F397297

General Info

Members Datasets Scaffolds Average Seq Length
303 181 606 375

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_8842_c1|nmdc:mga09592_8842_c1_189_1391
Length 400
Sequence VPFAGGRRYNERREKLREEDAVKATVAALRTTPERVLDDYDRLFDLAAARSHLAAGATTILKDNISWHFPFPAANTTPWQLEGTVLALKARAYDDQVCVQNKTVVTDAFKGEDLNGYVPIFNRYNVPVLYNFKDEDMTWSEYRPKAKMRVLDDIYPEGILVPDFFHGKNIVHLPTVKCHIYTTTTGAMKNAFGGLLNTRRHYTHSWIHETLVDLLAIQKEIHSGLFAVMDGTTAGNGPGPRTMYPKIKNVILGSGDQVAIDAVAAKMMGFDPLTIPYIRLAHEAGLGIGDPREIEVVGDPSLAEESWGFTVGDNGASRIGDVVWFGPLKPIQNVFMRTPLVNLFILGSETYHDYYRWPLKDKRVFEAWTKKTAWGQHFLEYRKHGALAASRPAAAGSGDR

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
87 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
88 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
159 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
160 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
161 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
173 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
174 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
175 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
176 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
177 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
178 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0
Rhizoplane 1.32
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_8842_c1 3300050508 Bacteria 8194
2 rootH1_10112637 3300003323 Bacteria 12795
3 rootH1_10131358 3300003323 Bacteria 17355
4 Ga0070690_100007834 3300005330 Bacteria 6126
5 Ga0070690_100183212 3300005330 Bacteria 1448
6 Ga0068869_100028167 3300005334 Bacteria 3923
7 Ga0070680_100030617 3300005336 Bacteria 4324
8 Ga0070680_100089952 3300005336 Bacteria 2540
9 Ga0070682_100006171 3300005337 Bacteria 6714
10 Ga0070689_100012401 3300005340 Bacteria 6139
11 Ga0070692_10124947 3300005345 Bacteria 1439
12 Ga0070668_100288205 3300005347 Bacteria 1373
13 Ga0070669_100000006 3300005353 Bacteria 268982
14 Ga0070671_100000506 3300005355 Bacteria 27235
15 Ga0070671_100030003 3300005355 Bacteria 4486
16 Ga0070709_10000020 3300005434 Bacteria 135699
17 Ga0070708_100156501 3300005445 Bacteria 2122
18 Ga0070678_100045502 3300005456 Bacteria 3141
19 Ga0070681_10050931 3300005458 Bacteria 4130
20 Ga0070706_100067494 3300005467 Bacteria 3308
21 Ga0070707_100051231 3300005468 Bacteria 3958
22 Ga0070698_100166801 3300005471 Bacteria 2144
23 Ga0070679_100001251 3300005530 Bacteria 22398
24 Ga0070679_100005075 3300005530 Bacteria 12158
25 Ga0070695_100003667 3300005545 Bacteria 8947
26 Ga0070665_100000260 3300005548 Bacteria 86762
27 Ga0070665_100003503 3300005548 Bacteria 16701
28 Ga0068855_100000045 3300005563 Bacteria 147511
29 Ga0068856_100039107 3300005614 Bacteria 4657
30 Ga0068859_100006968 3300005617 Bacteria 11472
31 Ga0068859_100007929 3300005617 Bacteria 10771
32 Ga0068859_100017195 3300005617 Bacteria 7261
33 Ga0068861_100015020 3300005719 Bacteria 5448
34 Ga0068863_100090946 3300005841 Bacteria 2894
35 Ga0068858_100000715 3300005842 Bacteria 34589
36 Ga0068860_100001049 3300005843 Bacteria 30478
