F397291

General Info

Members Datasets Scaffolds Average Seq Length
303 237 244 386

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0005326|Ga0501035_0005326_3979_5181
Length 400
Sequence MKAVAKRRRIMSFDKAEPQPKRRPKLKLPYDQTVLVMQGGGALGAYQAGAYEVLHEGGVEPDWIAGISIGAINAAIIAGNAPEDRVPALRAFWQEIATTIPGDLLAGQHAHTDFNFRQFSGWLSLIAGAKGFFRPWFLXXXXNPPGTPEATSFYDTAPLRETLLRHVDFDRINKGSLRLSLGAVQVRTGNFVYFDTHEPERVIGPEHVMASAALPPGFPAVYVDGEPYWDGGLVSNTPLSYVLDAGVAKDTLVFQIDLFSAVGPMPQTMDEVQERIKDITYSSRTRLNTDAFLEKYRLRHAIRALAQYVPEDALERLCDQSLPADVYDGRVSLVHIINRSNRREIQSKDFEFWRVSLDEHWRDGMRDARTAMEADSWREFSDPETGLAVYDYMRTDTRDD

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
7 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
12 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
13 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
14 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
15 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
18 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
19 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
20 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
21 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
22 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
23 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
24 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
25 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
26 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
27 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
28 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
29 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
30 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
31 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
32 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
33 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
34 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
35 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
36 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
37 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
38 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
39 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
40 2904699407
41 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
42 2906610324
43 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
44 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
45 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
46 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
47 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
48 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
49 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
50 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
51 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
52 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
53 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
54 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
55 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
81 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
110 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
111 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
217 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
222 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
235 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
236 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
237 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.06
Metatranscriptomes 0
Isolates 18.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.12
Nodule 13.2
Rhizoplane 1.65
Rhizosphere 46.86
Stem 0
Stem Tuber 0
Unclassified 17.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10015149 3300003187 Bacteria 3413
2 JGI25406J46586_10024760 3300003203 Bacteria 2345
3 JGI25153J46596_10000956 3300003215 Bacteria 17526
4 rootH2_10053927 3300003320 Bacteria 2884
5 rootH2_10053929 3300003320 Bacteria 3572
6 rootH1_10183404 3300003323 Bacteria 4830
7 JGI25404J52841_10001056 3300003659 Bacteria 4594
8 JGI25404J52841_10001679 3300003659 Bacteria 3981
9 Ga0070709_10007258 3300005434 Bacteria 6074
10 Ga0070710_10006103 3300005437 Bacteria 5765
11 Ga0070708_100062021 3300005445 Bacteria 3341
12 Ga0070708_100282131 3300005445 Bacteria 1563
13 Ga0070707_100259873 3300005468 Bacteria 1689
14 Ga0070697_100019391 3300005536 Bacteria 5373
15 Ga0070665_100005784 3300005548 Bacteria 12687
16 Ga0068856_100249760 3300005614 Bacteria 1789
17 Ga0081455_10000257 3300005937 Bacteria 69896
18 Ga0081455_10013857 3300005937 Bacteria 7929
19 Ga0081455_10027984 3300005937 Bacteria 5156
20 Ga0081455_10029417 3300005937 Bacteria 5009
21 Ga0081455_10045454 3300005937 Bacteria 3820
22 Ga0081455_10082628 3300005937 Bacteria 2627
