F397550

General Info

Members Datasets Scaffolds Average Seq Length
304 172 608 255

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10004103|Ga0114129_1000410314
Length 285
Sequence VSIEPLALTNDLIEAARDSVISRGGRMKQYEYLMVEADAPIAIITMNRPDRRNALSLAMMEELIDCFRTLGEKQEIRAIILAANGPAFSAGHDLSELIDRQIGDYRHVFDVCTELMTLIQSITQPVIAEVNGIATAAGCQLVATCDLVIASEKSQFATPGVRIGLFCTTPMVALTRAIGRKRALEMLLTGSPIDAQTAMEWGLTNRIVPSERLREESYALAQRITEASPLTVSVGKQAFYTQIDLDQPKAYAYAKEVMSLNAMAEDAQEGMGAFLEKRTPCWKGR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.71
Metatranscriptomes 3.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 92.43
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10004103 3300009147 Bacteria 20584
2 JGI25406J46586_10022639 3300003203 Bacteria 2499
3 Ga0065707_10140906 3300005295 Bacteria 1772
4 Ga0070658_10179713 3300005327 Bacteria 1780
5 Ga0070658_10322658 3300005327 Bacteria 1319
6 Ga0070683_100016115 3300005329 Bacteria 6580
7 Ga0070691_10011095 3300005341 Bacteria 4112
8 Ga0070687_100053727 3300005343 Bacteria 2096
9 Ga0070703_10000627 3300005406 Bacteria 12453
10 Ga0070709_10000038 3300005434 Bacteria 108855
11 Ga0070709_10088219 3300005434 Bacteria 2040
12 Ga0070709_10125868 3300005434 Bacteria 1743
13 Ga0070709_10293671 3300005434 Unclassified 1185
14 Ga0070714_100012429 3300005435 Bacteria 6798
15 Ga0070714_100020241 3300005435 Bacteria 5431
16 Ga0070714_100021639 3300005435 Bacteria 5263
17 Ga0070714_100029259 3300005435 Bacteria 4579
18 Ga0070714_100061499 3300005435 Bacteria 3226
19 Ga0070705_100000006 3300005440 Bacteria 118302
20 Ga0070700_100362508 3300005441 Bacteria 1078
21 Ga0070700_100394102 3300005441 Bacteria 1039
22 Ga0070694_100007665 3300005444 Bacteria 6588
23 Ga0070708_100009806 3300005445 Bacteria 7733
24 Ga0070708_100090726 3300005445 Bacteria 2782
25 Ga0070685_10293645 3300005466 Bacteria 1093
26 Ga0070706_100000629 3300005467 Bacteria 40581
27 Ga0070706_100001403 3300005467 Bacteria 25475
28 Ga0070706_100001876 3300005467 Bacteria 21714
29 Ga0070706_100008695 3300005467 Bacteria 9465
30 Ga0070706_100023058 3300005467 Bacteria 5733
31 Ga0070706_100031590 3300005467 Bacteria 4883
32 Ga0070706_100338596 3300005467 Bacteria 1403
33 Ga0070706_100343994 3300005467 Bacteria 1390
34 Ga0070706_100490822 3300005467 Bacteria 1143
35 Ga0070706_100655176 3300005467 Bacteria 975
36 Ga0070707_100000920 3300005468 Bacteria 29194
37 Ga0070707_100001568 3300005468 Bacteria 22146
38 Ga0070707_100008606 3300005468 Bacteria 9477
39 Ga0070707_100013664 3300005468 Bacteria 7603
40 Ga0070698_100041507 3300005471 Bacteria 4723
41 Ga0070698_100439854 3300005471 Bacteria 1239
42 Ga0070698_100600786 3300005471 Bacteria 1041
43 Ga0070699_100000011 3300005518 Bacteria 267738
44 Ga0070699_100268325 3300005518 Bacteria 1527
45 Ga0070679_100152303 3300005530 Bacteria 2289
46 Ga0070684_100001293 3300005535 Bacteria 17945
47 Ga0070684_100054593 3300005535 Bacteria 3481
48 Ga0068853_100329402 3300005539 Bacteria 1417
