F397459

General Info

Members Datasets Scaffolds Average Seq Length
304 195 606 347

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100005768|Ga0070698_1000057682
Length 368
Sequence VNLDKLDHRPVAVVGFAQRQMAEFDGSPTCVELLVPLFAELYEQTGFTRKDIGFWCSGSSDYLAGRSFSFVSAVDAIGVIPPVNESHVEMDAAWALYEAWVKIQTGEVDTAIVYGFGKSSAGVLRRTLALQLDPYTQTPLWPDTVSLAGLQARLGLDSGLWDEAAMASVVSRSLTDAESNEYAVRRGGSSVAELLARPLYADPLRKHDCAPVTDGAAAVVLAAGDRARSASEHPAWITGIAHNVDSLQLSRDLTAAPSVRRAGQAAGLHGIETAAGVIGSAGIDVAELHAPFSHQELILRRELGLPDDVRINPSGGALAANAMFASGLIRIGEAARRVWDGTAGRVLGHATSGPLLQQNLVCVMEAGH

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
73 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
76 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
77 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
97 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
167 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
168 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
169 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
173 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
174 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
175 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
176 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
177 2643221561 Nocardioides sp. Root151 Isolate Unclassified
178 2643221576 Nocardioides sp. Root614 Isolate Unclassified
179 2643221590 Nocardioides sp. Root682 Isolate Unclassified
180 2643221604 Nocardioides sp. Root190 Isolate Unclassified
181 2643221615 Nocardioides sp. Root224 Isolate Unclassified
182 2643221617 Nocardioides sp. Root79 Isolate Unclassified
183 2643221620 Nocardioides sp. Root240 Isolate Unclassified
184 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
185 2643221696 Nocardioides sp. Root140 Isolate Unclassified
186 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
187 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
188 2738541305 Nocardioides sp. CF167 Isolate Unclassified
189 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
190 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
191 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
192 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
193 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
194 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
195 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.78
Metatranscriptomes 0.33
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.43
Nodule 0
Rhizoplane 3.95
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100005768 3300005471 Bacteria 13540
2 Ga0070658_10100493 3300005327 Bacteria 2391
3 Ga0070660_100039326 3300005339 Bacteria 3594
4 Ga0070689_100308656 3300005340 Bacteria 1319
5 Ga0070687_100097517 3300005343 Bacteria 1639
6 Ga0070668_100059163 3300005347 Bacteria 2966
7 Ga0070659_100234036 3300005366 Bacteria 1518
8 Ga0070659_100248130 3300005366 Bacteria 1475
9 Ga0070667_100033173 3300005367 Bacteria 4313
10 Ga0070709_10035798 3300005434 Bacteria 3019
11 Ga0070714_100000571 3300005435 Bacteria 26507
12 Ga0070713_100007926 3300005436 Bacteria 7499