23 Ga0081538_10027264 3300005981 Bacteria 3966
24 Ga0081540_1000022 3300005983 Bacteria 161205
25 Ga0081540_1000544 3300005983 Bacteria 36521
26 Ga0081540_1000731 3300005983 Bacteria 30244
27 Ga0081540_1002537 3300005983 Bacteria 14812
28 Ga0081540_1003164 3300005983 Bacteria 13135
29 Ga0081540_1005764 3300005983 Bacteria 9169
30 Ga0081540_1006159 3300005983 Bacteria 8798
31 Ga0081540_1027170 3300005983 Bacteria 3248
32 Ga0081540_1071198 3300005983 Bacteria 1608
33 Ga0081539_10000979 3300005985 Bacteria 53212
34 Ga0081539_10001065 3300005985 Bacteria 50187
35 Ga0075365_10069065 3300006038 Bacteria 2375
36 Ga0075363_100026566 3300006048 Bacteria 2963
37 Ga0075363_100034002 3300006048 Bacteria 2659
38 Ga0070712_100068059 3300006175 Bacteria 2536
39 Ga0070712_100095895 3300006175 Bacteria 2183
40 Ga0075367_10000751 3300006178 Bacteria 12637
41 Ga0075367_10015776 3300006178 Bacteria 4115
42 Ga0075366_10058656 3300006195 Bacteria 2287
43 Ga0075430_100000274 3300006846 Bacteria 36446
44 Ga0075434_100112487 3300006871 Bacteria 2734
45 Ga0099824_1002487 3300006942 Bacteria 26950
46 Ga0099822_1001480 3300006943 Bacteria 27484
47 Ga0099794_10093384 3300007265 Bacteria 1495
48 Ga0105240_10003081 3300009093 Bacteria 26205
49 Ga0105240_10089647 3300009093 Bacteria 3761
50 Ga0105240_10214055 3300009093 Bacteria 2249
51 Ga0105248_10077818 3300009177 Bacteria 3729
52 Ga0105237_10152003 3300009545 Bacteria 2311
53 Ga0105239_10015992 3300010375 Bacteria 8304
54 Ga0105239_10203755 3300010375 Bacteria 2217
55 Ga0157370_10043754 3300013104 Bacteria 4308
56 Ga0157378_10013052 3300013297 Bacteria 7266
57 Ga0157379_10030359 3300014968 Bacteria 4811
58 Ga0183365_10001 3300015684 Bacteria 2090444
59 Ga0213872_10054285 3300021361 Bacteria 1817
60 Ga0213871_10000629 3300021441 Bacteria 5034
61 Ga0209148_1000537 3300025254 Bacteria 36806
62 Ga0209455_1002053 3300025272 Bacteria 8145
63 Ga0209025_1000741 3300025294 Bacteria 55042
64 Ga0209758_1000063 3300025297 Bacteria 315999
65 Ga0209758_1013645 3300025297 Bacteria 4405
66 Ga0209758_1024417 3300025297 Bacteria 2694
67 Ga0209050_1006440 3300025298 Bacteria 6946
68 Ga0209256_1001176 3300025299 Bacteria 29433
69 Ga0209257_1000334 3300025304 Bacteria 98054
70 Ga0207699_10009741 3300025906 Bacteria 4796
71 Ga0207684_10106338 3300025910 Bacteria 2400
72 Ga0207695_10050292 3300025913 Bacteria 4386
73 Ga0207671_10093862 3300025914 Bacteria 2264
74 Ga0207693_10055598 3300025915 Bacteria 3105
75 Ga0207663_10017868 3300025916 Bacteria 3961
76 Ga0207700_10135774 3300025928 Bacteria 2015
77 Ga0207702_10171662 3300026078 Bacteria 1989
78 Ga0207674_10047170 3300026116 Bacteria 4419
79 Ga0209589_1000001 3300027357 Bacteria 794224
80 Ga0209489_100001 3300027361 Bacteria 794224
81 Ga0209700_100001 3300027363 Bacteria 794224
82 Ga0268266_10001895 3300028379 Bacteria 23574
83 Ga0268266_10054214 3300028379 Bacteria 3445
84 Ga0307515_10054386 3300028794 Bacteria 5878
85 Ga0307513_10041965 3300031456 Bacteria 5043
86 Ga0265314_10007230 3300031711 Bacteria 9652
87 Ga0307516_10015472 3300031730 Bacteria 8025
88 Ga0307406_10030481 3300031901 Bacteria 3276
89 Ga0307510_10185681 3300033180 Bacteria 1635
90 Ga0315911_1000006 3300033442 Bacteria 414563
91 Ga0373943_0085567 3300035170 Bacteria 1624
92 Ga0373955_0039126 3300035172 Bacteria 2530
93 Ga0373927_0036495 3300035695 Bacteria 3196
94 Ga0373937_0002003 3300036401 Bacteria 17035
95 Ga0395905_0000507 3300037471 Bacteria 53414
96 Ga0436364_0721387 3300037853 Bacteria 1410
97 Ga0395901_0142980 3300038443 Bacteria 2515
98 Ga0436365_0862796 3300039437 Bacteria 5828
99 Ga0436365_0888520 3300039437 Bacteria 2524
100 Ga0436360_0172085 3300039438 Bacteria 5059
101 Ga0436361_0615246 3300039447 Bacteria 8991
102 Ga0466969_0010998 3300044656 Bacteria 4791
103 Ga0466966_0001487 3300044684 Bacteria 15041
104 Ga0466961_0022570 3300044693 Bacteria 4048
105 Ga0466963_0097379 3300044694 Bacteria 2010
106 Ga0466957_0026325 3300044842 Bacteria 3450
107 Ga0466959_0000130 3300045049 Bacteria 48736
108 Ga0451576_0273785 3300045051 Bacteria 1765
109 Ga0495592_0006749 3300046454 Bacteria 8558
110 Ga0495629_0024994 3300046459 Bacteria 4249
111 Ga0495638_0034361 3300046460 Bacteria 3237
112 Ga0495638_0038549 3300046460 Bacteria 3036
113 Ga0495651_0000265 3300046462 Bacteria 40572
114 Ga0495608_0000435 3300046511 Bacteria 29113
115 Ga0495610_0051448 3300046512 Bacteria 2004
116 Ga0495618_0002103 3300046514 Bacteria 13044
117 Ga0495620_0008241 3300046515 Bacteria 5605
118 Ga0495630_0127914 3300046517 Bacteria 1928
119 Ga0495652_0001766 3300046529 Bacteria 23183
120 Ga0495667_0046658 3300046559 Bacteria 2864
121 Ga0495635_0120666 3300046663 Bacteria 1788
122 Ga0495599_0016230 3300046678 Bacteria 4623
123 Ga0495623_0031932 3300046679 Bacteria 3385