49 Ga0070696_100000373 3300005546 Bacteria 27295
50 Ga0070696_100156705 3300005546 Bacteria 1675
51 Ga0070665_100268960 3300005548 Bacteria 1706
52 Ga0070665_100517223 3300005548 Bacteria 1205
53 Ga0070704_100106836 3300005549 Bacteria 2122
54 Ga0068855_100127774 3300005563 Bacteria 2905
55 Ga0068855_100148287 3300005563 Bacteria 2669
56 Ga0070664_100013689 3300005564 Bacteria 6610
57 Ga0068857_100060654 3300005577 Bacteria 3360
58 Ga0068857_100082309 3300005577 Bacteria 2875
59 Ga0068856_100009684 3300005614 Bacteria 9357
60 Ga0068852_100097904 3300005616 Bacteria 2640
61 Ga0068864_100311513 3300005618 Bacteria 1476
62 Ga0068861_100396182 3300005719 Bacteria 1224
63 Ga0068863_100179257 3300005841 Bacteria 2034
64 Ga0068862_100126247 3300005844 Bacteria 2259
65 Ga0081539_10002014 3300005985 Bacteria 30742
66 Ga0070717_10038135 3300006028 Bacteria 3905
67 Ga0075428_100006195 3300006844 Bacteria 13305
68 Ga0075428_100232114 3300006844 Bacteria 1991
69 Ga0075433_10047682 3300006852 Bacteria 3727
70 Ga0075434_100050108 3300006871 Bacteria 4148
71 Ga0075429_100013765 3300006880 Bacteria 7014
72 Ga0075429_100557293 3300006880 Bacteria 1004
73 Ga0075435_100000158 3300007076 Bacteria 39024
74 Ga0105240_10027042 3300009093 Bacteria 7520
75 Ga0111539_10128414 3300009094 Bacteria 2969
76 Ga0114129_10744596 3300009147 Bacteria 1255
77 Ga0105241_10294973 3300009174 Bacteria 1389
78 Ga0105248_10006241 3300009177 Bacteria 13065
79 Ga0105248_10016281 3300009177 Bacteria 8185
80 Ga0105248_10072050 3300009177 Bacteria 3883
81 Ga0105248_10459669 3300009177 Bacteria 1435
82 Ga0105248_11123851 3300009177 Bacteria 888
83 Ga0105237_10012421 3300009545 Bacteria 8977
84 Ga0105237_10931507 3300009545 Bacteria 876
85 Ga0105238_10105581 3300009551 Bacteria 2798
86 Ga0105249_10414505 3300009553 Bacteria 1380
87 Ga0105239_10018785 3300010375 Bacteria 7638
88 Ga0157370_10680662 3300013104 Bacteria 939
89 Ga0157369_10011160 3300013105 Bacteria 10215
90 Ga0157369_10058365 3300013105 Bacteria 4163
91 Ga0157369_10408556 3300013105 Bacteria 1408
92 Ga0157374_10656387 3300013296 Bacteria 1061
93 Ga0157378_10273391 3300013297 Bacteria 1626
94 Ga0157378_10494108 3300013297 Bacteria 1221
95 Ga0157372_10332446 3300013307 Bacteria 1769
96 Ga0163163_10002190 3300014325 Bacteria 16446
97 Ga0163163_10124654 3300014325 Bacteria 2613
98 Ga0157379_10326823 3300014968 Bacteria 1401
99 Ga0157376_10660254 3300014969 Bacteria 1047
100 Ga0206356_10167070 3300020070 Bacteria 1959
101 Ga0206356_11562221 3300020070 Bacteria 1258
102 Ga0206349_1877707 3300020075 Bacteria 3533
103 Ga0206351_10125323 3300020077 Bacteria 4274
104 Ga0206350_10470852 3300020080 Bacteria 2292
105 Ga0206350_10659237 3300020080 Bacteria 3487
106 Ga0206353_10579652 3300020082 Bacteria 1931
107 Ga0154015_1393183 3300020610 Bacteria 3742
108 Ga0213873_10018498 3300021358 Bacteria 1603
109 Ga0213872_10021734 3300021361 Bacteria 2956
110 Ga0213875_10001750 3300021388 Bacteria 13618
111 Ga0213875_10009909 3300021388 Bacteria 4803