13 Ga0070713_100231717 3300005436 Bacteria 1679
14 Ga0070710_10096180 3300005437 Bacteria 1755
15 Ga0070711_100026178 3300005439 Bacteria 3821
16 Ga0070708_100018336 3300005445 Bacteria 5857
17 Ga0070708_100122036 3300005445 Bacteria 2404
18 Ga0070706_100129482 3300005467 Bacteria 2355
19 Ga0070707_100089162 3300005468 Bacteria 2984
20 Ga0070697_100102530 3300005536 Bacteria 2378
21 Ga0070697_100155962 3300005536 Bacteria 1927
22 Ga0068855_100082782 3300005563 Bacteria 3719
23 Ga0068855_100153554 3300005563 Bacteria 2617
24 Ga0068855_100250904 3300005563 Bacteria 1974
25 Ga0070664_100090448 3300005564 Bacteria 2649
26 Ga0068856_100018423 3300005614 Bacteria 6767
27 Ga0068852_100359107 3300005616 Bacteria 1424
28 Ga0068861_100087307 3300005719 Bacteria 2454
29 Ga0068851_10106841 3300005834 Bacteria 1491
30 Ga0068863_100088990 3300005841 Bacteria 2927
31 Ga0068860_100007380 3300005843 Bacteria 10993
32 Ga0068860_100142725 3300005843 Bacteria 2303
33 Ga0068862_100088980 3300005844 Bacteria 2687
34 Ga0081540_1042029 3300005983 Bacteria 2362
35 Ga0081539_10007238 3300005985 Bacteria 10200
36 Ga0070717_10088604 3300006028 Bacteria 2609
37 Ga0070717_10104496 3300006028 Bacteria 2409
38 Ga0070717_10114786 3300006028 Bacteria 2301
39 Ga0070717_10386204 3300006028 Bacteria 1256
40 Ga0075365_10005198 3300006038 Bacteria 6999
41 Ga0075365_10010175 3300006038 Bacteria 5462
42 Ga0075365_10012599 3300006038 Bacteria 5030
43 Ga0075365_10015769 3300006038 Bacteria 4577
44 Ga0075365_10017745 3300006038 Bacteria 4362
45 Ga0075365_10030410 3300006038 Bacteria 3458
46 Ga0075365_10035463 3300006038 Bacteria 3227
47 Ga0075365_10043024 3300006038 Bacteria 2955
48 Ga0075365_10184638 3300006038 Bacteria 1458
49 Ga0075368_10004942 3300006042 Bacteria 4550
50 Ga0075368_10005649 3300006042 Bacteria 4318
51 Ga0075363_100009135 3300006048 Bacteria 4654
52 Ga0075363_100034456 3300006048 Bacteria 2643
53 Ga0075363_100053232 3300006048 Bacteria 2162
54 Ga0075363_100053468 3300006048 Bacteria 2158
55 Ga0075363_100150991 3300006048 Bacteria 1311
56 Ga0075364_10002342 3300006051 Bacteria 10640
57 Ga0075364_10046287 3300006051 Bacteria 2832
58 Ga0070716_100004494 3300006173 Bacteria 6675
59 Ga0075367_10014102 3300006178 Bacteria 4318
60 Ga0075367_10023168 3300006178 Bacteria 3490
61 Ga0075367_10084056 3300006178 Bacteria 1929
62 Ga0075370_10002455 3300006353 Bacteria 8598
63 Ga0075370_10054649 3300006353 Bacteria 2268
64 Ga0075370_10094796 3300006353 Bacteria 1723
65 Ga0075428_100004259 3300006844 Bacteria 15746
66 Ga0075428_100353603 3300006844 Bacteria 1577
67 Ga0075431_100017723 3300006847 Bacteria 7241
68 Ga0075434_100065381 3300006871 Bacteria 3622
69 Ga0105240_10285033 3300009093 Bacteria 1896
70 Ga0105245_10011053 3300009098 Bacteria 7860
71 Ga0105237_10037550 3300009545 Bacteria 4895
72 Ga0105237_10129109 3300009545 Bacteria 2522
73 Ga0105237_10174208 3300009545 Bacteria 2152
74 Ga0105239_10050216 3300010375 Bacteria 4575
75 Ga0105239_10707919 3300010375 Bacteria 1152
76 Ga0105246_10127422 3300011119 Bacteria 1896
77 Ga0157369_10026265 3300013105 Bacteria 6461
78 Ga0163163_10091986 3300014325 Bacteria 3048