37 Ga0068860_100099147 3300005843 Bacteria 2779
38 Ga0068862_100000371 3300005844 Bacteria 48686
39 Ga0070717_10071294 3300006028 Bacteria 2898
40 Ga0075366_10057550 3300006195 Bacteria 2310
41 Ga0075366_10135509 3300006195 Bacteria 1487
42 Ga0097621_100138230 3300006237 Bacteria 2080
43 Ga0075428_100004313 3300006844 Bacteria 15670
44 Ga0075428_100009800 3300006844 Bacteria 10648
45 Ga0075428_100073525 3300006844 Bacteria 3734
46 Ga0075430_100010416 3300006846 Bacteria 7871
47 Ga0075434_100047098 3300006871 Bacteria 4279
48 Ga0075429_100019182 3300006880 Bacteria 5925
49 Ga0075436_100006850 3300006914 Bacteria 7793
50 Ga0097620_100006968 3300006931 Bacteria 11472
51 Ga0097620_100007929 3300006931 Bacteria 10771
52 Ga0097620_100017195 3300006931 Bacteria 7261
53 Ga0075435_100051662 3300007076 Bacteria 3311
54 Ga0075435_100196731 3300007076 Bacteria 1707
55 Ga0111539_10047645 3300009094 Bacteria 5122
56 Ga0111539_10095610 3300009094 Bacteria 3490
57 Ga0111539_10133088 3300009094 Unclassified 2911
58 Ga0111539_10133462 3300009094 Bacteria 2907
59 Ga0111539_10141109 3300009094 Bacteria 2820
60 Ga0111539_10337580 3300009094 Bacteria 1754
61 Ga0105245_10000008 3300009098 Bacteria 279925
62 Ga0105245_10002684 3300009098 Bacteria 16011
63 Ga0105245_10330662 3300009098 Bacteria 1504
64 Ga0105247_10002054 3300009101 Bacteria 13948
65 Ga0105247_10038949 3300009101 Bacteria 2903
66 Ga0114129_10168068 3300009147 Bacteria 2992
67 Ga0114129_10272795 3300009147 Bacteria 2263
68 Ga0105248_10105926 3300009177 Bacteria 3170
69 Ga0105248_10157277 3300009177 Bacteria 2564
70 Ga0105249_10070049 3300009553 Bacteria 3237
71 Ga0105239_10352727 3300010375 Bacteria 1661
72 Ga0157370_10255798 3300013104 Unclassified 1619
73 Ga0157378_10052147 3300013297 Bacteria 3639
74 Ga0157372_10143834 3300013307 Bacteria 2750
75 Ga0157375_10029673 3300013308 Bacteria 5147
76 Ga0163163_10064273 3300014325 Bacteria 3641
77 Ga0163163_10323991 3300014325 Bacteria 1595
78 Ga0157380_10022937 3300014326 Bacteria 4707
79 Ga0157380_10072516 3300014326 Bacteria 2789
80 Ga0157379_10069226 3300014968 Bacteria 3156
81 Ga0157379_10118537 3300014968 Bacteria 2381
82 Ga0157379_10334912 3300014968 Bacteria 1383
83 Ga0157376_10068040 3300014969 Bacteria 3014
84 Ga0197907_10678231 3300020069 Bacteria 1254
85 Ga0206356_10600510 3300020070 Bacteria 1335
86 Ga0213876_10000683 3300021384 Bacteria 24041
87 Ga0213875_10018599 3300021388 Bacteria 3349
88 Ga0207710_10024849 3300025900 Bacteria 2583
89 Ga0207699_10000026 3300025906 Bacteria 152387
90 Ga0207684_10053346 3300025910 Bacteria 3432
91 Ga0207684_10164584 3300025910 Bacteria 1911
92 Ga0207652_10084879 3300025921 Bacteria 2774
93 Ga0207652_10089757 3300025921 Bacteria 2699
94 Ga0207652_10092370 3300025921 Bacteria 2662
95 Ga0207646_10044587 3300025922 Bacteria 3980
96 Ga0207681_10000006 3300025923 Bacteria 496979
97 Ga0207681_10187000 3300025923 Bacteria 1582
98 Ga0207687_10000071 3300025927 Bacteria 77050
99 Ga0207644_10196506 3300025931 Bacteria 1589
100 Ga0207644_10200664 3300025931 Bacteria 1573