112 Ga0213875_10039990 3300021388 Bacteria 2208
113 Ga0224712_10002963 3300022467 Bacteria 4307
114 Ga0224712_10015428 3300022467 Bacteria 2486
115 Ga0207653_10000131 3300025885 Bacteria 53307
116 Ga0207699_10000001 3300025906 Bacteria 695560
117 Ga0207705_10368768 3300025909 Bacteria 1108
118 Ga0207684_10000619 3300025910 Bacteria 42259
119 Ga0207684_10002563 3300025910 Bacteria 18227
120 Ga0207684_10008272 3300025910 Bacteria 9262
121 Ga0207684_10035909 3300025910 Bacteria 4207
122 Ga0207684_10049120 3300025910 Bacteria 3579
123 Ga0207695_10055894 3300025913 Bacteria 4110
124 Ga0207695_10238674 3300025913 Bacteria 1720
125 Ga0207671_10102229 3300025914 Unclassified 2172
126 Ga0207671_10104442 3300025914 Bacteria 2149
127 Ga0207663_10029230 3300025916 Bacteria 3235
128 Ga0207660_10420470 3300025917 Unclassified 1078
129 Ga0207662_10066177 3300025918 Bacteria 2177
130 Ga0207652_10588513 3300025921 Bacteria 998
131 Ga0207646_10000916 3300025922 Bacteria 38024
132 Ga0207646_10007058 3300025922 Bacteria 11490
133 Ga0207646_10025289 3300025922 Bacteria 5432
134 Ga0207646_10156731 3300025922 Bacteria 2054
135 Ga0207646_10186059 3300025922 Bacteria 1876
136 Ga0207646_10672586 3300025922 Bacteria 927
137 Ga0207700_10001844 3300025928 Bacteria 12012
138 Ga0207700_10002192 3300025928 Bacteria 11197
139 Ga0207664_10004386 3300025929 Bacteria 9562
140 Ga0207664_10007214 3300025929 Bacteria 7698
141 Ga0207664_10058935 3300025929 Bacteria 3056
142 Ga0207664_10113768 3300025929 Bacteria 2254
143 Ga0207664_10262970 3300025929 Bacteria 1509
144 Ga0207690_10340888 3300025932 Bacteria 1183
145 Ga0207665_10042025 3300025939 Bacteria 3055
146 Ga0207711_10137189 3300025941 Bacteria 2198
147 Ga0207711_10279318 3300025941 Bacteria 1538
148 Ga0207711_10398197 3300025941 Bacteria 1279
149 Ga0207661_10004155 3300025944 Bacteria 10126
150 Ga0207679_10003507 3300025945 Bacteria 9701
151 Ga0207667_10078981 3300025949 Bacteria 3410
152 Ga0207658_10356763 3300025986 Bacteria 1275
153 Ga0207658_10450299 3300025986 Bacteria 1140
154 Ga0207639_10330731 3300026041 Bacteria 1356
155 Ga0207708_10283710 3300026075 Bacteria 1342
156 Ga0207708_10350638 3300026075 Bacteria 1211
157 Ga0207702_10012500 3300026078 Bacteria 7061
158 Ga0207641_10205170 3300026088 Bacteria 1820
159 Ga0207641_10887338 3300026088 Bacteria 885
160 Ga0207674_10000062 3300026116 Bacteria 111069
161 Ga0207674_10099296 3300026116 Bacteria 2893
162 Ga0207674_10208164 3300026116 Bacteria 1905
163 Ga0207675_100396106 3300026118 Bacteria 1360
164 Ga0207698_10056975 3300026142 Bacteria 3020
165 Ga0207428_10148439 3300027907 Bacteria 1786
166 Ga0268266_10086459 3300028379 Bacteria 2742
167 Ga0268266_10498295 3300028379 Bacteria 1163
168 Ga0265338_10006233 3300028800 Bacteria 15263
169 Ga0265338_10219869 3300028800 Bacteria 1419
170 Ga0265330_10058304 3300031235 Bacteria 1683
171 Ga0265330_10079946 3300031235 Bacteria 1409
172 Ga0265332_10000038 3300031238 Bacteria 133265
173 Ga0265332_10005237 3300031238 Bacteria 5998