79 Ga0157380_10300732 3300014326 Bacteria 1478
80 Ga0206353_11540644 3300020082 Bacteria 2942
81 Ga0207692_10074310 3300025898 Bacteria 1801
82 Ga0207642_10052048 3300025899 Bacteria 1856
83 Ga0207647_10026837 3300025904 Bacteria 3762
84 Ga0207705_10127943 3300025909 Bacteria 1889
85 Ga0207684_10092386 3300025910 Bacteria 2579
86 Ga0207671_10086497 3300025914 Bacteria 2356
87 Ga0207693_10012652 3300025915 Bacteria 6817
88 Ga0207657_10045801 3300025919 Bacteria 3835
89 Ga0207649_10121265 3300025920 Bacteria 1763
90 Ga0207687_10117154 3300025927 Bacteria 1986
91 Ga0207664_10000445 3300025929 Bacteria 29415
92 Ga0207664_10003390 3300025929 Bacteria 10605
93 Ga0207664_10045826 3300025929 Bacteria 3430
94 Ga0207690_10299222 3300025932 Bacteria 1258
95 Ga0207665_10003424 3300025939 Bacteria 10612
96 Ga0207679_10039072 3300025945 Bacteria 3386
97 Ga0207667_10124693 3300025949 Bacteria 2653
98 Ga0207667_10205824 3300025949 Bacteria 2018
99 Ga0207658_10323078 3300025986 Bacteria 1336
100 Ga0207703_10277640 3300026035 Bacteria 1520
101 Ga0207708_10238721 3300026075 Bacteria 1461
102 Ga0207702_10155518 3300026078 Bacteria 2084
103 Ga0207702_10375226 3300026078 Bacteria 1366
104 Ga0207641_10105601 3300026088 Bacteria 2488
105 Ga0209813_10000921 3300027866 Bacteria 6619
106 Ga0268265_10177474 3300028380 Bacteria 1827
107 Ga0268264_10000155 3300028381 Bacteria 156029
108 Ga0268264_10209749 3300028381 Bacteria 1787
109 Ga0307517_10129193 3300028786 Bacteria 1827
110 Ga0307515_10000192 3300028794 Bacteria 149030
111 Ga0307515_10009748 3300028794 Bacteria 18512
112 Ga0307512_10007316 3300030522 Bacteria 10969
113 Ga0316183_1213175 3300030742 Bacteria 1685
114 Ga0316181_1013979 3300030744 Bacteria 1333
115 Ga0316182_1014450 3300030745 Bacteria 7108
116 Ga0265327_10002004 3300031251 Bacteria 23019
117 Ga0307513_10011653 3300031456 Bacteria 10912
118 Ga0307513_10172097 3300031456 Bacteria 2042
119 Ga0307509_10009764 3300031507 Bacteria 11903
120 Ga0307509_10020221 3300031507 Bacteria 7560
121 Ga0307508_10004894 3300031616 Bacteria 12885
122 Ga0316576_10067578 3300031727 Bacteria 2631
123 Ga0307516_10001391 3300031730 Bacteria 33410
124 Ga0307516_10030998 3300031730 Bacteria 5393
125 Ga0307516_10095843 3300031730 Bacteria 2788
126 Ga0307413_10013380 3300031824 Bacteria 4123
127 Ga0307410_10029370 3300031852 Bacteria 3501
128 Ga0307416_100460115 3300032002 Bacteria 1327
129 Ga0307415_100041837 3300032126 Bacteria 3045
130 Ga0307415_100094448 3300032126 Bacteria 2174
131 Ga0307415_100211035 3300032126 Bacteria 1549
132 Ga0373923_0039762 3300035111 Bacteria 1933
133 Ga0373943_0140085 3300035170 Bacteria 1302
134 Ga0373942_0000065 3300035207 Bacteria 22003
135 Ga0373935_0151109 3300035692 Bacteria 1576
136 Ga0373935_0179126 3300035692 Bacteria 1454
137 Ga0395900_0317757 3300037418 Bacteria 1538
138 Ga0395905_0074569 3300037471 Bacteria 3180
139 Ga0436364_0619612 3300037853 Bacteria 6111
140 Ga0436364_1322527 3300037853 Bacteria 5160
141 Ga0395901_0019176 3300038443 Bacteria 6993
142 Ga0395901_0119615 3300038443 Bacteria 2768
143 Ga0439447_015556 3300041407 Bacteria 2109