124 Ga0495646_0027761 3300046680 Bacteria 3548
125 Ga0495658_0052874 3300046683 Bacteria 2305
126 Ga0495660_0037703 3300046810 Bacteria 2692
127 Ga0495604_0000118 3300047317 Bacteria 66698
128 Ga0495674_0002109 3300047319 Bacteria 19517
129 Ga0495672_0015702 3300047320 Bacteria 5130
130 Ga0495672_0041110 3300047320 Bacteria 2799
131 Ga0495680_0002679 3300047322 Bacteria 17978
132 Ga0495675_0038611 3300047444 Bacteria 3040
133 Ga0495686_0024492 3300047472 Bacteria 3964
134 Ga0495602_0076591 3300048088 Bacteria 2833
135 Ga0496105_0016638 3300048908 Bacteria 5872
136 Ga0496109_0166659 3300048912 Bacteria 2066
137 Ga0496114_0033255 3300048917 Bacteria 4248
138 Ga0496116_0001246 3300048919 Bacteria 29566
139 Ga0496118_0008413 3300048921 Bacteria 10670
140 Ga0496118_0095536 3300048921 Bacteria 2028
141 Ga0496121_0007261 3300048924 Bacteria 13411
142 Ga0496121_0011114 3300048924 Bacteria 10045
143 Ga0496121_0044067 3300048924 Bacteria 3855
144 Ga0496121_0054018 3300048924 Bacteria 3361
145 Ga0496122_0053700 3300048925 Bacteria 3034
146 Ga0496122_0059657 3300048925 Bacteria 2815
147 Ga0496123_0142631 3300048926 Bacteria 1307
148 Ga0496125_0002221 3300048928 Bacteria 25866
149 Ga0496125_0018095 3300048928 Bacteria 6697
150 Ga0496126_0001652 3300048929 Bacteria 33559
151 Ga0496126_0011734 3300048929 Bacteria 9026
152 Ga0496126_0112336 3300048929 Bacteria 2372
153 Ga0496126_0136984 3300048929 Bacteria 2111
154 Ga0496126_0245572 3300048929 Bacteria 1493
155 Ga0496126_0277746 3300048929 Bacteria 1388
156 Ga0501034_0067872 3300049571 Bacteria 3578
157 Ga0501034_0077820 3300049571 Bacteria 3322
158 Ga0501036_0294977 3300049572 Bacteria 1356
159 Ga0501038_0151545 3300049574 Bacteria 1890
160 Ga0501038_0283425 3300049574 Bacteria 1304
161 Ga0501046_0046706 3300049580 Bacteria 3435
162 Ga0501047_0012850 3300049581 Bacteria 7933
163 Ga0501047_0093127 3300049581 Bacteria 2892
164 Ga0501047_0116560 3300049581 Bacteria 2553
165 Ga0501067_0093524 3300049583 Bacteria 1669
166 Ga0501068_0062367 3300049584 Bacteria 2267
167 Ga0501070_0014522 3300049586 Bacteria 6626
168 Ga0501070_0190082 3300049586 Bacteria 1688
169 Ga0501072_0227389 3300049588 Bacteria 1486
170 Ga0501073_0110998 3300049589 Bacteria 1902
171 Ga0501076_0114004 3300049592 Bacteria 2187
172 Ga0501077_0051462 3300049593 Bacteria 2617
173 Ga0501077_0122718 3300049593 Bacteria 1647
174 Ga0501079_0156000 3300049741 Bacteria 1779
175 Ga0501080_0018253 3300049742 Bacteria 6492
176 Ga0501080_0061555 3300049742 Bacteria 3494
177 Ga0501081_0018046 3300049743 Bacteria 4682
178 Ga0501083_0007632 3300049744 Bacteria 7666
179 Ga0501083_0034658 3300049744 Bacteria 3451
180 Ga0501035_0005326 3300049822 Bacteria 12168
181 Ga0501035_0141533 3300049822 Bacteria 2091
182 Ga0501044_0137742 3300049823 Bacteria 2431
183 Ga0501044_0211617 3300049823 Bacteria 1893
184 Ga0501045_0119457 3300049824 Bacteria 1957
185 nmdc:mga0yw44_44140_c1 3300050492 Bacteria 2665
186 nmdc:mga0k408_128040_c1 3300050493 Bacteria 1506
187 nmdc:mga0k408_47895_c1 3300050493 Bacteria 2471
188 nmdc:mga06z11_22452_c1 3300050494 Bacteria 2948
189 nmdc:mga06z11_27823_c1 3300050494 Bacteria 2706
190 nmdc:mga06z11_31837_c1 3300050494 Bacteria 2567
191 nmdc:mga07m45_33071_c1 3300050496 Bacteria 2871
192 nmdc:mga05p37_430711_c1 3300050507 Bacteria 1532
193 nmdc:mga0qj67_347_c1 3300050509 Bacteria 31880
194 nmdc:mga0a205_151718_c1 3300050515 Bacteria 2216
195 nmdc:mga0sz30_80451_c1 3300050516 Bacteria 1410
196 nmdc:mga0sz30_82931_c1 3300050516 Bacteria 1388
197 Ga0495601_0007572 3300053077 Bacteria 6374
198 Ga0495612_0006454 3300053078 Bacteria 4818
199 Ga0500635_0000831 3300053080 Bacteria 7616
200 Ga0495619_0001276 3300053085 Bacteria 16527
201 Ga0500643_039890 3300053087 Bacteria 1385
202 Ga0500644_0000965 3300053088 Bacteria 8999
203 Ga0500651_0004300 3300053093 Bacteria 7955
204 Ga0500566_0000463 3300053094 Bacteria 22603
205 Ga0500566_0003124 3300053094 Bacteria 9900
206 Ga0500641_0092374 3300053096 Bacteria 1292
207 Ga0500650_0002012 3300053098 Bacteria 6497
208 Ga0500554_001390 3300053102 Bacteria 4682
209 Ga0500555_001337 3300053103 Bacteria 7735
210 Ga0500556_0000051 3300053104 Bacteria 119031
211 Ga0500592_003776 3300053116 Bacteria 2415
212 Ga0500594_0005921 3300053118 Bacteria 2726
213 Ga0500595_001628 3300053119 Bacteria 11788
214 Ga0500595_001671 3300053119 Bacteria 11662
215 Ga0500595_009634 3300053119 Bacteria 3890
216 Ga0500595_034545 3300053119 Bacteria 1672
217 Ga0500595_036924 3300053119 Bacteria 1597
218 Ga0500608_000242 3300053122 Bacteria 21554
219 Ga0500618_027487 3300053125 Bacteria 1353
220 Ga0500642_0000041 3300053130 Bacteria 89564
221 Ga0500642_0000963 3300053130 Bacteria 8262
222 Ga0500652_000004 3300053131 Bacteria 173428
