F397581

General Info

Members Datasets Scaffolds Average Seq Length
304 203 231 176

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10026054|Ga0163162_100260542
Length 196
Sequence LKQKNKVHLPLSIPKNTMRKLANSELGRKSIEDFKEAEKTPLILILDDIRSLHNIGSVFRTADAFLIEKIYLCGITATPPNKEIHKTALGATDTVAWEYSKDVLDVITKLQTEDTEVWAIEQVENSVYLNDFHPEEGKKYALVFGNEVKGVSQEAIKLCSGTIEIPQLGTKHSLNISVSAGIVVWDIFQKNYTTAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
13 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
14 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
15 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
16 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
17 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
18 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
19 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
20 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
21 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
22 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
23 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
24 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
25 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
26 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
27 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
28 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
29 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
30 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
31 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
32 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
33 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
34 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
35 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
36 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
37 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
38 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
39 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
40 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
41 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
42 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
43 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
44 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
45 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
46 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
47 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
48 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
49 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
50 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
51 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
52 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
53 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
54 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
55 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
56 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
57 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
58 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
59 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
60 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
61 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
62 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
63 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
64 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
65 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
66 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
67 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
68 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
69 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
70 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
71 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
72 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
73 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
74 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
85 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
117 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
118 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
140 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
189 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
190 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
191 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