144 Ga0451797_1117393 3300041453 Bacteria 1612
145 Ga0451837_0478931 3300041494 Bacteria 1612
146 Ga0451837_0999671 3300041494 Bacteria 3765
147 Ga0439457_032693 3300042014 Bacteria 1155
148 Ga0439434_0010707 3300042435 Bacteria 2705
149 Ga0439464_0014412 3300042439 Bacteria 2125
150 Ga0466965_0005392 3300044683 Bacteria 5764
151 Ga0466966_0011927 3300044684 Bacteria 5760
152 Ga0466966_0013439 3300044684 Bacteria 5418
153 Ga0466961_0014805 3300044693 Bacteria 5011
154 Ga0466961_0029400 3300044693 Bacteria 3533
155 Ga0466961_0053236 3300044693 Bacteria 2583
156 Ga0466961_0053493 3300044693 Bacteria 2576
157 Ga0466961_0055178 3300044693 Bacteria 2534
158 Ga0466961_0076463 3300044693 Bacteria 2122
159 Ga0466963_0004704 3300044694 Bacteria 7971
160 Ga0466963_0017433 3300044694 Bacteria 4477
161 Ga0466970_0016723 3300044765 Bacteria 3785
162 Ga0466970_0032435 3300044765 Bacteria 2760
163 Ga0466970_0058051 3300044765 Bacteria 2070
164 Ga0466957_0035432 3300044842 Bacteria 2995
165 Ga0466960_0052179 3300044901 Bacteria 1978
166 Ga0466959_0069745 3300045049 Bacteria 2546
167 Ga0466958_0006217 3300045836 Bacteria 6481
168 Ga0466958_0024258 3300045836 Bacteria 3568
169 Ga0466967_0003665 3300045976 Bacteria 10106
170 Ga0466967_0009696 3300045976 Bacteria 7166
171 Ga0466967_0030426 3300045976 Bacteria 4531
172 Ga0466967_0125294 3300045976 Bacteria 2379
173 Ga0495608_0048869 3300046511 Bacteria 2810
174 Ga0495608_0184662 3300046511 Bacteria 1318
175 Ga0495630_0198761 3300046517 Bacteria 1530
176 Ga0495632_0047334 3300046519 Bacteria 2133
177 Ga0495588_0143807 3300046674 Bacteria 1260
178 Ga0495613_0075831 3300046689 Bacteria 2448
179 Ga0495684_0036543 3300047471 Bacteria 3765
180 Ga0496102_0003889 3300048905 Bacteria 12653
181 Ga0496108_0000041 3300048911 Bacteria 147365
182 Ga0496108_0139567 3300048911 Bacteria 2088
183 Ga0496109_0318748 3300048912 Bacteria 1467
184 Ga0496110_0060406 3300048913 Bacteria 3343
185 Ga0496110_0156127 3300048913 Bacteria 2067
186 Ga0496111_0376998 3300048914 Bacteria 1049
187 Ga0496112_0214732 3300048915 Bacteria 1880
188 Ga0496114_0058698 3300048917 Bacteria 3213
189 Ga0496114_0106246 3300048917 Bacteria 2402
190 Ga0496114_0136138 3300048917 Bacteria 2124
191 Ga0496124_0027871 3300048927 Bacteria 5060
192 Ga0501031_0021530 3300049568 Bacteria 4203
193 Ga0501031_0021619 3300049568 Bacteria 4194
194 Ga0501031_0050308 3300049568 Bacteria 2715
195 Ga0501032_0027522 3300049569 Bacteria 3906
196 Ga0501032_0030637 3300049569 Bacteria 3691
197 Ga0501033_0050612 3300049570 Bacteria 3081
198 Ga0501033_0093013 3300049570 Bacteria 2205
199 Ga0501033_0106650 3300049570 Bacteria 2041
200 Ga0501034_0001361 3300049571 Bacteria 33010
201 Ga0501034_0004567 3300049571 Bacteria 15348
202 Ga0501034_0022193 3300049571 Bacteria 6468
203 Ga0501034_0035530 3300049571 Bacteria 5052
204 Ga0501036_0101376 3300049572 Bacteria 2435
205 Ga0501037_0061517 3300049573 Bacteria 2738
206 Ga0501038_0002270 3300049574 Bacteria 17874
207 Ga0501038_0042027 3300049574 Bacteria 3983
208 Ga0501038_0152852 3300049574 Bacteria 1880
209 Ga0501039_0035191 3300049575 Bacteria 3864