174 Ga0265332_10122841 3300031238 Unclassified 1090
175 Ga0265328_10002521 3300031239 Bacteria 8208
176 Ga0265325_10000364 3300031241 Bacteria 31753
177 Ga0265325_10088732 3300031241 Bacteria 1527
178 Ga0265340_10021008 3300031247 Bacteria 3348
179 Ga0265339_10000098 3300031249 Bacteria 73022
180 Ga0265339_10000678 3300031249 Bacteria 26310
181 Ga0265339_10012207 3300031249 Bacteria 5254
182 Ga0265331_10000126 3300031250 Bacteria 101034
183 Ga0265331_10000562 3300031250 Bacteria 33471
184 Ga0265331_10003903 3300031250 Bacteria 9425
185 Ga0265316_10000031 3300031344 Bacteria 161451
186 Ga0265313_10004916 3300031595 Bacteria 10016
187 Ga0265314_10000201 3300031711 Bacteria 88062
188 Ga0265314_10000314 3300031711 Bacteria 68677
189 Ga0265314_10000416 3300031711 Bacteria 57316
190 Ga0265342_10001233 3300031712 Bacteria 24212
191 Ga0265342_10048449 3300031712 Unclassified 2547
192 Ga0265342_10053498 3300031712 Bacteria 2402
193 Ga0373953_0076811 3300035117 Bacteria 1384
194 Ga0373956_0129694 3300035119 Bacteria 1180
195 Ga0373943_0157419 3300035170 Bacteria 1235
196 Ga0373955_0018753 3300035172 Bacteria 3447
197 Ga0373955_0067204 3300035172 Bacteria 1995
198 Ga0373924_0039071 3300035410 Bacteria 1938
199 Ga0373924_0151755 3300035410 Bacteria 1014
200 Ga0373935_0065899 3300035692 Bacteria 2325
201 Ga0373927_0000959 3300035695 Bacteria 22003
202 Ga0373927_0004799 3300035695 Bacteria 9407
203 Ga0373927_0006917 3300035695 Bacteria 7705
204 Ga0373927_0170614 3300035695 Bacteria 1426
205 Ga0373933_0036623 3300035724 Bacteria 2873
206 Ga0373947_0261624 3300035725 Bacteria 1147
207 Ga0373937_0007617 3300036401 Bacteria 9379
208 Ga0373937_0013710 3300036401 Bacteria 7142
209 Ga0373937_0125175 3300036401 Bacteria 2397
210 Ga0373937_0319129 3300036401 Bacteria 1470
211 Ga0373937_0453183 3300036401 Bacteria 1218
212 Ga0373937_0802597 3300036401 Bacteria 889
213 Ga0373925_0019241 3300037068 Bacteria 4966
214 Ga0373925_0248600 3300037068 Bacteria 1426
215 Ga0395899_0014615 3300037312 Bacteria 5991
216 Ga0395898_0007237 3300037466 Bacteria 11776
217 Ga0395905_0324812 3300037471 Bacteria 1429
218 Ga0436364_0369898 3300037853 Bacteria 2144
219 Ga0436364_0493686 3300037853 Bacteria 2210
220 Ga0436364_0661003 3300037853 Bacteria 15933
221 Ga0436364_0880006 3300037853 Bacteria 23594
222 Ga0436364_1350070 3300037853 Bacteria 11520
223 Ga0436364_1422477 3300037853 Bacteria 26161
224 Ga0395901_0037420 3300038443 Bacteria 5018
225 Ga0436365_0171404 3300039437 Bacteria 1182
226 Ga0436365_1045322 3300039437 Bacteria 2746
227 Ga0436360_0278865 3300039438 Bacteria 4621
228 Ga0436360_0593498 3300039438 Bacteria 9729
229 Ga0436360_0729652 3300039438 Bacteria 12194
230 Ga0436360_1044530 3300039438 Bacteria 2508
231 Ga0436360_1240778 3300039438 Bacteria 2538
232 Ga0436361_0267774 3300039447 Bacteria 6565
233 Ga0436361_1150668 3300039447 Bacteria 2291
234 Ga0436363_0221004 3300039450 Bacteria 951
235 Ga0436363_0557816 3300039450 Bacteria 1086