198 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
199 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
200 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
201 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
202 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
203 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.33
Metatranscriptomes 0.33
Isolates 24.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 3.95
Nodule 1.97
Rhizoplane 0.99
Rhizosphere 72.04
Stem 0
Stem Tuber 0
Unclassified 20.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3839476 2162886007 Bacteria 2808
2 SwRhRL2b_contig_393335 2162886007 Bacteria 4171
3 SwRhRL2b_contig_64782 2162886007 Bacteria 3476
4 JGI24741J21665_1000829 3300001915 Bacteria 9291
5 rootL2_10024404 3300003322 Bacteria 3891
6 rootH1_10016396 3300003316 Bacteria 14063
7 rootH1_10016396 3300003323 Bacteria 21188
8 Ga0006562J51391_1012377 3300003578 Bacteria 3000
9 Ga0055534_1002048 3300003784 Bacteria 7300
10 Ga0065714_10066154 3300005288 Bacteria 7479
11 Ga0065714_10083861 3300005288 Bacteria 2226
12 Ga0065714_10122265 3300005288 Bacteria 1330
13 Ga0065714_10346397 3300005288 Bacteria 640
14 Ga0065704_10071350 3300005289 Bacteria 11585
15 Ga0065704_10071819 3300005289 Bacteria 9844
16 Ga0065704_10078096 3300005289 Bacteria 4527
17 Ga0065704_10100022 3300005289 Bacteria 2289
18 Ga0065715_10154029 3300005293 Bacteria 1697
19 Ga0065715_10213524 3300005293 Bacteria 1303
20 Ga0065715_10215841 3300005293 Bacteria 1293
21 Ga0070683_100072673 3300005329 Bacteria 3211
22 Ga0070682_100000062 3300005337 Bacteria 105099
23 Ga0070682_100078477 3300005337 Bacteria 2130
24 Ga0070668_100054778 3300005347 Bacteria 3077
25 Ga0070669_100416389 3300005353 Bacteria 1102
26 Ga0070663_100303162 3300005455 Bacteria 1279
27 Ga0070684_100001183 3300005535 Bacteria 18755
28 Ga0099824_1002879 3300006942 Bacteria 25179
29 Ga0079104_1000188 3300006946 Bacteria 86607
30 Ga0105251_10050393 3300009011 Bacteria 1989
31 Ga0105244_10000005 3300009036 Bacteria 481412
32 Ga0105244_10000067 3300009036 Bacteria 121181
33 Ga0105244_10092175 3300009036 Bacteria 1489
34 Ga0105244_10126421 3300009036 Bacteria 1235
35 Ga0105250_10012507 3300009092 Bacteria 3502
36 Ga0105250_10019193 3300009092 Bacteria 2763
37 Ga0105243_10000064 3300009148 Bacteria 126487
38 Ga0105249_10033779 3300009553 Bacteria 4633
39 Ga0157373_10000076 3300013100 Bacteria 85437
40 Ga0157373_10001102 3300013100 Bacteria 20720
41 Ga0157373_10094778 3300013100 Bacteria 2101
42 Ga0157371_10000019 3300013102 Bacteria 307914
43 Ga0157371_10017413 3300013102 Bacteria 5338
44 Ga0157371_10064709 3300013102 Bacteria 2591
45 Ga0157370_10000601 3300013104 Bacteria 44816
46 Ga0157370_10001732 3300013104 Bacteria 26860
47 Ga0157370_10001855 3300013104 Bacteria 26046
48 Ga0157370_10002866 3300013104 Bacteria 20580
49 Ga0157370_10004538 3300013104 Bacteria 15903
50 Ga0157370_10028535 3300013104 Bacteria 5488
51 Ga0157370_10037158 3300013104 Bacteria 4722
52 Ga0157370_10185890 3300013104 Bacteria 1929
53 Ga0157370_10244312 3300013104 Bacteria 1661
54 Ga0157370_10947619 3300013104 Bacteria 780
55 Ga0157370_11081621 3300013104 Bacteria 725
56 Ga0157369_10000019 3300013105 Bacteria 243437
57 Ga0157369_10009500 3300013105 Bacteria 11120
58 Ga0157369_10166723 3300013105 Bacteria 2323
59 Ga0163162_10026054 3300013306 Bacteria 5779
60 Ga0157372_11019237 3300013307 Bacteria 959
61 Ga0157375_10003636 3300013308 Bacteria 13376
62 Ga0157375_10038178 3300013308 Bacteria 4609
63 Ga0182008_10000005 3300014497 Bacteria 386556
64 Ga0182006_1000001 3300015261 Bacteria 1091090
65 Ga0182006_1008267 3300015261 Bacteria 4718
66 Ga0182006_1053670 3300015261 Bacteria 1544
67 Ga0182006_1074545 3300015261 Bacteria 1250
68 Ga0182006_1092231 3300015261 Bacteria 1088
69 Ga0182007_10059413 3300015262 Bacteria 1254
70 Ga0163161_10000369 3300017792 Bacteria 37617
71 Ga0163161_10006476 3300017792 Bacteria 8106
72 Ga0163161_10006716 3300017792 Bacteria 7960
73 Ga0163161_10042892 3300017792 Bacteria 3256
74 Ga0163161_10180931 3300017792 Bacteria 1616
75 Ga0163161_11065387 3300017792 Bacteria 693
76 Ga0213876_10034086 3300021384 Unclassified 2684
77 Ga0209455_1017949 3300025272 Bacteria 1467
78 Ga0209675_1000022 3300025291 Bacteria 315280
79 Ga0207696_1030763 3300025711 Bacteria 1628
80 Ga0207655_1000016 3300025728 Bacteria 551476