210 Ga0501039_0263290 3300049575 Bacteria 1355
211 Ga0501040_0090149 3300049576 Bacteria 2131
212 Ga0501042_0058506 3300049578 Bacteria 2751
213 Ga0501042_0210840 3300049578 Bacteria 1401
214 Ga0501043_0045308 3300049579 Bacteria 3459
215 Ga0501043_0200023 3300049579 Bacteria 1551
216 Ga0501046_0009886 3300049580 Bacteria 8218
217 Ga0501047_0029590 3300049581 Bacteria 5280
218 Ga0501047_0094126 3300049581 Bacteria 2875
219 Ga0501048_0000449 3300049582 Bacteria 28924
220 Ga0501067_0090534 3300049583 Bacteria 1698
221 Ga0501068_0004004 3300049584 Bacteria 8017
222 Ga0501069_0001319 3300049585 Bacteria 12153
223 Ga0501069_0090877 3300049585 Bacteria 1727
224 Ga0501069_0099297 3300049585 Bacteria 1652
225 Ga0501070_0000447 3300049586 Bacteria 37526
226 Ga0501070_0029328 3300049586 Bacteria 4615
227 Ga0501070_0040142 3300049586 Bacteria 3903
228 Ga0501070_0074325 3300049586 Bacteria 2813
229 Ga0501070_0108910 3300049586 Bacteria 2289
230 Ga0501070_0376356 3300049586 Bacteria 1150
231 Ga0501071_0001578 3300049587 Bacteria 13346
232 Ga0501071_0026235 3300049587 Bacteria 4088
233 Ga0501072_0053006 3300049588 Bacteria 3194
234 Ga0501072_0136874 3300049588 Bacteria 1952
235 Ga0501073_0007797 3300049589 Bacteria 7950
236 Ga0501074_0062365 3300049590 Bacteria 2684
237 Ga0501076_0127452 3300049592 Bacteria 2063
238 Ga0501080_0086695 3300049742 Bacteria 2909
239 Ga0501080_0151807 3300049742 Bacteria 2141
240 Ga0501080_0158204 3300049742 Bacteria 2093
241 Ga0501083_0001590 3300049744 Bacteria 15515
242 Ga0501083_0016073 3300049744 Bacteria 5241
243 Ga0501263_000711 3300049760 Bacteria 2744
244 Ga0501035_0016097 3300049822 Bacteria 6900
245 Ga0501035_0069185 3300049822 Bacteria 3130
246 Ga0501044_0304278 3300049823 Bacteria 1522
247 Ga0501045_0029945 3300049824 Bacteria 3937
248 nmdc:mga03n38_33267_c1 3300050490 Bacteria 2192
249 nmdc:mga03n38_6134_c1 3300050490 Bacteria 4153
250 nmdc:mga00v17_19721_c1 3300050491 Bacteria 3855
251 nmdc:mga00v17_45808_c1 3300050491 Bacteria 2644
252 nmdc:mga00v17_60511_c1 3300050491 Bacteria 2326
253 nmdc:mga0yw44_106902_c1 3300050492 Bacteria 1789
254 nmdc:mga0yw44_128866_c1 3300050492 Bacteria 1636
255 nmdc:mga0yw44_17312_c1 3300050492 Bacteria 3920
256 nmdc:mga0yw44_243387_c1 3300050492 Bacteria 1196
257 nmdc:mga0yw44_34903_c1 3300050492 Bacteria 2951
258 nmdc:mga0yw44_40802_c1 3300050492 Bacteria 2760
259 nmdc:mga0yw44_46031_c2 3300050492 Bacteria 1848
260 nmdc:mga0yw44_708_c1 3300050492 Bacteria 12223
261 nmdc:mga0yw44_82185_c1 3300050492 Bacteria 1407
262 nmdc:mga06z11_12318_c1 3300050494 Bacteria 3717
263 nmdc:mga06z11_13142_c1 3300050494 Bacteria 3626
264 nmdc:mga04h51_1290_c1 3300050495 Bacteria 5785
265 nmdc:mga07m45_10382_c1 3300050496 Bacteria 4863
266 nmdc:mga07m45_13828_c1 3300050496 Bacteria 4288
267 nmdc:mga07m45_50893_c1 3300050496 Bacteria 2335
268 nmdc:mga06r32_37602_c1 3300050510 Bacteria 4579
269 nmdc:mga0n895_63926_c1 3300050512 Bacteria 3639
270 Ga0500644_0000719 3300053088 Bacteria 11718
271 Ga0500651_0021167 3300053093 Bacteria 4053
272 Ga0500641_0001972 3300053096 Bacteria 7285
273 Ga0500554_004964 3300053102 Bacteria 2865