101 Ga0207670_10068207 3300025936 Bacteria 2450
102 Ga0207711_10018967 3300025941 Bacteria 5722
103 Ga0207689_10055861 3300025942 Bacteria 3248
104 Ga0207661_10015013 3300025944 Bacteria 5689
105 Ga0207667_10001424 3300025949 Bacteria 29960
106 Ga0207712_10097087 3300025961 Bacteria 2182
107 Ga0207668_10080914 3300025972 Bacteria 2355
108 Ga0207658_10143159 3300025986 Bacteria 1938
109 Ga0207703_10024606 3300026035 Bacteria 4736
110 Ga0207708_10058900 3300026075 Bacteria 2931
111 Ga0207702_10101412 3300026078 Bacteria 2542
112 Ga0207702_10269074 3300026078 Bacteria 1607
113 Ga0207641_10098881 3300026088 Bacteria 2566
114 Ga0207648_10309910 3300026089 Bacteria 1417
115 Ga0207675_100021250 3300026118 Bacteria 6045
116 Ga0207683_10013065 3300026121 Bacteria 7086
117 Ga0207683_10070945 3300026121 Bacteria 3078
118 Ga0207428_10082015 3300027907 Bacteria 2517
119 Ga0207428_10116913 3300027907 Bacteria 2047
120 Ga0268266_10003811 3300028379 Bacteria 14752
121 Ga0268266_10005513 3300028379 Bacteria 11779
122 Ga0268265_10000724 3300028380 Bacteria 32217
123 Ga0268264_10001105 3300028381 Bacteria 26650
124 Ga0265337_1014415 3300028556 Bacteria 2619
125 Ga0265337_1029126 3300028556 Unclassified 1653
126 Ga0265326_10001946 3300028558 Bacteria 7075
127 Ga0265319_1001574 3300028563 Bacteria 13381
128 Ga0265318_10000193 3300028577 Bacteria 53345
129 Ga0265318_10002035 3300028577 Bacteria 11164
130 Ga0265318_10017598 3300028577 Bacteria 2931
131 Ga0265323_10002478 3300028653 Bacteria 8438
132 Ga0265323_10008076 3300028653 Bacteria 4354
133 Ga0265323_10056585 3300028653 Bacteria 1375
134 Ga0265322_10002236 3300028654 Archaea 6002
135 Ga0265322_10002522 3300028654 Bacteria 5640
136 Ga0307515_10006143 3300028794 Bacteria 24147
137 Ga0265338_10065617 3300028800 Bacteria 3147
138 Ga0265338_10071814 3300028800 Bacteria 2958
139 Ga0265338_10081290 3300028800 Bacteria 2718
140 Ga0265338_10155152 3300028800 Bacteria 1774
141 Ga0265330_10000747 3300031235 Bacteria 20499
142 Ga0265330_10001057 3300031235 Bacteria 16639
143 Ga0265330_10019567 3300031235 Bacteria 3100
144 Ga0265330_10026381 3300031235 Unclassified 2628
145 Ga0265330_10029825 3300031235 Bacteria 2451
146 Ga0265330_10041559 3300031235 Bacteria 2038
147 Ga0265332_10001206 3300031238 Bacteria 14964
148 Ga0265332_10004191 3300031238 Bacteria 6826
149 Ga0265332_10011110 3300031238 Bacteria 4002
150 Ga0265332_10022639 3300031238 Bacteria 2772
151 Ga0265320_10000261 3300031240 Bacteria 43495
152 Ga0265320_10052193 3300031240 Unclassified 1981
153 Ga0265325_10003326 3300031241 Bacteria 10569
154 Ga0265329_10000662 3300031242 Bacteria 17649
155 Ga0265329_10000814 3300031242 Bacteria 15877
156 Ga0265329_10023746 3300031242 Bacteria 2040
157 Ga0265340_10002119 3300031247 Bacteria 11364
158 Ga0265339_10000222 3300031249 Bacteria 46203
159 Ga0265339_10005277 3300031249 Bacteria 8619
160 Ga0265339_10007006 3300031249 Bacteria 7325
161 Ga0265339_10024647 3300031249 Bacteria 3463
162 Ga0265331_10004288 3300031250 Bacteria 8934
163 Ga0265331_10017595 3300031250 Bacteria 3722