81 Ga0207655_1000045 3300025728 Bacteria 315397
82 Ga0207713_1079565 3300025735 Bacteria 1183
83 Ga0207681_10422366 3300025923 Bacteria 1080
84 Ga0207709_10000080 3300025935 Bacteria 165667
85 Ga0207661_10050410 3300025944 Bacteria 3316
86 Ga0207712_10238568 3300025961 Bacteria 1463
87 Ga0207668_10005605 3300025972 Bacteria 7402
88 Ga0207678_10347627 3300026067 Bacteria 1279
89 Ga0207702_10447345 3300026078 Bacteria 1253
90 Ga0209281_1000207 3300027111 Bacteria 132470
91 Ga0209489_119071 3300027361 Bacteria 2437
92 Ga0210002_1026012 3300027617 Bacteria 959
93 Ga0209282_1040459 3300027666 Bacteria 2770
94 Ga0209974_10035033 3300027876 Bacteria 1666
95 Ga0265327_10007960 3300031251 Bacteria 8018
96 Ga0307408_100005090 3300031548 Bacteria 8820
97 Ga0316576_10036391 3300031727 Bacteria 3519
98 Ga0307405_10000001 3300031731 Bacteria 1731270
99 Ga0307413_10000031 3300031824 Bacteria 35783
100 Ga0307413_10035374 3300031824 Bacteria 2864
101 Ga0307413_10728726 3300031824 Bacteria 826
102 Ga0307410_10000022 3300031852 Bacteria 61479
103 Ga0307406_10003955 3300031901 Bacteria 8053
104 Ga0307406_10016046 3300031901 Bacteria 4345
105 Ga0307407_10002265 3300031903 Bacteria 7450
106 Ga0307412_10000006 3300031911 Bacteria 506878
107 Ga0307412_10000395 3300031911 Bacteria 26866
108 Ga0307412_11078977 3300031911 Bacteria 713
109 Ga0307416_100000021 3300032002 Bacteria 189730
110 Ga0307416_100000168 3300032002 Bacteria 37121
111 Ga0307414_10000005 3300032004 Bacteria 452161
112 Ga0307414_10000025 3300032004 Bacteria 199049
113 Ga0307414_10004294 3300032004 Bacteria 7738
114 Ga0307414_10026353 3300032004 Bacteria 3741
115 Ga0307414_10029833 3300032004 Bacteria 3555
116 Ga0307414_10103491 3300032004 Bacteria 2148
117 Ga0307414_10586138 3300032004 Bacteria 998
118 Ga0307414_10615974 3300032004 Bacteria 975
119 Ga0307411_10000002 3300032005 Bacteria 534807
120 Ga0307411_10083639 3300032005 Bacteria 2205
121 Ga0307415_100923744 3300032126 Bacteria 806
122 Ga0307510_10007972 3300033180 Bacteria 12603
123 Ga0316574_0257689 3300035398 Bacteria 1114
124 Ga0395905_0000001 3300037471 Bacteria 2037079
125 Ga0395905_0002847 3300037471 Bacteria 18921
126 Ga0395901_0000537 3300038443 Bacteria 43652
127 Ga0436365_1248268 3300039437 Bacteria 25465
128 Ga0439447_000065 3300041407 Bacteria 36979
129 Ga0439466_0006970 3300041411 Bacteria 4283
130 Ga0439466_0013976 3300041411 Bacteria 2931
131 Ga0439466_0094028 3300041411 Bacteria 939
132 Ga0439465_0000014 3300041413 Bacteria 34565
133 Ga0451791_0479721 3300041451 Bacteria 862
134 Ga0451807_0828667 3300041486 Bacteria 1175
135 Ga0451843_0734236 3300041509 Bacteria 714
136 Ga0439445_0000296 3300042004 Bacteria 9679
137 Ga0451577_0010371 3300042876 Bacteria 8914
138 Ga0453683_0010525 3300044673 Bacteria 6125
139 Ga0453683_0146814 3300044673 Unclassified 1489
140 Ga0453684_0000310 3300044712 Bacteria 206883
141 Ga0453684_0001540 3300044712 Bacteria 64408
142 Ga0453684_0014717 3300044712 Bacteria 12471
143 Ga0453684_0076888 3300044712 Bacteria 4188
144 Ga0451576_0003558 3300045051 Bacteria 21213
145 Ga0451576_0075699 3300045051 Bacteria 3502
146 Ga0495627_000012 3300046453 Bacteria 345654
147 Ga0495627_002987 3300046453 Bacteria 7739
148 Ga0495627_006710 3300046453 Bacteria 4481
149 Ga0495590_0003388 3300046457 Bacteria 6517
150 Ga0495638_0515687 3300046460 Bacteria 600
151 Ga0495596_0000272 3300046500 Bacteria 34288
152 Ga0495606_0004682 3300046507 Bacteria 13520
153 Ga0495606_0009823 3300046507 Bacteria 8038
154 Ga0495606_0015304 3300046507 Bacteria 5918
155 Ga0495606_0364877 3300046507 Unclassified 762
156 Ga0495616_0017632 3300046513 Bacteria 3934
157 Ga0495632_0003349 3300046519 Bacteria 11418
158 Ga0495643_0001067 3300046522 Bacteria 27322
159 Ga0495643_0014501 3300046522 Bacteria 4688
160 Ga0495643_0040126 3300046522 Bacteria 2557
161 Ga0495663_0000018 3300046525 Bacteria 131320
162 Ga0495654_0000003 3300046530 Bacteria 863485
163 Ga0495654_0023354 3300046530 Bacteria 3203
164 Ga0495609_0000003 3300046538 Bacteria 711547
165 Ga0495633_0000001 3300046558 Bacteria 801972
166 Ga0495633_0000536 3300046558 Bacteria 37862
167 Ga0495625_0000148 3300046660 Bacteria 106591
168 Ga0495625_0026003 3300046660 Bacteria 4427
169 Ga0495625_0156851 3300046660 Bacteria 1527
170 Ga0495625_0218468 3300046660 Bacteria 1250
171 Ga0495671_0234375 3300046692 Bacteria 887
172 Ga0495681_0105161 3300047470 Bacteria 1229
