342 |
| 251 | Ga0495604_0020983 | 3300047317 | Unclassified | 5213 |
| 252 | Ga0495604_0038155 | 3300047317 | Unclassified | 3780 |
| 253 | Ga0495604_0105323 | 3300047317 | Bacteria | 2064 |
| 254 | Ga0495674_0066297 | 3300047319 | Unclassified | 3133 |
| 255 | Ga0495674_0066467 | 3300047319 | Bacteria | 3128 |
| 256 | Ga0495674_0083237 | 3300047319 | Unclassified | 2743 |
| 257 | Ga0495674_0090174 | 3300047319 | Bacteria | 2620 |
| 258 | Ga0495676_0103042 | 3300047321 | Unclassified | 2108 |
| 259 | Ga0495680_0000068 | 3300047322 | Bacteria | 89135 |
| 260 | Ga0495680_0000096 | 3300047322 | Bacteria | 79944 |
| 261 | Ga0495680_0021891 | 3300047322 | Bacteria | 5341 |
| 262 | Ga0495675_0000169 | 3300047444 | Bacteria | 47184 |
| 263 | Ga0495675_0022203 | 3300047444 | Unclassified | 4044 |
| 264 | Ga0495675_0096049 | 3300047444 | Unclassified | 1858 |
| 265 | Ga0495684_0005408 | 3300047471 | Bacteria | 9942 |
| 266 | Ga0495684_0007939 | 3300047471 | Bacteria | 8209 |
| 267 | Ga0495684_0017258 | 3300047471 | Bacteria | 5556 |
| 268 | Ga0495593_0013347 | 3300047673 | Bacteria | 4688 |
| 269 | Ga0495602_0059020 | 3300048088 | Unclassified | 3352 |
| 270 | Ga0495614_0017005 | 3300048089 | Bacteria | 3161 |
| 271 | Ga0496109_0000292 | 3300048912 | Bacteria | 47514 |
| 272 | Ga0496111_0101915 | 3300048914 | Bacteria | 2110 |
| 273 | Ga0496115_0007029 | 3300048918 | Bacteria | 8271 |
| 274 | Ga0496115_0055268 | 3300048918 | Bacteria | 3189 |
| 275 | Ga0496115_0138260 | 3300048918 | Bacteria | 2009 |
| 276 | Ga0501039_0048592 | 3300049575 | Archaea | 3280 |
| 277 | Ga0501039_0096278 | 3300049575 | Bacteria | 2308 |
| 278 | Ga0501075_0003861 | 3300049591 | Archaea | 10094 |
| 279 | Ga0501079_0038800 | 3300049741 | Archaea | 3673 |
| 280 | Ga0501081_0007371 | 3300049743 | Archaea | 7140 |
| 281 | nmdc:mga05p37_400785_c1 | 3300050507 | Bacteria | 1602 |
| 282 | nmdc:mga09592_37628_c1 | 3300050508 | Bacteria | 4059 |
| 283 | nmdc:mga09592_90346_c1 | 3300050508 | Bacteria | 2616 |
| 284 | nmdc:mga06r32_28449_c1 | 3300050510 | Bacteria | 5230 |
| 285 | nmdc:mga06r32_60978_c1 | 3300050510 | Bacteria | 3630 |
| 286 | nmdc:mga08y16_12214_c1 | 3300050511 | Bacteria | 9025 |
| 287 | nmdc:mga08y16_19631_c1 | 3300050511 | Bacteria | 7127 |
| 288 | nmdc:mga08y16_547052_c1 | 3300050511 | Bacteria | 1172 |
| 289 | nmdc:mga0n895_16025_c1 | 3300050512 | Bacteria | 6865 |
| 290 | nmdc:mga0n895_3502_c1 | 3300050512 | Bacteria | 12674 |
| 291 | nmdc:mga0n895_54906_c1 | 3300050512 | Bacteria | 3919 |
| 292 | nmdc:mga0rr50_15293_c1 | 3300050513 | Bacteria | 5062 |
| 293 | nmdc:mga0rr50_202107_c1 | 3300050513 | Bacteria | 1633 |
| 294 | nmdc:mga08x19_32306_c1 | 3300050514 | Bacteria | 3296 |
| 295 | nmdc:mga08x19_37981_c1 | 3300050514 | Archaea | 3058 |
| 296 | nmdc:mga0a205_12718_c1 | 3300050515 | Bacteria | 7800 |
| 297 | nmdc:mga0a205_132358_c1 | 3300050515 | Bacteria | 2394 |
| 298 | nmdc:mga0a205_39500_c1 | 3300050515 | Bacteria | 4542 |
| 299 | Ga0495612_0008731 | 3300053078 | Bacteria | 4110 |
| 300 | Ga0495595_0117525 | 3300053084 | Unclassified | 1294 |
| 301 | Ga0495619_0003638 | 3300053085 | Bacteria | 9929 |
| 302 | Ga0501084_0313349 | 3300054114 | Bacteria | 1325 |
| 303 | Ga0501082_0000052 | 3300060353 | Bacteria | 83141 |
| 304 | Ga0501082_0006783 | 3300060353 | Archaea | 9896 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0374934 | Ga0495628_0374934_94_1032 | 237 |