236 Ga0436363_0701743 3300039450 Bacteria 1604
237 Ga0436363_0975106 3300039450 Bacteria 872
238 Ga0436363_1405386 3300039450 Bacteria 1987
239 Ga0436362_0209248 3300039453 Bacteria 9115
240 Ga0436362_0268271 3300039453 Bacteria 1709
241 Ga0436362_0900301 3300039453 Bacteria 3997
242 Ga0436362_0998711 3300039453 Bacteria 1362
243 Ga0436362_1225717 3300039453 Bacteria 1924
244 Ga0453683_0022462 3300044673 Bacteria 4025
245 Ga0451576_0463426 3300045051 Bacteria 1331
246 Ga0466958_0105262 3300045836 Bacteria 1758
247 Ga0495592_0035841 3300046454 Bacteria 3738
248 Ga0495651_0052505 3300046462 Bacteria 3139
249 Ga0495580_0019826 3300046472 Bacteria 4990
250 Ga0495580_0089134 3300046472 Bacteria 2147
251 Ga0495580_0143977 3300046472 Unclassified 1652
252 Ga0495664_0024280 3300046477 Bacteria 3522
253 Ga0495664_0161492 3300046477 Bacteria 1359
254 Ga0495608_0069768 3300046511 Bacteria 2295
255 Ga0495628_0040095 3300046516 Bacteria 3744
256 Ga0495630_0357037 3300046517 Bacteria 1118
257 Ga0495652_0046499 3300046529 Bacteria 3726
258 Ga0495640_0047769 3300046533 Bacteria 2961
259 Ga0495640_0173059 3300046533 Bacteria 1379
260 Ga0495586_0198152 3300046535 Bacteria 1138
261 Ga0495587_0052607 3300046536 Bacteria 2402
262 Ga0495587_0152115 3300046536 Bacteria 1319
263 Ga0495645_0004210 3300046543 Bacteria 9841
264 Ga0495667_0029139 3300046559 Bacteria 3715
265 Ga0495634_0077687 3300046642 Bacteria 2176
266 Ga0495635_0068659 3300046663 Unclassified 2431
267 Ga0495635_0328719 3300046663 Unclassified 1022
268 Ga0495599_0025422 3300046678 Bacteria 3706
269 Ga0495646_0137599 3300046680 Bacteria 1368
270 Ga0495647_0217235 3300046681 Bacteria 843
271 Ga0495669_0135435 3300046684 Bacteria 1161
272 Ga0495581_0354128 3300047315 Bacteria 857
273 Ga0495604_0088917 3300047317 Bacteria 2297
274 Ga0495674_0015112 3300047319 Bacteria 7221
275 Ga0495674_0021115 3300047319 Bacteria 6024
276 Ga0495674_0056929 3300047319 Bacteria 3423
277 Ga0495674_0128939 3300047319 Bacteria 2132
278 Ga0495675_0064717 3300047444 Bacteria 2313
279 Ga0495675_0163244 3300047444 Bacteria 1371
280 Ga0495684_0022305 3300047471 Bacteria 4874
281 Ga0495684_0097545 3300047471 Bacteria 2223
282 Ga0495602_0104351 3300048088 Bacteria 2319
283 Ga0495602_0208200 3300048088 Bacteria 1487
284 Ga0496109_0000093 3300048912 Bacteria 93170
285 Ga0496109_0112338 3300048912 Bacteria 2534
286 Ga0496110_0261786 3300048913 Bacteria 1574
287 Ga0496111_0299848 3300048914 Bacteria 1191
288 Ga0496112_0036096 3300048915 Bacteria 4820
289 Ga0496112_0373722 3300048915 Bacteria 1367
290 Ga0496115_0014357 3300048918 Bacteria 5996
291 Ga0501036_0199741 3300049572 Bacteria 1682
292 Ga0501075_0427448 3300049591 Bacteria 1010
293 nmdc:mga05p37_56790_c1 3300050507 Bacteria 4820
294 nmdc:mga05p37_855577_c1 3300050507 Bacteria 987
295 nmdc:mga09592_54537_c1 3300050508 Bacteria 1873
296 nmdc:mga0rr50_207_c1 3300050513 Bacteria 31592
297 nmdc:mga08x19_194022_c1 3300050514 Bacteria 1390
298 nmdc:mga08x19_5501_c1 3300050514 Bacteria 7493