274 Ga0500556_0003509 3300053104 Bacteria 4597
275 Ga0500593_000238 3300053117 Bacteria 22609
276 Ga0500573_0015732 3300053140 Bacteria 4291
277 Ga0501084_0001216 3300054114 Bacteria 20230
278 Ga0501084_0063810 3300054114 Bacteria 3084
279 Ga0466962_0086754 3300061719 Bacteria 1499
280 2515494391 2515154088 Bacteria 5526283
281 2515719662 2515154129 Bacteria 5584369
282 2515757478 2515154137 Bacteria 5711575
283 2516083999 2515154202 Bacteria 5471270
284 2516088957 2515154203 Bacteria 5458536
285 2643825974 2643221561 Bacteria 4984412
286 2643891753 2643221576 Bacteria 5214352
287 2643960801 2643221590 Bacteria 5214697
288 2644035694 2643221604 Bacteria 5014917
289 2644089225 2643221615 Bacteria 5487866
290 2644101597 2643221617 Bacteria 5139111
291 2644115660 2643221620 Bacteria 5134593
292 2644319070 2643221657 Bacteria 5490246
293 2644531965 2643221696 Bacteria 5431823
294 2645721801 2643221961 Bacteria 3919167
295 2645724254 2643221962 Bacteria 3874254
296 2738868209 2738541305 Bacteria 4910150
297 2753265801 2751185782 Bacteria 11227053
298 2774392536 2773857762 Bacteria 5971770
299 2809196329 2808606439 Bacteria 5952208
300 2812332638 2811994874 Bacteria 5367947
301 2812351510 2811994878 Bacteria 5992952
302 2855387060 2855386786 Bacteria 4752232
303 2891970884 2891968417 Bacteria 5821697
304 Ga0070698_100005768
305 Ga0070658_10100493
306 Ga0070660_100039326
307 Ga0070689_100308656
308 Ga0070687_100097517
309 Ga0070668_100059163
310 Ga0070659_100234036
311 Ga0070659_100248130
312 Ga0070667_100033173
313 Ga0070709_10035798
314 Ga0070714_100000571
315 Ga0070713_100007926
316 Ga0070713_100231717
317 Ga0070710_10096180
318 Ga0070711_100026178
319 Ga0070708_100018336
320 Ga0070708_100122036
321 Ga0070706_100129482
322 Ga0070707_100089162
323 Ga0070697_100102530
324 Ga0070697_100155962
325 Ga0068855_100082782
326 Ga0068855_100153554
327 Ga0068855_100250904
328 Ga0070664_100090448
329 Ga0068856_100018423
330 Ga0068852_100359107
331 Ga0068861_100087307
332 Ga0068851_10106841
333 Ga0068863_100088990
334 Ga0068860_100007380
335 Ga0068860_100142725
336 Ga0068862_100088980
337 Ga0081540_1042029
338 Ga0081539_10007238
339 Ga0070717_10088604
340 Ga0070717_10104496
341 Ga0070717_10114786
342 Ga0070717_10386204
343 Ga0075365_10005198
344 Ga0075365_10010175
345 Ga0075365_10012599
346 Ga0075365_10015769
347 Ga0075365_10017745
348 Ga0075365_10030410
349 Ga0075365_10035463
350 Ga0075365_10043024
351 Ga0075365_10184638
352 Ga0075368_10004942
353 Ga0075368_10005649
354 Ga0075363_100009135
355 Ga0075363_100034456
356 Ga0075363_100053232
357 Ga0075363_100053468
358 Ga0075363_100150991
359 Ga0075364_10002342
360 Ga0075364_10046287
361 Ga0070716_100004494
362 Ga0075367_10014102
363 Ga0075367_10023168
364 Ga0075367_10084056
365 Ga0075370_10002455
366 Ga0075370_10054649
367 Ga0075370_10094796
368 Ga0075428_100004259
369 Ga0075428_100353603
370 Ga0075431_100017723
371 Ga0075434_100065381
372 Ga0105240_10285033
373 Ga0105245_10011053
374 Ga0105237_10037550
375 Ga0105237_10129109
376 Ga0105237_10174208
377 Ga0105239_10050216
378 Ga0105239_10707919
379 Ga0105246_10127422
380 Ga0157369_10026265