| 2 | 3300032126 | Ga0307415_100054866 | Ga0307415_1000548662 | 263 |
| 3 | 3300035114 | Ga0373939_0009963 | Ga0373939_0009963_1009_2157 | 263 |
| 4 | 3300053084 | Ga0495595_0117525 | Ga0495595_0117525_125_1093 | 264 |
| 5 | 3300042876 | Ga0451577_0268751 | Ga0451577_0268751_515_1516 | 268 |
| 6 | 3300046514 | Ga0495618_0065301 | Ga0495618_0065301_31_1104 | 274 |
| 7 | 3300028558 | Ga0265326_10000234 | Ga0265326_1000023419 | 275 |
| 8 | 3300028573 | Ga0265334_10000746 | Ga0265334_100007462 | 275 |
| 9 | 3300028654 | Ga0265322_10000018 | Ga0265322_10000018138 | 275 |
| 10 | 3300028666 | Ga0265336_10000035 | Ga0265336_1000003581 | 275 |
| 11 | 3300028800 | Ga0265338_10000362 | Ga0265338_100003629 | 275 |
| 12 | 3300029957 | Ga0265324_10000655 | Ga0265324_1000065517 | 275 |
| 13 | 3300031238 | Ga0265332_10002602 | Ga0265332_100026029 | 275 |
| 14 | 3300031241 | Ga0265325_10000528 | Ga0265325_100005289 | 275 |
| 15 | 3300031242 | Ga0265329_10006292 | Ga0265329_100062921 | 275 |
| 16 | 3300031247 | Ga0265340_10000980 | Ga0265340_100009803 | 275 |
| 17 | 3300031249 | Ga0265339_10000642 | Ga0265339_1000064219 | 275 |
| 18 | 3300031250 | Ga0265331_10000890 | Ga0265331_100008909 | 275 |
| 19 | 3300031344 | Ga0265316_10003098 | Ga0265316_1000309817 | 275 |
| 20 | 3300028556 | Ga0265337_1043419 | Ga0265337_10434192 | 276 |
| 21 | 3300028558 | Ga0265326_10000233 | Ga0265326_100002339 | 276 |
| 22 | 3300028666 | Ga0265336_10000817 | Ga0265336_1000081717 | 276 |
| 23 | 3300028800 | Ga0265338_10000361 | Ga0265338_100003619 | 276 |
| 24 | 3300029957 | Ga0265324_10000463 | Ga0265324_1000046316 | 276 |
| 25 | 3300031241 | Ga0265325_10051070 | Ga0265325_100510702 | 276 |
| 26 | 3300031247 | Ga0265340_10000978 | Ga0265340_1000097817 | 276 |
| 27 | 3300031249 | Ga0265339_10042405 | Ga0265339_100424052 | 276 |
| 28 | 3300031250 | Ga0265331_10000016 | Ga0265331_10000016259 | 276 |
| 29 | 3300031344 | Ga0265316_10000602 | Ga0265316_1000060222 | 276 |
| 30 | 3300031711 | Ga0265314_10001616 | Ga0265314_1000161619 | 276 |
| 31 | 3300048914 | Ga0496111_0101915 | Ga0496111_0101915_826_1944 | 276 |
| 32 | 3300025916 | Ga0207663_10009316 | Ga0207663_100093164 | 277 |
| 33 | 3300031548 | Ga0307408_100266269 | Ga0307408_1002662692 | 277 |
| 34 | 3300031731 | Ga0307405_10216731 | Ga0307405_102167312 | 277 |
| 35 | 3300031852 | Ga0307410_10005178 | Ga0307410_100051784 | 277 |
| 36 | 3300031995 | Ga0307409_100020613 | Ga0307409_1000206132 | 277 |
| 37 | 3300032002 | Ga0307416_100042102 | Ga0307416_1000421022 | 277 |
| 38 | 3300005434 | Ga0070709_10181679 | Ga0070709_101816792 | 278 |
| 39 | 3300005434 | Ga0070709_10246400 | Ga0070709_102464002 | 278 |
| 40 | 3300005437 | Ga0070710_10070197 | Ga0070710_100701972 | 278 |
| 41 | 3300005439 | Ga0070711_100128001 | Ga0070711_1001280012 | 278 |
| 42 | 3300005458 | Ga0070681_10004696 | Ga0070681_100046964 | 278 |
| 43 | 3300006914 | Ga0075436_100099175 | Ga0075436_1000991752 | 278 |
| 44 | 3300009093 | Ga0105240_10012563 | Ga0105240_100125639 | 278 |
| 45 | 3300025898 | Ga0207692_10008834 | Ga0207692_100088344 | 278 |
| 46 | 3300025898 | Ga0207692_10013410 | Ga0207692_100134102 | 278 |
| 47 | 3300025912 | Ga0207707_10008333 | Ga0207707_100083338 | 278 |
| 48 | 3300025913 | Ga0207695_10053722 | Ga0207695_100537223 | 278 |
| 49 | 3300025916 | Ga0207663_10028616 | Ga0207663_100286162 | 278 |
| 50 | 3300025916 | Ga0207663_10034782 | Ga0207663_100347822 | 278 |