223 Ga0500652_004929 3300053131 Bacteria 4172
224 Ga0500559_0021765 3300053136 Bacteria 2719
225 Ga0500568_0005321 3300053139 Bacteria 6674
226 Ga0500577_0030628 3300053142 Bacteria 1875
227 Ga0500590_074578 3300053148 Bacteria 1679
228 Ga0500604_0004703 3300053151 Bacteria 3615
229 Ga0500616_0000150 3300053153 Bacteria 117918
230 Ga0500616_0000481 3300053153 Bacteria 51776
231 Ga0500619_009199 3300053154 Bacteria 2440
232 Ga0500622_0000502 3300053156 Bacteria 36464
233 Ga0500636_0005500 3300053177 Bacteria 7240
234 Ga0500637_0000377 3300053178 Bacteria 16875
235 Ga0500637_0020362 3300053178 Bacteria 3592
236 Ga0500645_031605 3300053730 Bacteria 1590
237 Ga0501084_0073612 3300054114 Bacteria 2861
238 Ga0500661_000708 3300055283 Bacteria 6227
239 Ga0501082_0136556 3300060353 Bacteria 2128
240 Ga0501082_0138717 3300060353 Bacteria 2110
241 Ga0466962_0023927 3300061719 Bacteria 2935
242 Ga0466962_0091848 3300061719 Bacteria 1455
243 Ga0530510_0119364 3300061734 Bacteria 1935
244 Ga0530510_0155043 3300061734 Bacteria 1692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0091848 Ga0466962_0091848_179_1345 336
2 3300005983 Ga0081540_1006159 Ga0081540_10061592 339
3 3300006178 Ga0075367_10015776 Ga0075367_100157763 339
4 3300006195 Ga0075366_10058656 Ga0075366_100586563 339
5 3300009177 Ga0105248_10077818 Ga0105248_100778184 339
6 3300010375 Ga0105239_10203755 Ga0105239_102037552 339
7 3300028379 Ga0268266_10054214 Ga0268266_100542143 339
8 3300046515 Ga0495620_0008241 Ga0495620_0008241_2362_3774 339
9 3300046810 Ga0495660_0037703 Ga0495660_0037703_41_1297 339
10 3300047472 Ga0495686_0024492 Ga0495686_0024492_246_1613 339
11 3300048912 Ga0496109_0166659 Ga0496109_0166659_244_1467 339
12 3300048919 Ga0496116_0001246 Ga0496116_0001246_19515_20699 339
13 3300048921 Ga0496118_0008413 Ga0496118_0008413_9058_10242 339
14 3300048921 Ga0496118_0095536 Ga0496118_0095536_53_1237 339
15 3300048924 Ga0496121_0007261 Ga0496121_0007261_10064_11476 339
16 3300048924 Ga0496121_0054018 Ga0496121_0054018_1461_2621 339
17 3300048925 Ga0496122_0053700 Ga0496122_0053700_1358_2725 339
18 3300048928 Ga0496125_0002221 Ga0496125_0002221_6789_8201 339
19 3300048928 Ga0496125_0018095 Ga0496125_0018095_2926_4110 339
20 3300048929 Ga0496126_0136984 Ga0496126_0136984_308_1531 339
21 3300050492 nmdc:mga0yw44_44140_c1 nmdc:mga0yw44_44140_c1_230_1597 339
22 3300050493 nmdc:mga0k408_47895_c1 nmdc:mga0k408_47895_c1_860_2020 339
23 3300050494 nmdc:mga06z11_27823_c1 nmdc:mga06z11_27823_c1_1127_2287 339
24 3300050516 nmdc:mga0sz30_80451_c1 nmdc:mga0sz30_80451_c1_36_1220 339
25 3300053087 Ga0500643_039890 Ga0500643_039890_22_1320 339
26 3300053096 Ga0500641_0092374 Ga0500641_0092374_76_1260 339
27 3300053098 Ga0500650_0002012 Ga0500650_0002012_3711_5099 339
28 3300053104 Ga0500556_0000051 Ga0500556_0000051_39006_40418 339
29 3300053116 Ga0500592_003776 Ga0500592_003776_729_2141 339
30 3300053130 Ga0500642_0000041 Ga0500642_0000041_6880_8292 339
31 3300053131 Ga0500652_004929 Ga0500652_004929_2545_3957 339
32 3300053139 Ga0500568_0005321 Ga0500568_0005321_1652_3040 339
33 3300053148 Ga0500590_074578 Ga0500590_074578_325_1485 339
34 3300053151 Ga0500604_0004703 Ga0500604_0004703_1448_2836 339
35 3300053153 Ga0500616_0000150 Ga0500616_0000150_38758_40170 339
36 3300053154 Ga0500619_009199 Ga0500619_009199_387_1799 339
37 3300053156 Ga0500622_0000502 Ga0500622_0000502_11117_12301 339
38 3300053178 Ga0500637_0020362 Ga0500637_0020362_70_1230 339
39 3300053730 Ga0500645_031605 Ga0500645_031605_128_1540 339
40 3300037471 Ga0395905_0000507 Ga0395905_0000507_1912_3072 350
41 3300048929 Ga0496126_0245572 Ga0496126_0245572_26_1186 352
42 3300005937 Ga0081455_10027984 Ga0081455_100279842 353
43 3300049581 Ga0501047_0116560 Ga0501047_0116560_27_1184 354
44 3300049822 Ga0501035_0141533 Ga0501035_0141533_904_2061 354
45 3300053119 Ga0500595_009634 Ga0500595_009634_1562_2722 354
46 3300053093 Ga0500651_0004300 Ga0500651_0004300_5481_6641 355
47 3300053118 Ga0500594_0005921 Ga0500594_0005921_1442_2602 355
48 3300003320 rootH2_10053927 rootH2_100539272 356
49 3300048924 Ga0496121_0011114 Ga0496121_0011114_1144_2304 356
50 3300006048 Ga0075363_100034002 Ga0075363_1000340022 359
51 3300037853 Ga0436364_0721387 Ga0436364_0721387_77_1240 359
52 3300044693 Ga0466961_0022570 Ga0466961_0022570_1943_3133 359
53 3300049572 Ga0501036_0294977 Ga0501036_0294977_249_1328 359
54 3300050496 nmdc:mga07m45_33071_c1 nmdc:mga07m45_33071_c1_51_1130 359
55 3300050516 nmdc:mga0sz30_82931_c1 nmdc:mga0sz30_82931_c1_89_1168 359
56 3300061719 Ga0466962_0023927 Ga0466962_0023927_223_1413 359
57 3300003320 rootH2_10053929 rootH2_100539293 360
58 3300026116 Ga0207674_10047170 Ga0207674_100471701 360
59 3300005614 Ga0068856_100249760 Ga0068856_1002497602 361