164 Ga0265316_10000065 3300031344 Bacteria 111353
165 Ga0265316_10000255 3300031344 Bacteria 60839
166 Ga0265316_10000313 3300031344 Bacteria 53907
167 Ga0265316_10001071 3300031344 Bacteria 29569
168 Ga0265316_10004542 3300031344 Bacteria 13795
169 Ga0265316_10004556 3300031344 Bacteria 13767
170 Ga0265316_10027962 3300031344 Bacteria 4658
171 Ga0265316_10037492 3300031344 Unclassified 3911
172 Ga0307513_10011307 3300031456 Bacteria 11102
173 Ga0307509_10000065 3300031507 Bacteria 142674
174 Ga0307509_10016021 3300031507 Bacteria 8698
175 Ga0307509_10019199 3300031507 Bacteria 7811
176 Ga0307509_10064129 3300031507 Bacteria 3866
177 Ga0265313_10000342 3300031595 Bacteria 50604
178 Ga0265313_10000488 3300031595 Bacteria 41776
179 Ga0307508_10002364 3300031616 Bacteria 19955
180 Ga0316579_10041760 3300031691 Bacteria 2129
181 Ga0265314_10000003 3300031711 Bacteria 1653386
182 Ga0265314_10001287 3300031711 Bacteria 28479
183 Ga0265314_10008674 3300031711 Bacteria 8694
184 Ga0265314_10031616 3300031711 Bacteria 3904
185 Ga0265314_10065301 3300031711 Unclassified 2458
186 Ga0265342_10000583 3300031712 Bacteria 38453
187 Ga0265342_10002145 3300031712 Bacteria 17398
188 Ga0265342_10004827 3300031712 Bacteria 10454
189 Ga0265342_10011835 3300031712 Bacteria 5942
190 Ga0265342_10030359 3300031712 Bacteria 3349
191 Ga0265342_10038962 3300031712 Bacteria 2891
192 Ga0316576_10000691 3300031727 Bacteria 16566
193 Ga0316576_10003450 3300031727 Bacteria 9262
194 Ga0316576_10073201 3300031727 Bacteria 2531
195 Ga0316576_10195854 3300031727 Bacteria 1523
196 Ga0316576_10200192 3300031727 Bacteria 1505
197 Ga0316578_10003315 3300031728 Bacteria 7336
198 Ga0307516_10049404 3300031730 Bacteria 4134
199 Ga0316577_10016390 3300031733 Unclassified 4083
200 Ga0316577_10023892 3300031733 Bacteria 3394
201 Ga0307507_10135381 3300033179 Bacteria 1911
202 Ga0373949_0000251 3300035090 Bacteria 20226
203 Ga0373961_0000072 3300035241 Bacteria 54778
204 Ga0373931_0226789 3300035691 Bacteria 1127
205 Ga0373935_0186091 3300035692 Bacteria 1428
206 Ga0373937_0021821 3300036401 Bacteria 5749
207 Ga0373937_0198243 3300036401 Bacteria 1887
208 Ga0316582_0055272 3300036647 Bacteria 2530
209 Ga0316582_0077963 3300036647 Bacteria 2158
210 Ga0316584_0000280 3300036712 Bacteria 26062
211 Ga0316584_0015211 3300036712 Bacteria 5499
212 Ga0316584_0208653 3300036712 Bacteria 1439
213 Ga0395899_0016604 3300037312 Bacteria 5616
214 Ga0316581_0018361 3300037588 Unclassified 2031
215 Ga0436364_0663266 3300037853 Bacteria 10059
216 Ga0436364_0774524 3300037853 Bacteria 1854
217 Ga0436364_1337271 3300037853 Bacteria 5987
218 Ga0400483_236232 3300039062 Bacteria 2395
219 Ga0436365_0115620 3300039437 Bacteria 14590
220 Ga0436365_0139158 3300039437 Bacteria 50885
221 Ga0436365_1054018 3300039437 Bacteria 2184
222 Ga0436365_1392300 3300039437 Bacteria 5171
223 Ga0436365_1430806 3300039437 Bacteria 4851
224 Ga0451797_0630769 3300041453 Bacteria 2114
225 Ga0451843_1266889 3300041509 Bacteria 1581
226 Ga0451577_0000350 3300042876 Bacteria 85984