| 51 | 3300025928 | Ga0207700_10001548 | Ga0207700_100015482 | 278 |
| 52 | 3300025929 | Ga0207664_10043736 | Ga0207664_100437362 | 278 |
| 53 | 3300035121 | Ga0373960_0034965 | Ga0373960_0034965_257_1366 | 278 |
| 54 | 3300050514 | nmdc:mga08x19_37981_c1 | nmdc:mga08x19_37981_c1_471_1580 | 278 |
| 55 | 3300005440 | Ga0070705_100088226 | Ga0070705_1000882262 | 280 |
| 56 | 3300005456 | Ga0070678_100065504 | Ga0070678_1000655043 | 280 |
| 57 | 3300026121 | Ga0207683_10087637 | Ga0207683_100876372 | 280 |
| 58 | 3300049575 | Ga0501039_0096278 | Ga0501039_0096278_634_1761 | 285 |
| 59 | 3300049591 | Ga0501075_0003861 | Ga0501075_0003861_5007_6134 | 285 |
| 60 | 3300049741 | Ga0501079_0038800 | Ga0501079_0038800_1399_2526 | 285 |
| 61 | 3300049743 | Ga0501081_0007371 | Ga0501081_0007371_2831_3958 | 285 |
| 62 | 3300060353 | Ga0501082_0006783 | Ga0501082_0006783_2025_3152 | 285 |
| 63 | 3300006852 | Ga0075433_10011405 | Ga0075433_100114053 | 286 |
| 64 | 3300006871 | Ga0075434_100078972 | Ga0075434_1000789723 | 287 |
| 65 | 3300050512 | nmdc:mga0n895_54906_c1 | nmdc:mga0n895_54906_c1_1229_2335 | 287 |
| 66 | 3300046517 | Ga0495630_0014659 | Ga0495630_0014659_2486_3619 | 288 |
| 67 | 3300046675 | Ga0495657_0178880 | Ga0495657_0178880_85_1218 | 288 |
| 68 | 3300047317 | Ga0495604_0105323 | Ga0495604_0105323_38_1171 | 288 |
| 69 | 3300005842 | Ga0068858_100064937 | Ga0068858_1000649372 | 289 |
| 70 | 3300005985 | Ga0081539_10000494 | Ga0081539_1000049459 | 289 |
| 71 | 3300009148 | Ga0105243_10086568 | Ga0105243_100865682 | 289 |
| 72 | 3300026035 | Ga0207703_10285448 | Ga0207703_102854482 | 289 |
| 73 | 3300032168 | Ga0316593_10026724 | Ga0316593_100267241 | 289 |
| 74 | 3300049575 | Ga0501039_0048592 | Ga0501039_0048592_1965_3050 | 290 |
| 75 | 3300031344 | Ga0265316_10062693 | Ga0265316_100626932 | 291 |
| 76 | 3300013297 | Ga0157378_10005703 | Ga0157378_100057035 | 292 |
| 77 | 3300025927 | Ga0207687_10080289 | Ga0207687_100802893 | 292 |
| 78 | 3300005471 | Ga0070698_100055146 | Ga0070698_1000551462 | 294 |
| 79 | 3300046454 | Ga0495592_0007262 | Ga0495592_0007262_5360_6496 | 294 |
| 80 | 3300046455 | Ga0495603_0018086 | Ga0495603_0018086_3107_4240 | 294 |
| 81 | 3300046462 | Ga0495651_0009783 | Ga0495651_0009783_5376_6512 | 294 |
| 82 | 3300046463 | Ga0495653_0002178 | Ga0495653_0002178_85_1221 | 294 |
| 83 | 3300046511 | Ga0495608_0043203 | Ga0495608_0043203_98_1234 | 294 |
| 84 | 3300046516 | Ga0495628_0000278 | Ga0495628_0000278_21618_22754 | 294 |
| 85 | 3300046529 | Ga0495652_0001155 | Ga0495652_0001155_1628_2764 | 294 |
| 86 | 3300046536 | Ga0495587_0001436 | Ga0495587_0001436_3191_4327 | 294 |
| 87 | 3300046559 | Ga0495667_0014061 | Ga0495667_0014061_3657_4784 | 294 |
| 88 | 3300046663 | Ga0495635_0030693 | Ga0495635_0030693_734_1870 | 294 |
| 89 | 3300046675 | Ga0495657_0036562 | Ga0495657_0036562_483_1619 | 294 |
| 90 | 3300046680 | Ga0495646_0099999 | Ga0495646_0099999_358_1485 | 294 |
| 91 | 3300046809 | Ga0495600_0003416 | Ga0495600_0003416_493_1629 | 294 |
| 92 | 3300047317 | Ga0495604_0001652 | Ga0495604_0001652_16857_17993 | 294 |
| 93 | 3300047317 | Ga0495604_0020983 | Ga0495604_0020983_2808_3935 | 294 |
| 94 | 3300047319 | Ga0495674_0066467 | Ga0495674_0066467_639_1775 | 294 |
| 95 | 3300047319 | Ga0495674_0083237 | Ga0495674_0083237_576_1703 | 294 |
| 96 | 3300047322 | Ga0495680_0021891 | Ga0495680_0021891_1910_3046 | 294 |
| 97 | 3300047444 | Ga0495675_0000169 | Ga0495675_0000169_32735_33871 | 294 |