60 3300026078 Ga0207702_10171662 Ga0207702_101716622 361
61 3300049589 Ga0501073_0110998 Ga0501073_0110998_20_1111 362
62 3300006038 Ga0075365_10069065 Ga0075365_100690652 363
63 3300006048 Ga0075363_100026566 Ga0075363_1000265661 363
64 3300006178 Ga0075367_10000751 Ga0075367_100007512 363
65 3300050493 nmdc:mga0k408_128040_c1 nmdc:mga0k408_128040_c1_88_1248 363
66 3300050494 nmdc:mga06z11_22452_c1 nmdc:mga06z11_22452_c1_1282_2442 363
67 3300045051 Ga0451576_0273785 Ga0451576_0273785_240_1415 364
68 3300048929 Ga0496126_0011734 Ga0496126_0011734_6796_7968 364
69 3300053080 Ga0500635_0000831 Ga0500635_0000831_1846_3024 364
70 3300053122 Ga0500608_000242 Ga0500608_000242_2628_3803 364
71 3300053136 Ga0500559_0021765 Ga0500559_0021765_655_1833 364
72 3300013104 Ga0157370_10043754 Ga0157370_100437543 365
73 3300015684 Ga0183365_10001 Ga0183365_100011279 365
74 3300049571 Ga0501034_0067872 Ga0501034_0067872_237_1418 365
75 3300003323 rootH1_10183404 rootH1_101834042 366
76 3300044656 Ga0466969_0010998 Ga0466969_0010998_2127_3317 366
77 3300044684 Ga0466966_0001487 Ga0466966_0001487_13116_14306 366
78 3300044842 Ga0466957_0026325 Ga0466957_0026325_550_1740 366
79 3300045049 Ga0466959_0000130 Ga0466959_0000130_7954_9144 366
80 3300049822 Ga0501035_0005326 Ga0501035_0005326_3979_5181 366
81 3300047320 Ga0495672_0015702 Ga0495672_0015702_942_2102 368
82 iso_pu_bacteria 2828305725 2828309411 372
83 iso_pu_bacteria 2857524615 2857525753 372
84 iso_pu_bacteria 2919073203 2919074383 372
85 iso_pu_bacteria 2996310559 2996313484 373
86 3300005445 Ga0070708_100062021 Ga0070708_1000620214 374
87 3300005536 Ga0070697_100019391 Ga0070697_1000193913 374
88 3300005548 Ga0070665_100005784 Ga0070665_1000057841 375
89 3300028379 Ga0268266_10001895 Ga0268266_1000189510 375
90 3300044694 Ga0466963_0097379 Ga0466963_0097379_526_1701 376
91 3300049588 Ga0501072_0227389 Ga0501072_0227389_20_1159 376
92 iso_pu_bacteria 2821443989 2821447600 376
93 iso_pu_bacteria 2842298080 2842301595 376
94 iso_pu_bacteria 2842357229 2842360696 376
95 iso_pu_bacteria 2989349275 2989353665 376
96 3300048917 Ga0496114_0033255 Ga0496114_0033255_312_1472 377
97 3300003203 JGI25406J46586_10024760 JGI25406J46586_100247601 378
98 3300005985 Ga0081539_10000979 Ga0081539_1000097940 378
99 3300025299 Ga0209256_1001176 Ga0209256_100117628 378
100 3300031901 Ga0307406_10030481 Ga0307406_100304812 378
101 3300039437 Ga0436365_0888520 Ga0436365_0888520_237_1400 378
102 3300048908 Ga0496105_0016638 Ga0496105_0016638_4043_5206 378
103 3300049580 Ga0501046_0046706 Ga0501046_0046706_259_1434 378
104 3300049584 Ga0501068_0062367 Ga0501068_0062367_656_1831 378
105 3300049593 Ga0501077_0051462 Ga0501077_0051462_488_1663 378
106 3300049741 Ga0501079_0156000 Ga0501079_0156000_573_1748 378
107 3300049743 Ga0501081_0018046 Ga0501081_0018046_480_1655 378
108 3300061734 Ga0530510_0155043 Ga0530510_0155043_394_1569 378
109 iso_pu_bacteria 2602042107 2603862357 378
110 iso_pu_bacteria 2893066018 2893067953 378
111 3300005445 Ga0070708_100282131 Ga0070708_1002821312 379
112 3300005468 Ga0070707_100259873 Ga0070707_1002598732 379
113 3300006871 Ga0075434_100112487 Ga0075434_1001124872 379
114 3300009093 Ga0105240_10214055 Ga0105240_102140552 379
115 3300010375 Ga0105239_10015992 Ga0105239_100159927 379
116 3300021361 Ga0213872_10054285 Ga0213872_100542852 379
117 3300025910 Ga0207684_10106338 Ga0207684_101063382 379
118 3300025915 Ga0207693_10055598 Ga0207693_100555982 379
119 3300039437 Ga0436365_0862796 Ga0436365_0862796_2552_3727 379
120 3300039447 Ga0436361_0615246 Ga0436361_0615246_6719_7882 379
121 3300050507 nmdc:mga05p37_430711_c1 nmdc:mga05p37_430711_c1_288_1451 379
122 3300050515 nmdc:mga0a205_151718_c1 nmdc:mga0a205_151718_c1_681_1844 379
123 iso_pu_bacteria 2508501009 2508542401 380
124 iso_pu_bacteria 2513237096 2513657873 380
125 iso_pu_bacteria 2513237137 2513855573 380
126 iso_pu_bacteria 2513237145 2513920034 380
127 iso_pu_bacteria 2517572143 2517892118 380
128 iso_pu_bacteria 2524023228 2524534203 380
129 iso_pu_bacteria 2667528175 2671121844 380
130 iso_pu_bacteria 2728368998 2728751078 380
131 iso_pu_bacteria 2791355197 2793068797 380
132 iso_pu_bacteria 2885374607 2885381691 380
133 iso_pu_bacteria 2903768456 2903774438 380
134 iso_pu_bacteria 2904690495 2904694815 380
135 iso_pu_bacteria 2904699407 2904702242 380
136 iso_pu_bacteria 2906610324 2906617247 380
137 iso_pu_bacteria 2906635258 2906643362 380
138 iso_pu_bacteria 2906660503 2906662507 380
139 iso_pu_bacteria 2908739725 2908742398 380
140 iso_pu_bacteria 2908756301 2908760035 380
141 iso_pu_bacteria 2935630451 2935631255 380
142 iso_pu_bacteria 2941507105 2941509996 380
143 iso_pu_bacteria 2941515067 2941518917 380
144 iso_pu_bacteria 2941523033 2941525395 380