227 Ga0451577_0000448 3300042876 Bacteria 72373
228 Ga0451577_0006808 3300042876 Bacteria 11328
229 Ga0451577_0040390 3300042876 Bacteria 4188
230 Ga0451577_0106886 3300042876 Unclassified 2501
231 Ga0453683_0000646 3300044673 Bacteria 37564
232 Ga0453684_0000696 3300044712 Bacteria 119520
233 Ga0453684_0000705 3300044712 Bacteria 118689
234 Ga0453684_0015863 3300044712 Bacteria 11843
235 Ga0453684_0028102 3300044712 Bacteria 8041
236 Ga0453684_0033545 3300044712 Bacteria 7154
237 Ga0453684_0094938 3300044712 Bacteria 3667
238 Ga0453684_0129612 3300044712 Unclassified 3028
239 Ga0453684_0156522 3300044712 Unclassified 2701
240 Ga0466959_0127884 3300045049 Bacteria 1802
241 Ga0451576_0007807 3300045051 Bacteria 12687
242 Ga0451576_0009913 3300045051 Bacteria 11000
243 Ga0451576_0247139 3300045051 Bacteria 1864
244 Ga0451576_0248671 3300045051 Bacteria 1858
245 Ga0495629_0000095 3300046459 Bacteria 76904
246 Ga0495650_0069378 3300046471 Bacteria 1387
247 Ga0495639_0040205 3300046475 Bacteria 2103
248 Ga0495639_0091392 3300046475 Bacteria 1428
249 Ga0495630_0000001 3300046517 Bacteria 1687293
250 Ga0495586_0033634 3300046535 Bacteria 2752
251 Ga0495645_0099082 3300046543 Bacteria 2074
252 Ga0495634_0018493 3300046642 Bacteria 4962
253 Ga0495635_0018955 3300046663 Bacteria 4803
254 Ga0495657_0047421 3300046675 Bacteria 2905
255 Ga0495647_0020888 3300046681 Bacteria 2354
256 Ga0495647_0034619 3300046681 Bacteria 1892
257 Ga0495658_0000199 3300046683 Bacteria 34813
258 Ga0495658_0018970 3300046683 Bacteria 3585
259 Ga0495581_0001666 3300047315 Bacteria 12369
260 Ga0495680_0022497 3300047322 Bacteria 5251
261 Ga0495614_0018930 3300048089 Bacteria 2981
262 Ga0496111_0169707 3300048914 Bacteria 1621
263 Ga0496112_0261577 3300048915 Bacteria 1680
264 Ga0496114_0000005 3300048917 Bacteria 564262
265 Ga0501299_015324 3300049522 Bacteria 1345
266 Ga0501068_0055363 3300049584 Bacteria 2403
267 Ga0501069_0020642 3300049585 Bacteria 3570
268 Ga0501070_0032240 3300049586 Bacteria 4385
269 Ga0501070_0119787 3300049586 Bacteria 2175
270 Ga0501070_0285224 3300049586 Bacteria 1347
271 Ga0501071_0076842 3300049587 Unclassified 2439
272 Ga0501073_0192895 3300049589 Bacteria 1410
273 Ga0501075_0241831 3300049591 Bacteria 1376
274 Ga0501216_004036 3300049660 Bacteria 2165
275 Ga0501227_003329 3300049665 Bacteria 3485
276 Ga0501230_000231 3300049667 Bacteria 5008
277 Ga0501236_001495 3300049670 Bacteria 2655
278 Ga0501225_0011632 3300049705 Bacteria 2475
279 Ga0501083_0001073 3300049744 Bacteria 18253
280 Ga0501044_0055030 3300049823 Bacteria 4087
281 nmdc:mga0qj67_15337_c1 3300050509 Bacteria 5803
282 nmdc:mga06r32_139551_c1 3300050510 Bacteria 2399
283 nmdc:mga06r32_823_c1 3300050510 Bacteria 27485
284 nmdc:mga08y16_10982_c1 3300050511 Bacteria 9508
285 nmdc:mga08y16_111831_c1 3300050511 Bacteria 2843
286 nmdc:mga08y16_55551_c1 3300050511 Bacteria 4137
287 nmdc:mga08y16_5705_c1 3300050511 Bacteria 13044
288 nmdc:mga08y16_74390_c1 3300050511 Bacteria 3540
289 nmdc:mga0n895_16217_c1 3300050512 Bacteria 6830
290 nmdc:mga0n895_44219_c1 3300050512 Bacteria 4343