173 Ga0495686_0000224 3300047472 Bacteria 104239
174 Ga0495686_0002981 3300047472 Bacteria 15080
175 Ga0496102_0273269 3300048905 Bacteria 1593
176 Ga0496116_0000002 3300048919 Bacteria 920291
177 Ga0496116_0000051 3300048919 Bacteria 305038
178 Ga0496117_0000007 3300048920 Bacteria 720505
179 Ga0496117_0130153 3300048920 Bacteria 1527
180 Ga0496118_0000140 3300048921 Bacteria 128335
181 Ga0496118_0064617 3300048921 Bacteria 2684
182 Ga0496119_0000028 3300048922 Bacteria 244677
183 Ga0496120_0128998 3300048923 Bacteria 1297
184 Ga0496121_0012019 3300048924 Bacteria 9513
185 Ga0496121_0105172 3300048924 Bacteria 2167
186 Ga0496121_0319021 3300048924 Bacteria 1047
187 Ga0496122_0000181 3300048925 Bacteria 148788
188 Ga0496122_0000237 3300048925 Bacteria 123935
189 Ga0496122_0000422 3300048925 Bacteria 89784
190 Ga0496122_0000656 3300048925 Bacteria 69796
191 Ga0496122_0015994 3300048925 Bacteria 7134
192 Ga0496123_0000837 3300048926 Bacteria 49265
193 Ga0496123_0037302 3300048926 Bacteria 3433
194 Ga0496123_0086941 3300048926 Bacteria 1872
195 Ga0496123_0173518 3300048926 Bacteria 1134
196 Ga0496124_0002286 3300048927 Bacteria 25353
197 Ga0496124_0015544 3300048927 Bacteria 7287
198 Ga0496125_0000007 3300048928 Bacteria 715355
199 Ga0496125_0000184 3300048928 Bacteria 137135
200 Ga0496125_0000863 3300048928 Bacteria 48582
201 Ga0496125_0123138 3300048928 Bacteria 1844
202 Ga0496125_0215084 3300048928 Bacteria 1244
203 Ga0496126_0000921 3300048929 Bacteria 50911
204 Ga0496126_0005658 3300048929 Bacteria 14195
205 Ga0501033_0091887 3300049570 Bacteria 2220
206 Ga0501034_0018970 3300049571 Bacteria 7047
207 Ga0501034_0022065 3300049571 Bacteria 6486
208 Ga0501036_0117368 3300049572 Bacteria 2247
209 Ga0501038_0957024 3300049574 Unclassified 630
210 Ga0501047_0028373 3300049581 Bacteria 5395
211 Ga0501070_0064067 3300049586 Bacteria 3045
212 Ga0501238_000147 3300049671 Bacteria 10843
213 Ga0501249_017816 3300049679 Bacteria 1531
214 Ga0501251_000277 3300049681 Bacteria 4574
215 Ga0501080_0695008 3300049742 Unclassified 897
216 Ga0501241_000001 3300049758 Bacteria 233688
217 Ga0501266_000001 3300049763 Bacteria 562004
218 Ga0501269_000171 3300049766 Bacteria 19911
219 Ga0501280_000461 3300049776 Bacteria 9708
220 Ga0501280_008307 3300049776 Bacteria 1448
221 Ga0501035_0059764 3300049822 Bacteria 3395
222 Ga0501035_0890134 3300049822 Unclassified 706
223 Ga0500646_0002557 3300053090 Bacteria 4719
224 Ga0500646_0030762 3300053090 Bacteria 1474
225 Ga0500641_0000044 3300053096 Bacteria 63731
226 Ga0500641_0000051 3300053096 Bacteria 53081
227 Ga0500641_0012684 3300053096 Bacteria 3084
228 Ga0500658_0000020 3300053134 Bacteria 136543
229 Ga0500573_0377989 3300053140 Bacteria 678
230 Ga0500589_046514 3300053147 Bacteria 2021
231 Ga0500584_083983 3300053726 Bacteria 1355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_10447345 Ga0207702_104473453 164
2 3300021384 Ga0213876_10034086 Ga0213876_100340864 169
3 3300039437 Ga0436365_1248268 Ga0436365_1248268_24875_25384 169
4 3300049570 Ga0501033_0091887 Ga0501033_0091887_1515_2048 169
5 3300049571 Ga0501034_0018970 Ga0501034_0018970_4763_5296 169
6 3300049571 Ga0501034_0022065 Ga0501034_0022065_1746_2279 169
7 3300049586 Ga0501070_0064067 Ga0501070_0064067_561_1094 169
8 3300049742 Ga0501080_0695008 Ga0501080_0695008_193_726 169
9 3300049822 Ga0501035_0059764 Ga0501035_0059764_1850_2383 169
10 3300044712 Ga0453684_0014717 Ga0453684_0014717_181_693 170
11 iso_pu_bacteria 2513020052 2513234115 171
12 iso_pu_bacteria 2519899754 2520881337 171
13 iso_pu_bacteria 2643221600 2644010741 171
14 iso_pu_bacteria 2643221667 2644372038 171
15 iso_pu_bacteria 2643221716 2644643272 171
16 iso_pu_bacteria 2643221725 2644684185 171
17 iso_pu_bacteria 2738541279 2738734742 171
18 iso_pu_bacteria 2738541285 2738767501 171
19 iso_pu_bacteria 2738543007 2739216324 171
20 iso_pu_bacteria 2739367857 2739999688 171
21 iso_pu_bacteria 2739367858 2740004504 171
22 iso_pu_bacteria 2802428842 2802651921 171
23 iso_pu_bacteria 2816332280 2817414796 171
24 iso_pu_bacteria 2833640130 2833642185 171
25 iso_pu_bacteria 2857613821 2857615233 171
26 iso_pu_bacteria 2857618242 2857620974 171
27 iso_pu_bacteria 2881247448 2881250727 171
28 iso_pu_bacteria 2881359912 2881360270 171
29 iso_pu_bacteria 2903895155 2903895878 171
30 iso_pu_bacteria 2904419702 2904423907 171
31 iso_pu_bacteria 2904555929 2904560460 171