145 iso_pu_bacteria 3005474847 3005480492 380
146 iso_pu_bacteria 8006933436 8006940287 380
147 iso_pu_bacteria 8006973647 8006980065 380
148 3300003215 JGI25153J46596_10000956 JGI25153J46596_100009562 381
149 3300025297 Ga0209758_1000063 Ga0209758_1000063247 381
150 3300025297 Ga0209758_1013645 Ga0209758_10136455 381
151 3300025298 Ga0209050_1006440 Ga0209050_10064405 381
152 3300025304 Ga0209257_1000334 Ga0209257_100033453 381
153 3300033180 Ga0307510_10185681 Ga0307510_101856813 381
154 3300046460 Ga0495638_0038549 Ga0495638_0038549_1500_2666 381
155 3300049574 Ga0501038_0283425 Ga0501038_0283425_87_1247 381
156 3300049583 Ga0501067_0093524 Ga0501067_0093524_24_1184 381
157 3300049586 Ga0501070_0190082 Ga0501070_0190082_15_1175 381
158 3300049592 Ga0501076_0114004 Ga0501076_0114004_101_1261 381
159 3300049593 Ga0501077_0122718 Ga0501077_0122718_251_1411 381
160 3300049742 Ga0501080_0061555 Ga0501080_0061555_2131_3291 381
161 3300049744 Ga0501083_0034658 Ga0501083_0034658_1331_2491 381
162 3300049824 Ga0501045_0119457 Ga0501045_0119457_502_1662 381
163 3300053119 Ga0500595_001671 Ga0500595_001671_8305_9465 381
164 3300053130 Ga0500642_0000963 Ga0500642_0000963_3270_4430 381
165 3300053142 Ga0500577_0030628 Ga0500577_0030628_283_1446 381
166 3300054114 Ga0501084_0073612 Ga0501084_0073612_1316_2476 381
167 3300060353 Ga0501082_0136556 Ga0501082_0136556_527_1687 381
168 3300061734 Ga0530510_0119364 Ga0530510_0119364_594_1754 381
169 iso_pu_bacteria 8056689827 8056695716 381
170 3300003659 JGI25404J52841_10001056 JGI25404J52841_100010565 382
171 3300005937 Ga0081455_10082628 Ga0081455_100826282 382
172 3300005983 Ga0081540_1000022 Ga0081540_100002236 382
173 3300021441 Ga0213871_10000629 Ga0213871_100006294 382
174 3300031456 Ga0307513_10041965 Ga0307513_100419655 382
175 3300039438 Ga0436360_0172085 Ga0436360_0172085_1333_2496 382
176 3300048924 Ga0496121_0044067 Ga0496121_0044067_1953_3113 382
177 3300048929 Ga0496126_0277746 Ga0496126_0277746_77_1237 382
178 3300049581 Ga0501047_0012850 Ga0501047_0012850_5552_6712 382
179 3300049586 Ga0501070_0014522 Ga0501070_0014522_4057_5217 382
180 3300049742 Ga0501080_0018253 Ga0501080_0018253_4568_5728 382
181 3300053094 Ga0500566_0000463 Ga0500566_0000463_15734_16894 382
182 3300053125 Ga0500618_027487 Ga0500618_027487_83_1267 382
183 iso_pu_bacteria 2513237098 2513674423 382
184 iso_pu_bacteria 2513237161 2514015689 382
185 iso_pu_bacteria 2517093001 2517102792 382
186 iso_pu_bacteria 2524023210 2524465771 382
187 iso_pu_bacteria 2791355196 2793062720 382
188 iso_pu_bacteria 2802429603 2805915083 382
189 iso_pu_bacteria 2824696289 2824699454 382
190 iso_pu_bacteria 2824704595 2824712557 382
191 iso_pu_bacteria 2824753945 2824754228 382
192 iso_pu_bacteria 2824763712 2824768965 382
193 iso_pu_bacteria 2824773399 2824775382 382
194 iso_pu_bacteria 2838122688 2838123481 382
195 iso_pu_bacteria 2841941048 2841947746 382
196 iso_pu_bacteria 2841949485 2841949583 382
197 iso_pu_bacteria 2841966195 2841971912 382
198 iso_pu_bacteria 2841974524 2841974745 382
199 iso_pu_bacteria 2841983080 2841983695 382
200 iso_pu_bacteria 2847939898 2847946819 382
201 iso_pu_bacteria 2874612657 2874619491 382
202 iso_pu_bacteria 2885383462 2885390413 382
203 iso_pu_bacteria 2904711408 2904714951 382
204 iso_pu_bacteria 2906643746 2906649968 382
205 iso_pu_bacteria 8056681323 8056687347 382
206 3300005434 Ga0070709_10007258 Ga0070709_100072582 383
207 3300005437 Ga0070710_10006103 Ga0070710_100061031 383
208 3300005937 Ga0081455_10000257 Ga0081455_1000025731 383
209 3300005937 Ga0081455_10029417 Ga0081455_100294171 383
210 3300006175 Ga0070712_100068059 Ga0070712_1000680594 383
211 3300007265 Ga0099794_10093384 Ga0099794_100933841 383
212 3300013297 Ga0157378_10013052 Ga0157378_100130526 383
213 3300014968 Ga0157379_10030359 Ga0157379_100303592 383
214 3300025906 Ga0207699_10009741 Ga0207699_100097414 383
215 3300025928 Ga0207700_10135774 Ga0207700_101357741 383
216 3300028794 Ga0307515_10054386 Ga0307515_100543864 383
217 3300031730 Ga0307516_10015472 Ga0307516_100154724 383
218 3300053094 Ga0500566_0003124 Ga0500566_0003124_8720_9886 383
219 3300053102 Ga0500554_001390 Ga0500554_001390_1622_2788 383
220 3300053119 Ga0500595_001628 Ga0500595_001628_7683_8849 383
221 3300053119 Ga0500595_036924 Ga0500595_036924_381_1547 383
222 3300053131 Ga0500652_000004 Ga0500652_000004_84073_85239 383
223 3300053177 Ga0500636_0005500 Ga0500636_0005500_742_1908 383
224 3300053178 Ga0500637_0000377 Ga0500637_0000377_12846_14012 383
225 3300055283 Ga0500661_000708 Ga0500661_000708_4570_5736 383
226 3300005981 Ga0081538_10027264 Ga0081538_100272642 384
227 3300006175 Ga0070712_100095895 Ga0070712_1000958952 384
228 3300006942 Ga0099824_1002487 Ga0099824_100248714 384