299 nmdc:mga0a205_108005_c1 3300050515 Bacteria 2681
300 nmdc:mga0a205_361402_c1 3300050515 Bacteria 1318
301 nmdc:mga0a205_5658_c1 3300050515 Bacteria 11260
302 Ga0495601_0191405 3300053077 Bacteria 1337
303 Ga0495612_0098732 3300053078 Bacteria 1242
304 Ga0495619_0164653 3300053085 Bacteria 1532
305 Ga0114129_10004103
306 JGI25406J46586_10022639
307 Ga0065707_10140906
308 Ga0070658_10179713
309 Ga0070658_10322658
310 Ga0070683_100016115
311 Ga0070691_10011095
312 Ga0070687_100053727
313 Ga0070703_10000627
314 Ga0070709_10000038
315 Ga0070709_10088219
316 Ga0070709_10125868
317 Ga0070709_10293671
318 Ga0070714_100012429
319 Ga0070714_100020241
320 Ga0070714_100021639
321 Ga0070714_100029259
322 Ga0070714_100061499
323 Ga0070705_100000006
324 Ga0070700_100362508
325 Ga0070700_100394102
326 Ga0070694_100007665
327 Ga0070708_100009806
328 Ga0070708_100090726
329 Ga0070685_10293645
330 Ga0070706_100000629
331 Ga0070706_100001403
332 Ga0070706_100001876
333 Ga0070706_100008695
334 Ga0070706_100023058
335 Ga0070706_100031590
336 Ga0070706_100338596
337 Ga0070706_100343994
338 Ga0070706_100490822
339 Ga0070706_100655176
340 Ga0070707_100000920
341 Ga0070707_100001568
342 Ga0070707_100008606
343 Ga0070707_100013664
344 Ga0070698_100041507
345 Ga0070698_100439854
346 Ga0070698_100600786
347 Ga0070699_100000011
348 Ga0070699_100268325
349 Ga0070679_100152303
350 Ga0070684_100001293
351 Ga0070684_100054593
352 Ga0068853_100329402
353 Ga0070696_100000373
354 Ga0070696_100156705
355 Ga0070665_100268960
356 Ga0070665_100517223
357 Ga0070704_100106836
358 Ga0068855_100127774
359 Ga0068855_100148287
360 Ga0070664_100013689
361 Ga0068857_100060654
362 Ga0068857_100082309
363 Ga0068856_100009684
364 Ga0068852_100097904
365 Ga0068864_100311513
366 Ga0068861_100396182
367 Ga0068863_100179257
368 Ga0068862_100126247
369 Ga0081539_10002014
370 Ga0070717_10038135
371 Ga0075428_100006195
372 Ga0075428_100232114
373 Ga0075433_10047682
374 Ga0075434_100050108
375 Ga0075429_100013765
376 Ga0075429_100557293
377 Ga0075435_100000158
378 Ga0105240_10027042
379 Ga0111539_10128414
380 Ga0114129_10744596
381 Ga0105241_10294973
382 Ga0105248_10006241
383 Ga0105248_10016281
384 Ga0105248_10072050
385 Ga0105248_10459669
386 Ga0105248_11123851
387 Ga0105237_10012421
388 Ga0105237_10931507
389 Ga0105238_10105581
390 Ga0105249_10414505
391 Ga0105239_10018785
392 Ga0157370_10680662
393 Ga0157369_10011160
394 Ga0157369_10058365
395 Ga0157369_10408556
396 Ga0157374_10656387
397 Ga0157378_10273391
398 Ga0157378_10494108
399 Ga0157372_10332446
400 Ga0163163_10002190
401 Ga0163163_10124654
402 Ga0157379_10326823
403 Ga0157376_10660254
404 Ga0206356_10167070
405 Ga0206356_11562221
406 Ga0206349_1877707
407 Ga0206351_10125323
408 Ga0206350_10470852
409 Ga0206350_10659237
410 Ga0206353_10579652
411 Ga0154015_1393183
412 Ga0213873_10018498
413 Ga0213872_10021734
414 Ga0213875_10001750
415 Ga0213875_10009909
416 Ga0213875_10039990
417 Ga0224712_10002963