| 98 | 3300047444 | Ga0495675_0096049 | Ga0495675_0096049_279_1406 | 294 |
| 99 | 3300047471 | Ga0495684_0017258 | Ga0495684_0017258_1179_2315 | 294 |
| 100 | 3300005438 | Ga0070701_10024411 | Ga0070701_100244112 | 295 |
| 101 | 3300005617 | Ga0068859_100339075 | Ga0068859_1003390751 | 295 |
| 102 | 3300005844 | Ga0068862_100102457 | Ga0068862_1001024572 | 295 |
| 103 | 3300006914 | Ga0075436_100025537 | Ga0075436_1000255374 | 295 |
| 104 | 3300006931 | Ga0097620_100339074 | Ga0097620_1003390742 | 295 |
| 105 | 3300050514 | nmdc:mga08x19_32306_c1 | nmdc:mga08x19_32306_c1_411_1532 | 295 |
| 106 | 3300005985 | Ga0081539_10072389 | Ga0081539_100723892 | 296 |
| 107 | 3300006852 | Ga0075433_10031263 | Ga0075433_100312633 | 296 |
| 108 | 3300006871 | Ga0075434_100006816 | Ga0075434_1000068167 | 296 |
| 109 | 3300007076 | Ga0075435_100016329 | Ga0075435_1000163297 | 296 |
| 110 | 3300009147 | Ga0114129_10008808 | Ga0114129_1000880812 | 296 |
| 111 | 3300050512 | nmdc:mga0n895_16025_c1 | nmdc:mga0n895_16025_c1_2672_3778 | 296 |
| 112 | 3300050513 | nmdc:mga0rr50_15293_c1 | nmdc:mga0rr50_15293_c1_3941_5047 | 296 |
| 113 | 3300050515 | nmdc:mga0a205_12718_c1 | nmdc:mga0a205_12718_c1_3462_4568 | 296 |
| 114 | 3300006846 | Ga0075430_100179443 | Ga0075430_1001794432 | 297 |
| 115 | 3300025981 | Ga0207640_10184618 | Ga0207640_101846181 | 297 |
| 116 | 3300048912 | Ga0496109_0000292 | Ga0496109_0000292_43351_44463 | 297 |
| 117 | 3300050510 | nmdc:mga06r32_60978_c1 | nmdc:mga06r32_60978_c1_1611_2723 | 297 |
| 118 | 3300006237 | Ga0097621_100039553 | Ga0097621_1000395533 | 298 |
| 119 | 3300006358 | Ga0068871_100001278 | Ga0068871_1000012786 | 298 |
| 120 | 3300046459 | Ga0495629_0000006 | Ga0495629_0000006_124722_125828 | 298 |
| 121 | 3300046475 | Ga0495639_0007146 | Ga0495639_0007146_2827_3933 | 298 |
| 122 | 3300046663 | Ga0495635_0008581 | Ga0495635_0008581_4758_5864 | 298 |
| 123 | 3300046681 | Ga0495647_0023792 | Ga0495647_0023792_100_1206 | 298 |
| 124 | 3300046683 | Ga0495658_0000739 | Ga0495658_0000739_8903_10009 | 298 |
| 125 | 3300046689 | Ga0495613_0036024 | Ga0495613_0036024_1680_2786 | 298 |
| 126 | 3300047315 | Ga0495581_0007095 | Ga0495581_0007095_1955_3061 | 298 |
| 127 | 3300047322 | Ga0495680_0000096 | Ga0495680_0000096_62961_64067 | 298 |
| 128 | 3300047471 | Ga0495684_0005408 | Ga0495684_0005408_4485_5612 | 298 |
| 129 | 3300053085 | Ga0495619_0003638 | Ga0495619_0003638_115_1221 | 298 |
| 130 | 3300005471 | Ga0070698_100316570 | Ga0070698_1003165702 | 299 |
| 131 | 3300038443 | Ga0395901_0003598 | Ga0395901_0003598_10910_11998 | 299 |
| 132 | 3300035118 | Ga0373954_0060955 | Ga0373954_0060955_70_1197 | 301 |
| 133 | 3300035692 | Ga0373935_0032180 | Ga0373935_0032180_1206_2333 | 301 |
| 134 | 3300035725 | Ga0373947_0024015 | Ga0373947_0024015_1785_2912 | 301 |
| 135 | 3300036401 | Ga0373937_0053719 | Ga0373937_0053719_553_1680 | 301 |
| 136 | 3300046462 | Ga0495651_0003699 | Ga0495651_0003699_8871_9998 | 301 |
| 137 | 3300046463 | Ga0495653_0030213 | Ga0495653_0030213_1992_3119 | 301 |
| 138 | 3300046472 | Ga0495580_0007808 | Ga0495580_0007808_5297_6424 | 301 |
| 139 | 3300046517 | Ga0495630_0024161 | Ga0495630_0024161_2911_4044 | 301 |
| 140 | 3300046526 | Ga0495666_0008362 | Ga0495666_0008362_3839_4966 | 301 |
| 141 | 3300046529 | Ga0495652_0023471 | Ga0495652_0023471_2284_3411 | 301 |
| 142 | 3300046531 | Ga0495665_0066909 | Ga0495665_0066909_612_1739 | 301 |