229 3300006943 Ga0099822_1001480 Ga0099822_10014804 384
230 3300025916 Ga0207663_10017868 Ga0207663_100178684 384
231 3300027357 Ga0209589_1000001 Ga0209589_1000001190 384
232 3300027361 Ga0209489_100001 Ga0209489_100001190 384
233 3300027363 Ga0209700_100001 Ga0209700_100001190 384
234 3300033442 Ga0315911_1000006 Ga0315911_1000006299 384
235 3300006846 Ga0075430_100000274 Ga0075430_10000027411 385
236 3300009093 Ga0105240_10003081 Ga0105240_1000308115 385
237 3300009545 Ga0105237_10152003 Ga0105237_101520032 385
238 3300025913 Ga0207695_10050292 Ga0207695_100502924 385
239 3300025914 Ga0207671_10093862 Ga0207671_100938622 385
240 3300031711 Ga0265314_10007230 Ga0265314_100072308 385
241 3300046460 Ga0495638_0034361 Ga0495638_0034361_1900_3096 385
242 3300047320 Ga0495672_0041110 Ga0495672_0041110_1045_2223 385
243 3300048925 Ga0496122_0059657 Ga0496122_0059657_933_2105 385
244 3300048926 Ga0496123_0142631 Ga0496123_0142631_37_1209 385
245 3300048929 Ga0496126_0001652 Ga0496126_0001652_24733_25905 385
246 3300049571 Ga0501034_0077820 Ga0501034_0077820_963_2129 385
247 3300049574 Ga0501038_0151545 Ga0501038_0151545_196_1362 385
248 3300049581 Ga0501047_0093127 Ga0501047_0093127_188_1354 385
249 3300049744 Ga0501083_0007632 Ga0501083_0007632_4796_5962 385
250 3300049823 Ga0501044_0137742 Ga0501044_0137742_95_1252 385
251 3300049823 Ga0501044_0211617 Ga0501044_0211617_260_1426 385
252 3300050494 nmdc:mga06z11_31837_c1 nmdc:mga06z11_31837_c1_477_1679 385
253 3300050509 nmdc:mga0qj67_347_c1 nmdc:mga0qj67_347_c1_15055_16218 385
254 3300053088 Ga0500644_0000965 Ga0500644_0000965_3605_4801 385
255 3300053153 Ga0500616_0000481 Ga0500616_0000481_10067_11263 385
256 3300060353 Ga0501082_0138717 Ga0501082_0138717_153_1319 385
257 3300003187 JGI25151J46595_10015149 JGI25151J46595_100151495 386
258 3300003659 JGI25404J52841_10001679 JGI25404J52841_100016793 386
259 3300005937 Ga0081455_10013857 Ga0081455_100138575 386
260 3300005937 Ga0081455_10045454 Ga0081455_100454543 386
261 3300005983 Ga0081540_1000544 Ga0081540_10005447 386
262 3300005983 Ga0081540_1000731 Ga0081540_100073125 386
263 3300005983 Ga0081540_1002537 Ga0081540_10025376 386
264 3300005983 Ga0081540_1003164 Ga0081540_10031649 386
265 3300005983 Ga0081540_1005764 Ga0081540_10057645 386
266 3300005983 Ga0081540_1027170 Ga0081540_10271702 386
267 3300005983 Ga0081540_1071198 Ga0081540_10711981 386
268 3300005985 Ga0081539_10001065 Ga0081539_1000106524 386
269 3300009093 Ga0105240_10089647 Ga0105240_100896473 386
270 3300025254 Ga0209148_1000537 Ga0209148_100053730 386
271 3300025272 Ga0209455_1002053 Ga0209455_10020536 386
272 3300025294 Ga0209025_1000741 Ga0209025_100074143 386
273 3300025297 Ga0209758_1024417 Ga0209758_10244173 386
274 3300035170 Ga0373943_0085567 Ga0373943_0085567_396_1574 386
275 3300035172 Ga0373955_0039126 Ga0373955_0039126_475_1653 386
276 3300035695 Ga0373927_0036495 Ga0373927_0036495_272_1450 386
277 3300036401 Ga0373937_0002003 Ga0373937_0002003_4393_5571 386
278 3300038443 Ga0395901_0142980 Ga0395901_0142980_189_1364 386
279 3300046454 Ga0495592_0006749 Ga0495592_0006749_1583_2761 386
280 3300046459 Ga0495629_0024994 Ga0495629_0024994_1249_2427 386
281 3300046462 Ga0495651_0000265 Ga0495651_0000265_1516_2694 386
282 3300046511 Ga0495608_0000435 Ga0495608_0000435_1850_3028 386
283 3300046512 Ga0495610_0051448 Ga0495610_0051448_154_1314 386
284 3300046514 Ga0495618_0002103 Ga0495618_0002103_7520_8698 386
285 3300046517 Ga0495630_0127914 Ga0495630_0127914_140_1318 386
286 3300046529 Ga0495652_0001766 Ga0495652_0001766_10627_11805 386
287 3300046559 Ga0495667_0046658 Ga0495667_0046658_80_1258 386
288 3300046663 Ga0495635_0120666 Ga0495635_0120666_595_1773 386
289 3300046678 Ga0495599_0016230 Ga0495599_0016230_3338_4516 386
290 3300046679 Ga0495623_0031932 Ga0495623_0031932_1296_2474 386
291 3300046680 Ga0495646_0027761 Ga0495646_0027761_157_1335 386
292 3300046683 Ga0495658_0052874 Ga0495658_0052874_1004_2182 386
293 3300047317 Ga0495604_0000118 Ga0495604_0000118_49713_50891 386
294 3300047319 Ga0495674_0002109 Ga0495674_0002109_6989_8167 386
295 3300047322 Ga0495680_0002679 Ga0495680_0002679_1921_3099 386
296 3300047444 Ga0495675_0038611 Ga0495675_0038611_1441_2619 386
297 3300048088 Ga0495602_0076591 Ga0495602_0076591_156_1334 386
298 3300048929 Ga0496126_0112336 Ga0496126_0112336_56_1228 386
299 3300053077 Ga0495601_0007572 Ga0495601_0007572_3536_4714 386
300 3300053078 Ga0495612_0006454 Ga0495612_0006454_855_2033 386
301 3300053085 Ga0495619_0001276 Ga0495619_0001276_1490_2668 386
302 3300053103 Ga0500555_001337 Ga0500555_001337_3018_4277 386
303 3300053119 Ga0500595_034545 Ga0500595_034545_256_1443 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