32 iso_pu_bacteria 2919191525 2919196040 171
33 iso_pu_bacteria 2919509842 2919510172 171
34 iso_pu_bacteria 2919683626 2919684816 171
35 iso_pu_bacteria 2929150217 2929151934 171
36 iso_pu_bacteria 2958512119 2958515128 171
37 iso_pu_bacteria 2977268062 2977268668 171
38 iso_pu_bacteria 8036736890 8036738696 171
39 iso_pu_bacteria 8054307821 8054312151 171
40 iso_pu_bacteria 8055419101 8055419415 171
41 iso_pu_bacteria 8055592153 8055593184 171
42 iso_pu_bacteria 8056440228 8056442306 171
43 iso_pu_bacteria 2511231000 2511233604 172
44 iso_pu_bacteria 2582581278 2585143210 172
45 iso_pu_bacteria 2582581281 2585157084 172
46 iso_pu_bacteria 2582581282 2585161224 172
47 iso_pu_bacteria 2582581873 2585426213 172
48 iso_pu_bacteria 2585428045 2587676847 172
49 iso_pu_bacteria 2585428060 2587746687 172
50 iso_pu_bacteria 2585428061 2587753716 172
51 iso_pu_bacteria 2585428095 2587866087 172
52 iso_pu_bacteria 2585428115 2587944465 172
53 iso_pu_bacteria 2585428182 2588211048 172
54 iso_pu_bacteria 2585428183 2588215469 172
55 iso_pu_bacteria 2585428184 2588218878 172
56 iso_pu_bacteria 2585428185 2588224377 172
57 iso_pu_bacteria 2585428187 2588232202 172
58 iso_pu_bacteria 2588253712 2588447110 172
59 iso_pu_bacteria 2588254255 2590602787 172
60 iso_pu_bacteria 2588254257 2590609759 172
61 iso_pu_bacteria 2728369107 2729201236 172
62 iso_pu_bacteria 2738541273 2738698867 172
63 iso_pu_bacteria 2738543014 2739253193 172
64 iso_pu_bacteria 2739367874 2740060049 172
65 iso_pu_bacteria 2751185877 2753673832 172
66 iso_pu_bacteria 2765235839 2765575240 172
67 iso_pu_bacteria 2772190705 2772606011 172
68 iso_pu_bacteria 2775506739 2775674665 172
69 iso_pu_bacteria 2816332188 2816875090 172
70 iso_pu_bacteria 2842083920 2842084621 172
71 iso_pu_bacteria 2871720351 2871723182 172
72 iso_pu_bacteria 2889290771 2889294225 172
73 iso_pu_bacteria 2905999023 2905999407 172
74 iso_pu_bacteria 2919097161 2919098282 172
75 iso_pu_bacteria 2919399522 2919401667 172
76 iso_pu_bacteria 2945924605 2945925295 172
77 iso_pu_bacteria 2946019816 2946023663 172
78 iso_pu_bacteria 2977243572 2977244091 172
79 iso_pu_bacteria 2984572630 2984573974 172
80 iso_pu_bacteria 2984606641 2984607420 172
81 iso_pu_bacteria 2993372514 2993375592 172
82 iso_pu_bacteria 2993480792 2993482459 172
83 iso_pu_bacteria 2523533629 2524006644 173
84 3300013104 Ga0157370_10002866 Ga0157370_100028667 174
85 3300013307 Ga0157372_11019237 Ga0157372_110192372 174
86 3300017792 Ga0163161_10042892 Ga0163161_100428923 174
87 3300046507 Ga0495606_0009823 Ga0495606_0009823_4726_5265 174
88 3300048928 Ga0496125_0000863 Ga0496125_0000863_23040_23579 174
89 3300048929 Ga0496126_0005658 Ga0496126_0005658_1447_1986 174
90 3300049776 Ga0501280_008307 Ga0501280_008307_471_1010 174
91 3300053096 Ga0500641_0000051 Ga0500641_0000051_36074_36613 174
92 2162886007 SwRhRL2b_contig_393335 SwRhRL2b_0880.00003600 175
93 3300005288 Ga0065714_10083861 Ga0065714_100838613 175
94 3300005288 Ga0065714_10122265 Ga0065714_101222653 175
95 3300005288 Ga0065714_10346397 Ga0065714_103463971 175
96 3300005289 Ga0065704_10071819 Ga0065704_100718193 175
97 3300005289 Ga0065704_10100022 Ga0065704_101000222 175
98 3300005293 Ga0065715_10213524 Ga0065715_102135241 175
99 3300005293 Ga0065715_10215841 Ga0065715_102158412 175
100 3300005337 Ga0070682_100078477 Ga0070682_1000784774 175
101 3300006942 Ga0099824_1002879 Ga0099824_100287926 175
102 3300006946 Ga0079104_1000188 Ga0079104_10001885 175
103 3300009011 Ga0105251_10050393 Ga0105251_100503932 175
104 3300009036 Ga0105244_10000067 Ga0105244_1000006785 175
105 3300009036 Ga0105244_10126421 Ga0105244_101264212 175
106 3300009092 Ga0105250_10019193 Ga0105250_100191932 175
107 3300013100 Ga0157373_10000076 Ga0157373_100000765 175
108 3300013102 Ga0157371_10017413 Ga0157371_100174133 175
109 3300013104 Ga0157370_10001732 Ga0157370_1000173222 175
110 3300013104 Ga0157370_10001855 Ga0157370_1000185521 175
111 3300013104 Ga0157370_10028535 Ga0157370_100285358 175
112 3300013104 Ga0157370_10037158 Ga0157370_100371582 175
113 3300013104 Ga0157370_10244312 Ga0157370_102443122 175
114 3300013104 Ga0157370_10947619 Ga0157370_109476191 175
115 3300013105 Ga0157369_10009500 Ga0157369_100095001 175
116 3300013306 Ga0163162_10026054 Ga0163162_100260542 175
117 3300013308 Ga0157375_10038178 Ga0157375_100381783 175