| 143 | 3300046642 | Ga0495634_0051222 | Ga0495634_0051222_539_1672 | 301 |
| 144 | 3300046663 | Ga0495635_0025627 | Ga0495635_0025627_1138_2265 | 301 |
| 145 | 3300046675 | Ga0495657_0056343 | Ga0495657_0056343_138_1265 | 301 |
| 146 | 3300046679 | Ga0495623_0036146 | Ga0495623_0036146_1040_2167 | 301 |
| 147 | 3300046680 | Ga0495646_0022275 | Ga0495646_0022275_1205_2332 | 301 |
| 148 | 3300046690 | Ga0495624_0023217 | Ga0495624_0023217_1461_2588 | 301 |
| 149 | 3300047317 | Ga0495604_0038155 | Ga0495604_0038155_1624_2751 | 301 |
| 150 | 3300047319 | Ga0495674_0066297 | Ga0495674_0066297_535_1668 | 301 |
| 151 | 3300047321 | Ga0495676_0103042 | Ga0495676_0103042_577_1704 | 301 |
| 152 | 3300047444 | Ga0495675_0022203 | Ga0495675_0022203_952_2079 | 301 |
| 153 | 3300047471 | Ga0495684_0007939 | Ga0495684_0007939_4393_5520 | 301 |
| 154 | 3300047673 | Ga0495593_0013347 | Ga0495593_0013347_70_1197 | 301 |
| 155 | 3300048088 | Ga0495602_0059020 | Ga0495602_0059020_1250_2377 | 301 |
| 156 | 3300053078 | Ga0495612_0008731 | Ga0495612_0008731_858_1985 | 301 |
| 157 | 3300005355 | Ga0070671_100132907 | Ga0070671_1001329071 | 302 |
| 158 | 3300039450 | Ga0436363_0224992 | Ga0436363_0224992_56_1207 | 302 |
| 159 | 3300045051 | Ga0451576_0407816 | Ga0451576_0407816_157_1278 | 302 |
| 160 | 3300005841 | Ga0068863_100010229 | Ga0068863_1000102295 | 303 |
| 161 | 3300013296 | Ga0157374_10071818 | Ga0157374_100718182 | 303 |
| 162 | 3300026088 | Ga0207641_10025119 | Ga0207641_100251194 | 303 |
| 163 | 3300028800 | Ga0265338_10006280 | Ga0265338_100062807 | 303 |
| 164 | 3300028800 | Ga0265338_10052701 | Ga0265338_100527013 | 303 |
| 165 | 3300031239 | Ga0265328_10056216 | Ga0265328_100562162 | 303 |
| 166 | 3300031240 | Ga0265320_10006778 | Ga0265320_100067782 | 303 |
| 167 | 3300031241 | Ga0265325_10004101 | Ga0265325_100041019 | 303 |
| 168 | 3300031247 | Ga0265340_10023569 | Ga0265340_100235691 | 303 |
| 169 | 3300031250 | Ga0265331_10049358 | Ga0265331_100493583 | 303 |
| 170 | 3300031344 | Ga0265316_10007613 | Ga0265316_100076137 | 303 |
| 171 | 3300031344 | Ga0265316_10039576 | Ga0265316_100395762 | 303 |
| 172 | 3300035691 | Ga0373931_0066453 | Ga0373931_0066453_20_1159 | 303 |
| 173 | 3300037418 | Ga0395900_0024683 | Ga0395900_0024683_4286_5386 | 303 |
| 174 | 3300037418 | Ga0395900_0177602 | Ga0395900_0177602_942_2042 | 303 |
| 175 | 3300037471 | Ga0395905_0155582 | Ga0395905_0155582_91_1191 | 303 |
| 176 | 3300037471 | Ga0395905_0417066 | Ga0395905_0417066_42_1142 | 303 |
| 177 | 3300038443 | Ga0395901_0138068 | Ga0395901_0138068_211_1311 | 303 |
| 178 | 3300042876 | Ga0451577_0085296 | Ga0451577_0085296_395_1528 | 303 |
| 179 | 3300031903 | Ga0307407_10165299 | Ga0307407_101652991 | 304 |
| 180 | 3300032005 | Ga0307411_10133321 | Ga0307411_101333212 | 304 |
| 181 | 3300036401 | Ga0373937_0041127 | Ga0373937_0041127_815_1951 | 304 |
| 182 | 3300046529 | Ga0495652_0149474 | Ga0495652_0149474_315_1463 | 304 |
| 183 | 3300005434 | Ga0070709_10017635 | Ga0070709_100176352 | 305 |
| 184 | 3300005435 | Ga0070714_100218172 | Ga0070714_1002181721 | 305 |
| 185 | 3300005436 | Ga0070713_100089253 | Ga0070713_1000892533 | 305 |
| 186 | 3300005548 | Ga0070665_100003010 | Ga0070665_10000301014 | 305 |
| 187 | 3300009176 | Ga0105242_10224881 | Ga0105242_102248812 | 305 |
| 188 | 3300013297 | Ga0157378_10003816 | Ga0157378_1000381610 | 305 |