291 nmdc:mga0rr50_34785_c1 3300050513 Bacteria 3611
292 nmdc:mga08x19_5508_c1 3300050514 Bacteria 7489
293 Ga0495619_0001281 3300053085 Bacteria 16499
294 Ga0500554_025600 3300053102 Bacteria 1686
295 Ga0500572_003413 3300053111 Bacteria 3646
296 Ga0500595_000222 3300053119 Bacteria 38935
297 Ga0500614_000228 3300053123 Bacteria 14619
298 Ga0500642_0017638 3300053130 Bacteria 2742
299 Ga0500559_0002974 3300053136 Bacteria 8519
300 Ga0500603_009230 3300053150 Bacteria 2202
301 Ga0500622_0027839 3300053156 Bacteria 2978
302 Ga0500638_085694 3300053162 Bacteria 1491
303 Ga0501084_0171132 3300054114 Bacteria 1833
304 nmdc:mga09592_8842_c1
305 rootH1_10112637
306 rootH1_10131358
307 Ga0070690_100007834
308 Ga0070690_100183212
309 Ga0068869_100028167
310 Ga0070680_100030617
311 Ga0070680_100089952
312 Ga0070682_100006171
313 Ga0070689_100012401
314 Ga0070692_10124947
315 Ga0070668_100288205
316 Ga0070669_100000006
317 Ga0070671_100000506
318 Ga0070671_100030003
319 Ga0070709_10000020
320 Ga0070708_100156501
321 Ga0070678_100045502
322 Ga0070681_10050931
323 Ga0070706_100067494
324 Ga0070707_100051231
325 Ga0070698_100166801
326 Ga0070679_100001251
327 Ga0070679_100005075
328 Ga0070695_100003667
329 Ga0070665_100000260
330 Ga0070665_100003503
331 Ga0068855_100000045
332 Ga0068856_100039107
333 Ga0068859_100006968
334 Ga0068859_100007929
335 Ga0068859_100017195
336 Ga0068861_100015020
337 Ga0068863_100090946
338 Ga0068858_100000715
339 Ga0068860_100001049
340 Ga0068860_100099147
341 Ga0068862_100000371
342 Ga0070717_10071294
343 Ga0075366_10057550
344 Ga0075366_10135509
345 Ga0097621_100138230
346 Ga0075428_100004313
347 Ga0075428_100009800
348 Ga0075428_100073525
349 Ga0075430_100010416
350 Ga0075434_100047098
351 Ga0075429_100019182
352 Ga0075436_100006850
353 Ga0097620_100006968
354 Ga0097620_100007929
355 Ga0097620_100017195
356 Ga0075435_100051662
357 Ga0075435_100196731
358 Ga0111539_10047645
359 Ga0111539_10095610
360 Ga0111539_10133088
361 Ga0111539_10133462
362 Ga0111539_10141109
363 Ga0111539_10337580
364 Ga0105245_10000008
365 Ga0105245_10002684
366 Ga0105245_10330662
367 Ga0105247_10002054
368 Ga0105247_10038949
369 Ga0114129_10168068
370 Ga0114129_10272795
371 Ga0105248_10105926
372 Ga0105248_10157277
373 Ga0105249_10070049
374 Ga0105239_10352727
375 Ga0157370_10255798
376 Ga0157378_10052147
377 Ga0157372_10143834
378 Ga0157375_10029673
379 Ga0163163_10064273
380 Ga0163163_10323991
381 Ga0157380_10022937
382 Ga0157380_10072516
383 Ga0157379_10069226
384 Ga0157379_10118537
385 Ga0157379_10334912
386 Ga0157376_10068040
387 Ga0197907_10678231
388 Ga0206356_10600510
389 Ga0213876_10000683
390 Ga0213875_10018599
391 Ga0207710_10024849
392 Ga0207699_10000026
393 Ga0207684_10053346
394 Ga0207684_10164584
395 Ga0207652_10084879
396 Ga0207652_10089757
397 Ga0207652_10092370
398 Ga0207646_10044587
399 Ga0207681_10000006
400 Ga0207681_10187000
401 Ga0207687_10000071
402 Ga0207644_10196506
403 Ga0207644_10200664
404 Ga0207670_10068207
405 Ga0207711_10018967
406 Ga0207689_10055861