381 Ga0163163_10091986
382 Ga0157380_10300732
383 Ga0206353_11540644
384 Ga0207692_10074310
385 Ga0207642_10052048
386 Ga0207647_10026837
387 Ga0207705_10127943
388 Ga0207684_10092386
389 Ga0207671_10086497
390 Ga0207693_10012652
391 Ga0207657_10045801
392 Ga0207649_10121265
393 Ga0207687_10117154
394 Ga0207664_10000445
395 Ga0207664_10003390
396 Ga0207664_10045826
397 Ga0207690_10299222
398 Ga0207665_10003424
399 Ga0207679_10039072
400 Ga0207667_10124693
401 Ga0207667_10205824
402 Ga0207658_10323078
403 Ga0207703_10277640
404 Ga0207708_10238721
405 Ga0207702_10155518
406 Ga0207702_10375226
407 Ga0207641_10105601
408 Ga0209813_10000921
409 Ga0268265_10177474
410 Ga0268264_10000155
411 Ga0268264_10209749
412 Ga0307517_10129193
413 Ga0307515_10000192
414 Ga0307515_10009748
415 Ga0307512_10007316
416 Ga0316183_1213175
417 Ga0316181_1013979
418 Ga0316182_1014450
419 Ga0265327_10002004
420 Ga0307513_10011653
421 Ga0307513_10172097
422 Ga0307509_10009764
423 Ga0307509_10020221
424 Ga0307508_10004894
425 Ga0316576_10067578
426 Ga0307516_10001391
427 Ga0307516_10030998
428 Ga0307516_10095843
429 Ga0307413_10013380
430 Ga0307410_10029370
431 Ga0307416_100460115
432 Ga0307415_100041837
433 Ga0307415_100094448
434 Ga0307415_100211035
435 Ga0373923_0039762
436 Ga0373943_0140085
437 Ga0373942_0000065
438 Ga0373935_0151109
439 Ga0373935_0179126
440 Ga0395900_0317757
441 Ga0395905_0074569
442 Ga0436364_0619612
443 Ga0436364_1322527
444 Ga0395901_0019176
445 Ga0395901_0119615
446 Ga0439447_015556
447 Ga0451797_1117393
448 Ga0451837_0478931
449 Ga0451837_0999671
450 Ga0439457_032693
451 Ga0439434_0010707
452 Ga0439464_0014412
453 Ga0466965_0005392
454 Ga0466966_0011927
455 Ga0466966_0013439
456 Ga0466961_0014805
457 Ga0466961_0029400
458 Ga0466961_0053236
459 Ga0466961_0053493
460 Ga0466961_0055178
461 Ga0466961_0076463
462 Ga0466963_0004704
463 Ga0466963_0017433
464 Ga0466970_0016723
465 Ga0466970_0032435
466 Ga0466970_0058051
467 Ga0466957_0035432
468 Ga0466960_0052179
469 Ga0466959_0069745
470 Ga0466958_0006217
471 Ga0466958_0024258
472 Ga0466967_0003665
473 Ga0466967_0009696
474 Ga0466967_0030426
475 Ga0466967_0125294
476 Ga0495608_0048869
477 Ga0495608_0184662
478 Ga0495630_0198761
479 Ga0495632_0047334
480 Ga0495588_0143807
481 Ga0495613_0075831
482 Ga0495684_0036543
483 Ga0496102_0003889
484 Ga0496108_0000041
485 Ga0496108_0139567
486 Ga0496109_0318748
487 Ga0496110_0060406
488 Ga0496110_0156127
489 Ga0496111_0376998
490 Ga0496112_0214732
491 Ga0496114_0058698
492 Ga0496114_0106246
493 Ga0496114_0136138
494 Ga0496124_0027871
495 Ga0501031_0021530
496 Ga0501031_0021619
497 Ga0501031_0050308
498 Ga0501032_0027522
499 Ga0501032_0030637
500 Ga0501033_0050612
501 Ga0501033_0093013
502 Ga0501033_0106650
503 Ga0501034_0001361
504 Ga0501034_0004567
505 Ga0501034_0022193
506 Ga0501034_0035530
507 Ga0501036_0101376
508 Ga0501037_0061517
509 Ga0501038_0002270
510 Ga0501038_0042027
511 Ga0501038_0152852
512 Ga0501039_0035191
513 Ga0501039_0263290
514 Ga0501040_0090149
515 Ga0501042_0058506
516 Ga0501042_0210840
517 Ga0501043_0045308
518 Ga0501043_0200023
519 Ga0501046_0009886