418 Ga0224712_10015428
419 Ga0207653_10000131
420 Ga0207699_10000001
421 Ga0207705_10368768
422 Ga0207684_10000619
423 Ga0207684_10002563
424 Ga0207684_10008272
425 Ga0207684_10035909
426 Ga0207684_10049120
427 Ga0207695_10055894
428 Ga0207695_10238674
429 Ga0207671_10102229
430 Ga0207671_10104442
431 Ga0207663_10029230
432 Ga0207660_10420470
433 Ga0207662_10066177
434 Ga0207652_10588513
435 Ga0207646_10000916
436 Ga0207646_10007058
437 Ga0207646_10025289
438 Ga0207646_10156731
439 Ga0207646_10186059
440 Ga0207646_10672586
441 Ga0207700_10001844
442 Ga0207700_10002192
443 Ga0207664_10004386
444 Ga0207664_10007214
445 Ga0207664_10058935
446 Ga0207664_10113768
447 Ga0207664_10262970
448 Ga0207690_10340888
449 Ga0207665_10042025
450 Ga0207711_10137189
451 Ga0207711_10279318
452 Ga0207711_10398197
453 Ga0207661_10004155
454 Ga0207679_10003507
455 Ga0207667_10078981
456 Ga0207658_10356763
457 Ga0207658_10450299
458 Ga0207639_10330731
459 Ga0207708_10283710
460 Ga0207708_10350638
461 Ga0207702_10012500
462 Ga0207641_10205170
463 Ga0207641_10887338
464 Ga0207674_10000062
465 Ga0207674_10099296
466 Ga0207674_10208164
467 Ga0207675_100396106
468 Ga0207698_10056975
469 Ga0207428_10148439
470 Ga0268266_10086459
471 Ga0268266_10498295
472 Ga0265338_10006233
473 Ga0265338_10219869
474 Ga0265330_10058304
475 Ga0265330_10079946
476 Ga0265332_10000038
477 Ga0265332_10005237
478 Ga0265332_10122841
479 Ga0265328_10002521
480 Ga0265325_10000364
481 Ga0265325_10088732
482 Ga0265340_10021008
483 Ga0265339_10000098
484 Ga0265339_10000678
485 Ga0265339_10012207
486 Ga0265331_10000126
487 Ga0265331_10000562
488 Ga0265331_10003903
489 Ga0265316_10000031
490 Ga0265313_10004916
491 Ga0265314_10000201
492 Ga0265314_10000314
493 Ga0265314_10000416
494 Ga0265342_10001233
495 Ga0265342_10048449
496 Ga0265342_10053498
497 Ga0373953_0076811
498 Ga0373956_0129694
499 Ga0373943_0157419
500 Ga0373955_0018753
501 Ga0373955_0067204
502 Ga0373924_0039071
503 Ga0373924_0151755
504 Ga0373935_0065899
505 Ga0373927_0000959
506 Ga0373927_0004799
507 Ga0373927_0006917
508 Ga0373927_0170614
509 Ga0373933_0036623
510 Ga0373947_0261624
511 Ga0373937_0007617
512 Ga0373937_0013710
513 Ga0373937_0125175
514 Ga0373937_0319129
515 Ga0373937_0453183
516 Ga0373937_0802597
517 Ga0373925_0019241
518 Ga0373925_0248600
519 Ga0395899_0014615
520 Ga0395898_0007237
521 Ga0395905_0324812
522 Ga0436364_0369898
523 Ga0436364_0493686
524 Ga0436364_0661003
525 Ga0436364_0880006
526 Ga0436364_1350070
527 Ga0436364_1422477
528 Ga0395901_0037420
529 Ga0436365_0171404
530 Ga0436365_1045322
531 Ga0436360_0278865
532 Ga0436360_0593498
533 Ga0436360_0729652
534 Ga0436360_1044530
535 Ga0436360_1240778
536 Ga0436361_0267774
537 Ga0436361_1150668
538 Ga0436363_0221004
539 Ga0436363_0557816
540 Ga0436363_0701743
541 Ga0436363_0975106
542 Ga0436363_1405386
543 Ga0436362_0209248
544 Ga0436362_0268271
545 Ga0436362_0900301
546 Ga0436362_0998711
547 Ga0436362_1225717
548 Ga0453683_0022462
549 Ga0451576_0463426