407 Ga0207661_10015013
408 Ga0207667_10001424
409 Ga0207712_10097087
410 Ga0207668_10080914
411 Ga0207658_10143159
412 Ga0207703_10024606
413 Ga0207708_10058900
414 Ga0207702_10101412
415 Ga0207702_10269074
416 Ga0207641_10098881
417 Ga0207648_10309910
418 Ga0207675_100021250
419 Ga0207683_10013065
420 Ga0207683_10070945
421 Ga0207428_10082015
422 Ga0207428_10116913
423 Ga0268266_10003811
424 Ga0268266_10005513
425 Ga0268265_10000724
426 Ga0268264_10001105
427 Ga0265337_1014415
428 Ga0265337_1029126
429 Ga0265326_10001946
430 Ga0265319_1001574
431 Ga0265318_10000193
432 Ga0265318_10002035
433 Ga0265318_10017598
434 Ga0265323_10002478
435 Ga0265323_10008076
436 Ga0265323_10056585
437 Ga0265322_10002236
438 Ga0265322_10002522
439 Ga0307515_10006143
440 Ga0265338_10065617
441 Ga0265338_10071814
442 Ga0265338_10081290
443 Ga0265338_10155152
444 Ga0265330_10000747
445 Ga0265330_10001057
446 Ga0265330_10019567
447 Ga0265330_10026381
448 Ga0265330_10029825
449 Ga0265330_10041559
450 Ga0265332_10001206
451 Ga0265332_10004191
452 Ga0265332_10011110
453 Ga0265332_10022639
454 Ga0265320_10000261
455 Ga0265320_10052193
456 Ga0265325_10003326
457 Ga0265329_10000662
458 Ga0265329_10000814
459 Ga0265329_10023746
460 Ga0265340_10002119
461 Ga0265339_10000222
462 Ga0265339_10005277
463 Ga0265339_10007006
464 Ga0265339_10024647
465 Ga0265331_10004288
466 Ga0265331_10017595
467 Ga0265316_10000065
468 Ga0265316_10000255
469 Ga0265316_10000313
470 Ga0265316_10001071
471 Ga0265316_10004542
472 Ga0265316_10004556
473 Ga0265316_10027962
474 Ga0265316_10037492
475 Ga0307513_10011307
476 Ga0307509_10000065
477 Ga0307509_10016021
478 Ga0307509_10019199
479 Ga0307509_10064129
480 Ga0265313_10000342
481 Ga0265313_10000488
482 Ga0307508_10002364
483 Ga0316579_10041760
484 Ga0265314_10000003
485 Ga0265314_10001287
486 Ga0265314_10008674
487 Ga0265314_10031616
488 Ga0265314_10065301
489 Ga0265342_10000583
490 Ga0265342_10002145
491 Ga0265342_10004827
492 Ga0265342_10011835
493 Ga0265342_10030359
494 Ga0265342_10038962
495 Ga0316576_10000691
496 Ga0316576_10003450
497 Ga0316576_10073201
498 Ga0316576_10195854
499 Ga0316576_10200192
500 Ga0316578_10003315
501 Ga0307516_10049404
502 Ga0316577_10016390
503 Ga0316577_10023892
504 Ga0307507_10135381
505 Ga0373949_0000251
506 Ga0373961_0000072
507 Ga0373931_0226789
508 Ga0373935_0186091
509 Ga0373937_0021821
510 Ga0373937_0198243
511 Ga0316582_0055272
512 Ga0316582_0077963
513 Ga0316584_0000280
514 Ga0316584_0015211
515 Ga0316584_0208653
516 Ga0395899_0016604
517 Ga0316581_0018361
518 Ga0436364_0663266
519 Ga0436364_0774524
520 Ga0436364_1337271
521 Ga0400483_236232
522 Ga0436365_0115620
523 Ga0436365_0139158
524 Ga0436365_1054018
525 Ga0436365_1392300
526 Ga0436365_1430806
527 Ga0451797_0630769
528 Ga0451843_1266889
529 Ga0451577_0000350
530 Ga0451577_0000448
531 Ga0451577_0006808
532 Ga0451577_0040390
533 Ga0451577_0106886
534 Ga0453683_0000646
535 Ga0453684_0000696
536 Ga0453684_0000705
537 Ga0453684_0015863
538 Ga0453684_0028102
539 Ga0453684_0033545
540 Ga0453684_0094938
541 Ga0453684_0129612