118 3300015261 Ga0182006_1008267 Ga0182006_10082672 175
119 3300015261 Ga0182006_1053670 Ga0182006_10536702 175
120 3300015261 Ga0182006_1074545 Ga0182006_10745452 175
121 3300015261 Ga0182006_1092231 Ga0182006_10922312 175
122 3300017792 Ga0163161_10000369 Ga0163161_100003697 175
123 3300017792 Ga0163161_10006476 Ga0163161_100064762 175
124 3300017792 Ga0163161_10180931 Ga0163161_101809311 175
125 3300017792 Ga0163161_11065387 Ga0163161_110653871 175
126 3300025272 Ga0209455_1017949 Ga0209455_10179492 175
127 3300025711 Ga0207696_1030763 Ga0207696_10307632 175
128 3300025728 Ga0207655_1000045 Ga0207655_100004578 175
129 3300025735 Ga0207713_1079565 Ga0207713_10795652 175
130 3300027111 Ga0209281_1000207 Ga0209281_100020748 175
131 3300027617 Ga0210002_1026012 Ga0210002_10260121 175
132 3300027666 Ga0209282_1040459 Ga0209282_10404592 175
133 3300027876 Ga0209974_10035033 Ga0209974_100350332 175
134 3300031548 Ga0307408_100005090 Ga0307408_1000050908 175
135 3300031727 Ga0316576_10036391 Ga0316576_100363912 175
136 3300031731 Ga0307405_10000001 Ga0307405_10000001608 175
137 3300031824 Ga0307413_10000031 Ga0307413_1000003119 175
138 3300031824 Ga0307413_10035374 Ga0307413_100353742 175
139 3300031824 Ga0307413_10728726 Ga0307413_107287262 175
140 3300031852 Ga0307410_10000022 Ga0307410_1000002226 175
141 3300031901 Ga0307406_10003955 Ga0307406_100039554 175
142 3300031901 Ga0307406_10016046 Ga0307406_100160465 175
143 3300031903 Ga0307407_10002265 Ga0307407_100022652 175
144 3300032002 Ga0307416_100000168 Ga0307416_10000016829 175
145 3300032004 Ga0307414_10000005 Ga0307414_10000005298 175
146 3300032004 Ga0307414_10004294 Ga0307414_100042944 175
147 3300032004 Ga0307414_10029833 Ga0307414_100298333 175
148 3300032004 Ga0307414_10615974 Ga0307414_106159742 175
149 3300032005 Ga0307411_10000002 Ga0307411_10000002120 175
150 3300032005 Ga0307411_10083639 Ga0307411_100836392 175
151 3300033180 Ga0307510_10007972 Ga0307510_100079726 175
152 3300035398 Ga0316574_0257689 Ga0316574_0257689_365_892 175
153 3300037471 Ga0395905_0000001 Ga0395905_0000001_348003_348533 175
154 3300037471 Ga0395905_0002847 Ga0395905_0002847_6881_7408 175
155 3300038443 Ga0395901_0000537 Ga0395901_0000537_32865_33392 175
156 3300041407 Ga0439447_000065 Ga0439447_000065_9027_9557 175
157 3300041411 Ga0439466_0006970 Ga0439466_0006970_3523_4059 175
158 3300041411 Ga0439466_0013976 Ga0439466_0013976_710_1246 175
159 3300041451 Ga0451791_0479721 Ga0451791_0479721_249_791 175
160 3300041486 Ga0451807_0828667 Ga0451807_0828667_453_995 175
161 3300042876 Ga0451577_0010371 Ga0451577_0010371_7207_7737 175
162 3300044673 Ga0453683_0010525 Ga0453683_0010525_1462_1992 175
163 3300044673 Ga0453683_0146814 Ga0453683_0146814_768_1301 175
164 3300044712 Ga0453684_0000310 Ga0453684_0000310_134997_135524 175
165 3300044712 Ga0453684_0001540 Ga0453684_0001540_34835_35371 175
166 3300044712 Ga0453684_0076888 Ga0453684_0076888_1547_2077 175
167 3300045051 Ga0451576_0003558 Ga0451576_0003558_11681_12217 175
168 3300045051 Ga0451576_0075699 Ga0451576_0075699_1562_2092 175
169 3300046453 Ga0495627_002987 Ga0495627_002987_2792_3331 175
170 3300046507 Ga0495606_0364877 Ga0495606_0364877_21_560 175
171 3300046513 Ga0495616_0017632 Ga0495616_0017632_888_1418 175
172 3300046522 Ga0495643_0001067 Ga0495643_0001067_22680_23210 175
173 3300046530 Ga0495654_0023354 Ga0495654_0023354_1636_2172 175
174 3300046660 Ga0495625_0026003 Ga0495625_0026003_566_1096 175
175 3300046660 Ga0495625_0156851 Ga0495625_0156851_764_1306 175
176 3300046660 Ga0495625_0218468 Ga0495625_0218468_476_1012 175
177 3300046692 Ga0495671_0234375 Ga0495671_0234375_164_706 175
178 3300047470 Ga0495681_0105161 Ga0495681_0105161_447_977 175
179 3300048919 Ga0496116_0000002 Ga0496116_0000002_81084_81620 175
180 3300048921 Ga0496118_0064617 Ga0496118_0064617_1984_2520 175
181 3300048924 Ga0496121_0012019 Ga0496121_0012019_5781_6317 175
182 3300048924 Ga0496121_0105172 Ga0496121_0105172_1438_1968 175
183 3300048927 Ga0496124_0015544 Ga0496124_0015544_3041_3577 175
184 3300048928 Ga0496125_0000007 Ga0496125_0000007_81968_82504 175
185 3300048928 Ga0496125_0215084 Ga0496125_0215084_592_1128 175
186 3300049572 Ga0501036_0117368 Ga0501036_0117368_1381_1908 175
187 3300049574 Ga0501038_0957024 Ga0501038_0957024_49_576 175
188 3300049581 Ga0501047_0028373 Ga0501047_0028373_3385_3912 175