520 Ga0501047_0029590
521 Ga0501047_0094126
522 Ga0501048_0000449
523 Ga0501067_0090534
524 Ga0501068_0004004
525 Ga0501069_0001319
526 Ga0501069_0090877
527 Ga0501069_0099297
528 Ga0501070_0000447
529 Ga0501070_0029328
530 Ga0501070_0040142
531 Ga0501070_0074325
532 Ga0501070_0108910
533 Ga0501070_0376356
534 Ga0501071_0001578
535 Ga0501071_0026235
536 Ga0501072_0053006
537 Ga0501072_0136874
538 Ga0501073_0007797
539 Ga0501074_0062365
540 Ga0501076_0127452
541 Ga0501080_0086695
542 Ga0501080_0151807
543 Ga0501080_0158204
544 Ga0501083_0001590
545 Ga0501083_0016073
546 Ga0501263_000711
547 Ga0501035_0016097
548 Ga0501035_0069185
549 Ga0501044_0304278
550 Ga0501045_0029945
551 nmdc:mga03n38_33267_c1
552 nmdc:mga03n38_6134_c1
553 nmdc:mga00v17_19721_c1
554 nmdc:mga00v17_45808_c1
555 nmdc:mga00v17_60511_c1
556 nmdc:mga0yw44_106902_c1
557 nmdc:mga0yw44_128866_c1
558 nmdc:mga0yw44_17312_c1
559 nmdc:mga0yw44_243387_c1
560 nmdc:mga0yw44_34903_c1
561 nmdc:mga0yw44_40802_c1
562 nmdc:mga0yw44_46031_c2
563 nmdc:mga0yw44_708_c1
564 nmdc:mga0yw44_82185_c1
565 nmdc:mga06z11_12318_c1
566 nmdc:mga06z11_13142_c1
567 nmdc:mga04h51_1290_c1
568 nmdc:mga07m45_10382_c1
569 nmdc:mga07m45_13828_c1
570 nmdc:mga07m45_50893_c1
571 nmdc:mga06r32_37602_c1
572 nmdc:mga0n895_63926_c1
573 Ga0500644_0000719
574 Ga0500651_0021167
575 Ga0500641_0001972
576 Ga0500554_004964
577 Ga0500556_0003509
578 Ga0500593_000238
579 Ga0500573_0015732
580 Ga0501084_0001216
581 Ga0501084_0063810
582 Ga0466962_0086754
583 2515494391
584 2515719662
585 2515757478
586 2516083999
587 2516088957
588 2643825974
589 2643891753
590 2643960801
591 2644035694
592 2644089225
593 2644101597
594 2644115660
595 2644319070
596 2644531965
597 2645721801
598 2645724254
599 2738868209
600 2753265801
601 2774392536
602 2809196329
603 2812332638
604 2812351510
605 2855387060
606 2891970884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.8465 4 340
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.8371 4 340
7pyt-assembly1.cif.gz_B benzoylsuccinyl-coa thiolase with coenzyme a 0.8292 2 340
4bi9-assembly2.cif.gz_C crystal structure of wild-type scp2 thiolase from trypanosoma brucei. 0.8246 5 337
7pyt-assembly1.cif.gz_B benzoylsuccinyl-coa thiolase with coenzyme a 0.8246 2 340
ID Description Score Start End Superfamily
af_O53567_3_352_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8902 4 337 3.40.47.10
af_O53567_3_352_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8725 4 337 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8357 254 339 3.40.47.10
af_I6YGD8_6_387_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8354 7 339 3.40.47.10
af_Q6P4V5_7_398_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.8345 6 337 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7V8X445-F1-model_v4 Lipid-transfer protein 0.9176 7 215 GO:0016746
AF-A0A4Z0FQ14-F1-model_v4 Lipid-transfer protein 0.9089 4 340 GO:0016747
AF-A0A829MA61-F1-model_v4 Putative lipid transfer protein 0.9055 4 340 GO:0016747
AF-A0A2E5YHJ9-F1-model_v4 Lipid-transfer protein 0.9037 4 340 GO:0016747
AF-A0A0R2PAP6-F1-model_v4 deleted 0.9021 4 340

Map