542 Ga0453684_0156522
543 Ga0466959_0127884
544 Ga0451576_0007807
545 Ga0451576_0009913
546 Ga0451576_0247139
547 Ga0451576_0248671
548 Ga0495629_0000095
549 Ga0495650_0069378
550 Ga0495639_0040205
551 Ga0495639_0091392
552 Ga0495630_0000001
553 Ga0495586_0033634
554 Ga0495645_0099082
555 Ga0495634_0018493
556 Ga0495635_0018955
557 Ga0495657_0047421
558 Ga0495647_0020888
559 Ga0495647_0034619
560 Ga0495658_0000199
561 Ga0495658_0018970
562 Ga0495581_0001666
563 Ga0495680_0022497
564 Ga0495614_0018930
565 Ga0496111_0169707
566 Ga0496112_0261577
567 Ga0496114_0000005
568 Ga0501299_015324
569 Ga0501068_0055363
570 Ga0501069_0020642
571 Ga0501070_0032240
572 Ga0501070_0119787
573 Ga0501070_0285224
574 Ga0501071_0076842
575 Ga0501073_0192895
576 Ga0501075_0241831
577 Ga0501216_004036
578 Ga0501227_003329
579 Ga0501230_000231
580 Ga0501236_001495
581 Ga0501225_0011632
582 Ga0501083_0001073
583 Ga0501044_0055030
584 nmdc:mga0qj67_15337_c1
585 nmdc:mga06r32_139551_c1
586 nmdc:mga06r32_823_c1
587 nmdc:mga08y16_10982_c1
588 nmdc:mga08y16_111831_c1
589 nmdc:mga08y16_55551_c1
590 nmdc:mga08y16_5705_c1
591 nmdc:mga08y16_74390_c1
592 nmdc:mga0n895_16217_c1
593 nmdc:mga0n895_44219_c1
594 nmdc:mga0rr50_34785_c1
595 nmdc:mga08x19_5508_c1
596 Ga0495619_0001281
597 Ga0500554_025600
598 Ga0500572_003413
599 Ga0500595_000222
600 Ga0500614_000228
601 Ga0500642_0017638
602 Ga0500559_0002974
603 Ga0500603_009230
604 Ga0500622_0027839
605 Ga0500638_085694
606 Ga0501084_0171132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04015

DUF362

Domain of unknown function (DUF362)

59

266

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gha-assembly1.cif.gz_B sulfur transferase ttua in complex with sulfur carrier ttub 0.64 13 110
5gha-assembly2.cif.gz_D sulfur transferase ttua in complex with sulfur carrier ttub 0.6305 13 110
5b4f-assembly1.cif.gz_A-2 sulfur transferase ttua in complex with iron sulfur cluster 0.6151 13 110
3a2k-assembly2.cif.gz_B crystal structure of tils complexed with trna 0.6124 17 110
5fkv-assembly1.cif.gz_A cryo-em structure of the e. coli replicative dna polymerase complex bound to dna (dna polymerase iii alpha, beta, epsilon, tau complex) 0.61 61 110
ID Description Score Start End Superfamily
3a2kB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6124 17 110 3.40.50.620
af_C0PDM3_77_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6037 16 79 3.40.50.150
af_C6TAN4_30_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6034 57 110 3.40.50.300
af_Q2FZ63_56_217_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5908 36 110 3.40.50.300
1xnhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.5819 14 110 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A535YQ46-F1-model_v4 DUF362 domain-containing protein 0.9889 10 107
AF-A0A523WR56-F1-model_v4 DUF362 domain-containing protein 0.9818 1 154
AF-A0A7V0T5M8-F1-model_v4 DUF362 domain-containing protein 0.9817 1 364
AF-A0A7X5W2L4-F1-model_v4 deleted 0.9811 1 360
AF-A0A7C3YDZ1-F1-model_v4 DUF362 domain-containing protein 0.9811 31 360

Map