| 189 | 3300014969 | Ga0157376_10000004 | Ga0157376_1000000435 | 305 |
| 190 | 3300025928 | Ga0207700_10092996 | Ga0207700_100929962 | 305 |
| 191 | 3300028379 | Ga0268266_10000470 | Ga0268266_1000047042 | 305 |
| 192 | 3300048918 | Ga0496115_0055268 | Ga0496115_0055268_617_1756 | 305 |
| 193 | 3300005467 | Ga0070706_100095505 | Ga0070706_1000955051 | 306 |
| 194 | 3300005468 | Ga0070707_100009356 | Ga0070707_1000093564 | 306 |
| 195 | 3300006175 | Ga0070712_100043186 | Ga0070712_1000431863 | 306 |
| 196 | 3300006844 | Ga0075428_100101853 | Ga0075428_1001018532 | 306 |
| 197 | 3300009093 | Ga0105240_10069565 | Ga0105240_100695651 | 306 |
| 198 | 3300013308 | Ga0157375_10076526 | Ga0157375_100765263 | 306 |
| 199 | 3300025910 | Ga0207684_10104096 | Ga0207684_101040961 | 306 |
| 200 | 3300025913 | Ga0207695_10197859 | Ga0207695_101978592 | 306 |
| 201 | 3300025915 | Ga0207693_10046843 | Ga0207693_100468433 | 306 |
| 202 | 3300025922 | Ga0207646_10000012 | Ga0207646_10000012274 | 306 |
| 203 | 3300005353 | Ga0070669_100002919 | Ga0070669_1000029196 | 307 |
| 204 | 3300005435 | Ga0070714_100300650 | Ga0070714_1003006502 | 307 |
| 205 | 3300005436 | Ga0070713_100215880 | Ga0070713_1002158801 | 307 |
| 206 | 3300005445 | Ga0070708_100079394 | Ga0070708_1000793943 | 307 |
| 207 | 3300005518 | Ga0070699_100100896 | Ga0070699_1001008963 | 307 |
| 208 | 3300005536 | Ga0070697_100268596 | Ga0070697_1002685962 | 307 |
| 209 | 3300006028 | Ga0070717_10040876 | Ga0070717_100408761 | 307 |
| 210 | 3300006844 | Ga0075428_100013979 | Ga0075428_1000139792 | 307 |
| 211 | 3300006846 | Ga0075430_100373870 | Ga0075430_1003738701 | 307 |
| 212 | 3300006871 | Ga0075434_100000527 | Ga0075434_10000052725 | 307 |
| 213 | 3300009094 | Ga0111539_10002668 | Ga0111539_100026687 | 307 |
| 214 | 3300025929 | Ga0207664_10323401 | Ga0207664_103234011 | 307 |
| 215 | 3300026075 | Ga0207708_10083064 | Ga0207708_100830642 | 307 |
| 216 | 3300027907 | Ga0207428_10007573 | Ga0207428_100075737 | 307 |
| 217 | 3300050508 | nmdc:mga09592_37628_c1 | nmdc:mga09592_37628_c1_2898_4007 | 307 |
| 218 | 3300050511 | nmdc:mga08y16_12214_c1 | nmdc:mga08y16_12214_c1_614_1723 | 307 |
| 219 | 3300050512 | nmdc:mga0n895_3502_c1 | nmdc:mga0n895_3502_c1_1034_2137 | 307 |
| 220 | 3300050513 | nmdc:mga0rr50_202107_c1 | nmdc:mga0rr50_202107_c1_148_1251 | 307 |
| 221 | 3300050515 | nmdc:mga0a205_39500_c1 | nmdc:mga0a205_39500_c1_1413_2516 | 307 |
| 222 | 3300005937 | Ga0081455_10021728 | Ga0081455_100217287 | 308 |
| 223 | 3300050511 | nmdc:mga08y16_547052_c1 | nmdc:mga08y16_547052_c1_50_1159 | 308 |
| 224 | 3300005439 | Ga0070711_100052158 | Ga0070711_1000521583 | 309 |
| 225 | 3300031250 | Ga0265331_10003861 | Ga0265331_100038614 | 309 |
| 226 | 3300032126 | Ga0307415_100131157 | Ga0307415_1001311572 | 309 |
| 227 | 3300005471 | Ga0070698_100063410 | Ga0070698_1000634101 | 310 |
| 228 | 3300005937 | Ga0081455_10008627 | Ga0081455_100086278 | 310 |
| 229 | 3300044673 | Ga0453683_0011305 | Ga0453683_0011305_1568_2704 | 310 |
| 230 | 3300044712 | Ga0453684_0027949 | Ga0453684_0027949_2102_3238 | 310 |
| 231 | 3300045051 | Ga0451576_0008447 | Ga0451576_0008447_6842_7978 | 310 |
| 232 | 3300050510 | nmdc:mga06r32_28449_c1 | nmdc:mga06r32_28449_c1_1971_3086 | 310 |
| 233 | 3300005468 | Ga0070707_100103282 | Ga0070707_1001032822 | 311 |
| 234 | 3300014969 | Ga0157376_10002854 | Ga0157376_100028548 | 311 |
| 235 | 3300025910 | Ga0207684_10194311 | Ga0207684_101943112 | 311 |