189 3300049671 Ga0501238_000147 Ga0501238_000147_621_1157 175
190 3300049679 Ga0501249_017816 Ga0501249_017816_895_1437 175
191 3300049763 Ga0501266_000001 Ga0501266_000001_532594_533124 175
192 3300049776 Ga0501280_000461 Ga0501280_000461_6285_6821 175
193 3300049822 Ga0501035_0890134 Ga0501035_0890134_70_597 175
194 3300053090 Ga0500646_0002557 Ga0500646_0002557_1909_2451 175
195 3300053090 Ga0500646_0030762 Ga0500646_0030762_621_1151 175
196 3300053096 Ga0500641_0000044 Ga0500641_0000044_21248_21790 175
197 3300053096 Ga0500641_0012684 Ga0500641_0012684_1997_2533 175
198 3300053134 Ga0500658_0000020 Ga0500658_0000020_77902_78432 175
199 3300053140 Ga0500573_0377989 Ga0500573_0377989_24_560 175
200 3300053147 Ga0500589_046514 Ga0500589_046514_158_694 175
201 3300053726 Ga0500584_083983 Ga0500584_083983_489_1031 175
202 2162886007 SwRhRL2b_contig_3839476 SwRhRL2b_0805.00000660 176
203 2162886007 SwRhRL2b_contig_64782 SwRhRL2b_0835.00006390 176
204 3300001915 JGI24741J21665_1000829 JGI24741J21665_10008293 176
205 3300003322 rootL2_10024404 rootL2_100244044 176
206 3300003323 rootH1_10016396 rootH1_1001639615 176
207 3300003578 Ga0006562J51391_1012377 Ga0006562J51391_10123772 176
208 3300003784 Ga0055534_1002048 Ga0055534_10020487 176
209 3300005288 Ga0065714_10066154 Ga0065714_100661542 176
210 3300005289 Ga0065704_10071350 Ga0065704_100713501 176
211 3300005289 Ga0065704_10078096 Ga0065704_100780964 176
212 3300005293 Ga0065715_10154029 Ga0065715_101540293 176
213 3300005329 Ga0070683_100072673 Ga0070683_1000726732 176
214 3300005337 Ga0070682_100000062 Ga0070682_10000006284 176
215 3300005347 Ga0070668_100054778 Ga0070668_1000547782 176
216 3300005353 Ga0070669_100416389 Ga0070669_1004163892 176
217 3300005455 Ga0070663_100303162 Ga0070663_1003031622 176
218 3300005535 Ga0070684_100001183 Ga0070684_10000118321 176
219 3300009036 Ga0105244_10000005 Ga0105244_100000059 176
220 3300009036 Ga0105244_10092175 Ga0105244_100921752 176
221 3300009092 Ga0105250_10012507 Ga0105250_100125074 176
222 3300009148 Ga0105243_10000064 Ga0105243_1000006451 176
223 3300009553 Ga0105249_10033779 Ga0105249_100337792 176
224 3300013100 Ga0157373_10001102 Ga0157373_1000110226 176
225 3300013100 Ga0157373_10094778 Ga0157373_100947782 176
226 3300013102 Ga0157371_10000019 Ga0157371_1000001937 176
227 3300013102 Ga0157371_10064709 Ga0157371_100647093 176
228 3300013104 Ga0157370_10000601 Ga0157370_1000060149 176
229 3300013104 Ga0157370_10004538 Ga0157370_1000453817 176
230 3300013104 Ga0157370_10185890 Ga0157370_101858902 176
231 3300013104 Ga0157370_11081621 Ga0157370_110816212 176
232 3300013105 Ga0157369_10000019 Ga0157369_10000019176 176
233 3300013105 Ga0157369_10166723 Ga0157369_101667234 176
234 3300013308 Ga0157375_10003636 Ga0157375_100036361 176
235 3300014497 Ga0182008_10000005 Ga0182008_10000005189 176
236 3300015261 Ga0182006_1000001 Ga0182006_1000001417 176
237 3300015262 Ga0182007_10059413 Ga0182007_100594131 176
238 3300017792 Ga0163161_10006716 Ga0163161_100067168 176
239 3300025291 Ga0209675_1000022 Ga0209675_1000022174 176
240 3300025728 Ga0207655_1000016 Ga0207655_10000169 176
241 3300025923 Ga0207681_10422366 Ga0207681_104223662 176
242 3300025935 Ga0207709_10000080 Ga0207709_1000008097 176
243 3300025944 Ga0207661_10050410 Ga0207661_100504102 176
244 3300025961 Ga0207712_10238568 Ga0207712_102385682 176
245 3300025972 Ga0207668_10005605 Ga0207668_100056059 176
246 3300026067 Ga0207678_10347627 Ga0207678_103476272 176
247 3300027361 Ga0209489_119071 Ga0209489_1190713 176
248 3300031251 Ga0265327_10007960 Ga0265327_100079602 176
249 3300031911 Ga0307412_10000006 Ga0307412_10000006443 176
250 3300031911 Ga0307412_10000395 Ga0307412_100003958 176
251 3300031911 Ga0307412_11078977 Ga0307412_110789771 176
252 3300032002 Ga0307416_100000021 Ga0307416_10000002179 176
253 3300032004 Ga0307414_10000025 Ga0307414_1000002551 176
254 3300032004 Ga0307414_10026353 Ga0307414_100263531 176
255 3300032004 Ga0307414_10103491 Ga0307414_101034914 176
256 3300032004 Ga0307414_10586138 Ga0307414_105861382 176
257 3300032126 Ga0307415_100923744 Ga0307415_1009237441 176
258 3300041411 Ga0439466_0094028 Ga0439466_0094028_182_718 176
259 3300041413 Ga0439465_0000014 Ga0439465_0000014_17577_18107 176
260 3300041509 Ga0451843_0734236 Ga0451843_0734236_74_610 176
261 3300042004 Ga0439445_0000296 Ga0439445_0000296_7552_8082 176