35

243

0.98

PF12536

DUF3734

Patatin phospholipase

279

384

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.6832 24 363
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.6813 18 368
5fya-assembly1.cif.gz_B cubic crystal of the native plpd 0.6789 18 368
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.6756 18 363
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.6687 24 363
ID Description Score Start End Superfamily
af_B0G109_19_215_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.7778 20 221 3.40.1090.10
af_B0G109_19_215_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6942 20 221 3.40.1090.10
af_Q54JJ8_18_280_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6848 10 330 3.40.1090.10
af_Q54JJ8_18_280_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6825 10 330 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.6399 24 313 3.40.1090.10
ID Description Score Start End GO Terms
AF-A0A529MFL3-F1-model_v4 Patatin-like phospholipase family protein 0.9735 48 386 GO:0006629
AF-A0A257Y745-F1-model_v4 PNPLA domain-containing protein 0.9685 50 168 GO:0006629
AF-A0A849HUT6-F1-model_v4 Patatin-like phospholipase family protein 0.9682 22 386 GO:0016042
GO:0016787
AF-A0A6C1KFN6-F1-model_v4 Patatin-like phospholipase family protein 0.9653 22 386 GO:0016042
GO:0016787
AF-A0A3C0MD20-F1-model_v4 Uncharacterized protein 0.965 84 386 GO:0006629

Feature Viewer

pLDDT pTM Quality
83.59 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map