| 236 | 3300025922 | Ga0207646_10076221 | Ga0207646_100762212 | 311 |
| 237 | 3300028800 | Ga0265338_10021761 | Ga0265338_100217612 | 311 |
| 238 | 3300046475 | Ga0495639_0057547 | Ga0495639_0057547_588_1730 | 311 |
| 239 | 3300046476 | Ga0495662_0018989 | Ga0495662_0018989_573_1715 | 311 |
| 240 | 3300046499 | Ga0495594_0080879 | Ga0495594_0080879_104_1207 | 311 |
| 241 | 3300046642 | Ga0495634_0117213 | Ga0495634_0117213_369_1511 | 311 |
| 242 | 3300046674 | Ga0495588_0019872 | Ga0495588_0019872_2107_3210 | 311 |
| 243 | 3300048918 | Ga0496115_0007029 | Ga0496115_0007029_1686_2828 | 311 |
| 244 | 3300005545 | Ga0070695_100045259 | Ga0070695_1000452592 | 312 |
| 245 | 3300006852 | Ga0075433_10117182 | Ga0075433_101171822 | 312 |
| 246 | 3300014968 | Ga0157379_10117000 | Ga0157379_101170002 | 312 |
| 247 | 3300025941 | Ga0207711_10124035 | Ga0207711_101240352 | 312 |
| 248 | 3300026088 | Ga0207641_10216689 | Ga0207641_102166892 | 312 |
| 249 | 3300028563 | Ga0265319_1000970 | Ga0265319_100097016 | 312 |
| 250 | 3300028577 | Ga0265318_10000424 | Ga0265318_1000042412 | 312 |
| 251 | 3300031238 | Ga0265332_10006469 | Ga0265332_100064694 | 312 |
| 252 | 3300031240 | Ga0265320_10000131 | Ga0265320_1000013116 | 312 |
| 253 | 3300031241 | Ga0265325_10005365 | Ga0265325_100053656 | 312 |
| 254 | 3300031247 | Ga0265340_10002645 | Ga0265340_100026451 | 312 |
| 255 | 3300031249 | Ga0265339_10005286 | Ga0265339_100052867 | 312 |
| 256 | 3300031250 | Ga0265331_10000246 | Ga0265331_1000024642 | 312 |
| 257 | 3300031344 | Ga0265316_10006470 | Ga0265316_100064709 | 312 |
| 258 | 3300031595 | Ga0265313_10001486 | Ga0265313_1000148613 | 312 |
| 259 | 3300031711 | Ga0265314_10020331 | Ga0265314_100203314 | 312 |
| 260 | 3300031712 | Ga0265342_10000218 | Ga0265342_1000021842 | 312 |
| 261 | 3300045051 | Ga0451576_0009712 | Ga0451576_0009712_1029_2144 | 312 |
| 262 | 3300050515 | nmdc:mga0a205_132358_c1 | nmdc:mga0a205_132358_c1_293_1441 | 312 |
| 263 | 3300060353 | Ga0501082_0000052 | Ga0501082_0000052_22450_23580 | 312 |
| 264 | 3300005436 | Ga0070713_100038467 | Ga0070713_1000384674 | 313 |
| 265 | 3300024227 | Ga0228598_1001648 | Ga0228598_10016483 | 313 |
| 266 | 3300025906 | Ga0207699_10025727 | Ga0207699_100257273 | 313 |
| 267 | 3300025939 | Ga0207665_10006643 | Ga0207665_100066436 | 313 |
| 268 | 3300005439 | Ga0070711_100089461 | Ga0070711_1000894612 | 314 |
| 269 | 3300013100 | Ga0157373_10234658 | Ga0157373_102346581 | 314 |
| 270 | 3300038443 | Ga0395901_0130038 | Ga0395901_0130038_1232_2359 | 314 |
| 271 | 3300046473 | Ga0495582_0038665 | Ga0495582_0038665_297_1436 | 314 |
| 272 | 3300046689 | Ga0495613_0002121 | Ga0495613_0002121_12590_13729 | 314 |
| 273 | 3300025939 | Ga0207665_10033074 | Ga0207665_100330742 | 315 |
| 274 | 3300046462 | Ga0495651_0000132 | Ga0495651_0000132_52171_53298 | 315 |
| 275 | 3300046499 | Ga0495594_0005608 | Ga0495594_0005608_635_1777 | 315 |
| 276 | 3300046559 | Ga0495667_0008760 | Ga0495667_0008760_4438_5565 | 315 |
| 277 | 3300046690 | Ga0495624_0069799 | Ga0495624_0069799_987_2129 | 315 |
| 278 | 3300047319 | Ga0495674_0090174 | Ga0495674_0090174_382_1524 | 315 |
| 279 | 3300047322 | Ga0495680_0000068 | Ga0495680_0000068_3724_4851 | 315 |
| 280 | 3300048089 | Ga0495614_0017005 | Ga0495614_0017005_916_2058 | 315 |
| 281 | 3300005468 | Ga0070707_100006797 | Ga0070707_1000067978 | 316 |
| 282 | 3300006844 | Ga0075428_100355600 | Ga0075428_1003556002 | 316 |