550 Ga0466958_0105262
551 Ga0495592_0035841
552 Ga0495651_0052505
553 Ga0495580_0019826
554 Ga0495580_0089134
555 Ga0495580_0143977
556 Ga0495664_0024280
557 Ga0495664_0161492
558 Ga0495608_0069768
559 Ga0495628_0040095
560 Ga0495630_0357037
561 Ga0495652_0046499
562 Ga0495640_0047769
563 Ga0495640_0173059
564 Ga0495586_0198152
565 Ga0495587_0052607
566 Ga0495587_0152115
567 Ga0495645_0004210
568 Ga0495667_0029139
569 Ga0495634_0077687
570 Ga0495635_0068659
571 Ga0495635_0328719
572 Ga0495599_0025422
573 Ga0495646_0137599
574 Ga0495647_0217235
575 Ga0495669_0135435
576 Ga0495581_0354128
577 Ga0495604_0088917
578 Ga0495674_0015112
579 Ga0495674_0021115
580 Ga0495674_0056929
581 Ga0495674_0128939
582 Ga0495675_0064717
583 Ga0495675_0163244
584 Ga0495684_0022305
585 Ga0495684_0097545
586 Ga0495602_0104351
587 Ga0495602_0208200
588 Ga0496109_0000093
589 Ga0496109_0112338
590 Ga0496110_0261786
591 Ga0496111_0299848
592 Ga0496112_0036096
593 Ga0496112_0373722
594 Ga0496115_0014357
595 Ga0501036_0199741
596 Ga0501075_0427448
597 nmdc:mga05p37_56790_c1
598 nmdc:mga05p37_855577_c1
599 nmdc:mga09592_54537_c1
600 nmdc:mga0rr50_207_c1
601 nmdc:mga08x19_194022_c1
602 nmdc:mga08x19_5501_c1
603 nmdc:mga0a205_108005_c1
604 nmdc:mga0a205_361402_c1
605 nmdc:mga0a205_5658_c1
606 Ga0495601_0191405
607 Ga0495612_0098732
608 Ga0495619_0164653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

36

285

0.95

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

41

282

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9749 7 257
2vx2-assembly3.cif.gz_G crystal structure of human enoyl coenzyme a hydratase domain- containing protein 3 (echdc3) 0.9731 6 257
2vx2-assembly3.cif.gz_G crystal structure of human enoyl coenzyme a hydratase domain- containing protein 3 (echdc3) 0.9656 6 257
3l3s-assembly2.cif.gz_F crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.9574 8 240
3l3s-assembly1.cif.gz_C crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.9533 8 239
ID Description Score Start End Superfamily
2vx2F02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9956 206 258 1.10.12.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9757 7 200 3.90.226.10
2vx2D02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9748 204 258 1.10.12.10
3mybB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9729 205 257 1.10.12.10
2vx2A02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9726 204 258 1.10.12.10
ID Description Score Start End GO Terms
AF-K8XSR9-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9881 35 260 GO:0006631
GO:0016836
AF-A0A7W0NWT1-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.986 7 260 GO:0004300
GO:0006631
AF-A0A535DRZ9-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9844 1 251 GO:0004300
GO:0006631
AF-A0A3A6P1F5-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9833 3 260 GO:0006631
GO:0016836
AF-A0A182W3P4-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9813 7 260 GO:0005739
GO:0006631
GO:0016836

Map