262 3300046453 Ga0495627_000012 Ga0495627_000012_210733_211263 176
263 3300046453 Ga0495627_006710 Ga0495627_006710_800_1330 176
264 3300046457 Ga0495590_0003388 Ga0495590_0003388_2285_2818 176
265 3300046460 Ga0495638_0515687 Ga0495638_0515687_25_555 176
266 3300046500 Ga0495596_0000272 Ga0495596_0000272_28645_29175 176
267 3300046507 Ga0495606_0004682 Ga0495606_0004682_9674_10204 176
268 3300046507 Ga0495606_0015304 Ga0495606_0015304_3318_3848 176
269 3300046519 Ga0495632_0003349 Ga0495632_0003349_8842_9372 176
270 3300046522 Ga0495643_0014501 Ga0495643_0014501_3132_3662 176
271 3300046522 Ga0495643_0040126 Ga0495643_0040126_657_1187 176
272 3300046525 Ga0495663_0000018 Ga0495663_0000018_97789_98319 176
273 3300046530 Ga0495654_0000003 Ga0495654_0000003_352327_352857 176
274 3300046538 Ga0495609_0000003 Ga0495609_0000003_361918_362454 176
275 3300046558 Ga0495633_0000001 Ga0495633_0000001_444238_444768 176
276 3300046558 Ga0495633_0000536 Ga0495633_0000536_29723_30253 176
277 3300046660 Ga0495625_0000148 Ga0495625_0000148_29990_30520 176
278 3300047472 Ga0495686_0000224 Ga0495686_0000224_24187_24717 176
279 3300047472 Ga0495686_0002981 Ga0495686_0002981_2669_3199 176
280 3300048905 Ga0496102_0273269 Ga0496102_0273269_1012_1542 176
281 3300048919 Ga0496116_0000051 Ga0496116_0000051_189750_190280 176
282 3300048920 Ga0496117_0000007 Ga0496117_0000007_529658_530188 176
283 3300048920 Ga0496117_0130153 Ga0496117_0130153_70_600 176
284 3300048921 Ga0496118_0000140 Ga0496118_0000140_45733_46263 176
285 3300048922 Ga0496119_0000028 Ga0496119_0000028_190216_190746 176
286 3300048923 Ga0496120_0128998 Ga0496120_0128998_403_933 176
287 3300048924 Ga0496121_0319021 Ga0496121_0319021_101_631 176
288 3300048925 Ga0496122_0000181 Ga0496122_0000181_80792_81322 176
289 3300048925 Ga0496122_0000237 Ga0496122_0000237_23388_23918 176
290 3300048925 Ga0496122_0000422 Ga0496122_0000422_65622_66152 176
291 3300048925 Ga0496122_0000656 Ga0496122_0000656_10884_11414 176
292 3300048925 Ga0496122_0015994 Ga0496122_0015994_1176_1706 176
293 3300048926 Ga0496123_0000837 Ga0496123_0000837_19005_19535 176
294 3300048926 Ga0496123_0037302 Ga0496123_0037302_2664_3194 176
295 3300048926 Ga0496123_0086941 Ga0496123_0086941_440_970 176
296 3300048926 Ga0496123_0173518 Ga0496123_0173518_323_853 176
297 3300048927 Ga0496124_0002286 Ga0496124_0002286_5446_5976 176
298 3300048928 Ga0496125_0000184 Ga0496125_0000184_108320_108850 176
299 3300048928 Ga0496125_0123138 Ga0496125_0123138_1280_1810 176
300 3300048929 Ga0496126_0000921 Ga0496126_0000921_25129_25659 176
301 3300049681 Ga0501251_000277 Ga0501251_000277_1600_2130 176
302 3300049758 Ga0501241_000001 Ga0501241_000001_156756_157313 176
303 3300049766 Ga0501269_000171 Ga0501269_000171_6979_7509 176
304 iso_pu_bacteria 2958458903 2958462960 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

41

185

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.9071 19 172
3gyq-assembly1.cif.gz_B structure of the thiostrepton-resistance methyltransferase s-adenosyl-l-methionine complex 0.8959 27 175
3nk7-assembly1.cif.gz_A structure of the nosiheptide-resistance methyltransferase s-adenosyl-l-methionine complex 0.8937 27 175
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8921 26 174
2i6d-assembly1.cif.gz_A the structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis. 0.8911 26 176
ID Description Score Start End Superfamily
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9395 24 174 3.40.1280.10
af_A0A0G2JYA7_1418_1569_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9309 27 174 3.40.1280.10
af_Q0DW28_49_219_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9167 15 174 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9159 27 172 3.40.1280.10
af_Q54XF8_1505_1680_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9151 20 174 3.40.1280.10
ID Description Score Start End GO Terms
AF-R5AWU0-F1-model_v4 RNA methyltransferase TrmH family 0.9887 25 176 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A644SPE4-F1-model_v4 23S rRNA (Guanosine-2'-O-)-methyltransferase RlmB (EC 2.1.1.185) 0.9855 2 176 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A833AZ99-F1-model_v4 deleted 0.9831 35 176
AF-A0A359MF85-F1-model_v4 deleted 0.9825 48 150
AF-A0A807YHM8-F1-model_v4 deleted 0.9807 1 176

Feature Viewer

pLDDT pTM Quality
94.21 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map