| 283 | 3300006847 | Ga0075431_100079062 | Ga0075431_1000790622 | 316 |
| 284 | 3300025922 | Ga0207646_10004238 | Ga0207646_100042383 | 316 |
| 285 | 3300050507 | nmdc:mga05p37_400785_c1 | nmdc:mga05p37_400785_c1_104_1216 | 316 |
| 286 | 3300050508 | nmdc:mga09592_90346_c1 | nmdc:mga09592_90346_c1_903_2015 | 316 |
| 287 | 3300054114 | Ga0501084_0313349 | Ga0501084_0313349_51_1163 | 316 |
| 288 | 3300007265 | Ga0099794_10005531 | Ga0099794_100055312 | 317 |
| 289 | 3300009147 | Ga0114129_10096576 | Ga0114129_100965765 | 317 |
| 290 | 3300005468 | Ga0070707_100000031 | Ga0070707_10000003142 | 318 |
| 291 | 3300006847 | Ga0075431_100290455 | Ga0075431_1002904552 | 318 |
| 292 | 3300025922 | Ga0207646_10000046 | Ga0207646_1000004666 | 318 |
| 293 | 3300027907 | Ga0207428_10002609 | Ga0207428_100026098 | 318 |
| 294 | 3300050511 | nmdc:mga08y16_19631_c1 | nmdc:mga08y16_19631_c1_1129_2241 | 318 |
| 295 | 3300048918 | Ga0496115_0138260 | Ga0496115_0138260_673_1818 | 319 |
| 296 | 3300031712 | Ga0265342_10034981 | Ga0265342_100349813 | 321 |
| 297 | 3300005434 | Ga0070709_10036240 | Ga0070709_100362402 | 322 |
| 298 | 3300005436 | Ga0070713_100047041 | Ga0070713_1000470411 | 322 |
| 299 | 3300025906 | Ga0207699_10116542 | Ga0207699_101165421 | 322 |
| 300 | 3300028800 | Ga0265338_10151696 | Ga0265338_101516962 | 322 |
| 301 | 3300037471 | Ga0395905_0001373 | Ga0395905_0001373_20166_21284 | 325 |
| 302 | 3300005345 | Ga0070692_10024988 | Ga0070692_100249882 | 334 |
| 303 | 3300025909 | Ga0207705_10004576 | Ga0207705_100045766 | 334 |
| 304 | 3300025949 | Ga0207667_10087004 | Ga0207667_100870043 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rzy-assembly2.cif.gz_B | plasmodium falciparum pfa0660w hsp40 co-chaperone j-domain | 0.9589 | 4 | 67 |
| 5nro-assembly1.cif.gz_B | structure of full-length dnak with bound j-domain | 0.9588 | 4 | 64 |
| 3apq-assembly1.cif.gz_A | crystal structure of j-trx1 fragment of erdj5 | 0.9504 | 4 | 72 |
| 3apq-assembly2.cif.gz_B | crystal structure of j-trx1 fragment of erdj5 | 0.9499 | 4 | 72 |
| 5ayl-assembly1.cif.gz_A | crystal structure of erdj5 form ii | 0.9447 | 4 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LJ46_11_102_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9935 | 5 | 70 | 1.10.287.110 |
| af_I1LP50_1_90_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9923 | 5 | 70 | 1.10.287.110 |
| af_Q54YH7_8_119_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9798 | 4 | 68 | 1.10.287.110 |
| af_Q55D57_37_119_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9789 | 4 | 68 | 1.10.287.110 |
| af_A0A0R0EVG5_46_123_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9687 | 1 | 68 | 1.10.287.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S3CC44-F1-model_v4 | J domain-containing protein | 0.9767 | 4 | 71 |
GO:0005783
GO:0036503 GO:0051087 GO:0051787 |
| AF-A0A6G7RSU1-F1-model_v4 | Chaperone DnaJ C-terminal domain-containing protein | 0.962 | 109 | 309 |
GO:0005737
GO:0042026 GO:0051082 GO:0051085 |
| AF-A0A7S3C9R4-F1-model_v4 | Chaperone DnaJ C-terminal domain-containing protein | 0.9579 | 171 | 309 |
GO:0005737
GO:0042026 GO:0051082 GO:0051085 |
| AF-A0A6G3VHS8-F1-model_v4 | deleted | 0.9538 | 216 | 295 |
|
| AF-A0A7C0U482-F1-model_v4 | J domain-containing protein | 0.9508 | 209 | 309 |
GO:0005737
GO:0042026 GO:0051082 GO:0051085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar