F397240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 195 | 264 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0268725|Ga0496102_0268725_500_1198 |
| Length | 232 |
| Sequence | VIDEQTSKPRSSFWRELPFLLGVAILVAVLVRAFVLQTFYIPSPSMQHTLELQDRVLVNKLVYDFRDPHRGEIIVFKSPLDWRSDPSEEDFIKRVIGVAGDHVICCDAKGRITVNEQPLDETSYLYTDSTGQQSAPSDIKFDVVVPDGRIFVLGDNRGESRDSRCHLNDPGTLKGENAFVSEDLVVGRAIAVAWPLADAARLPIPTTYDSVPPGKTPAPSTPEIHAGADANC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 8 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 9 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 10 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 11 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 12 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 13 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 14 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 15 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 16 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 17 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 18 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 19 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 20 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 21 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 22 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 23 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 24 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 25 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 26 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 27 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 28 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 29 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 30 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 31 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 32 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 124 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 125 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 126 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 142 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 144 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 152 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 153 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 182 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 183 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 184 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 185 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 186 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 187 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 188 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 190 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 191 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 192 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 193 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 194 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 195 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.8 |
| Metatranscriptomes | 0.33 |
| Isolates | 12.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.3 |
| Nodule | 1.98 |
| Rhizoplane | 3.96 |
| Rhizosphere | 79.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10016792 | 3300003203 | Bacteria | 3042 |
| 2 | JGI25406J46586_10070632 | 3300003203 | Bacteria | 1097 |
| 3 | rootH1_10052087 | 3300003316 | Bacteria | 1463 |
| 4 | Ga0070658_10683394 | 3300005327 | Bacteria | 891 |
| 5 | Ga0070683_100001322 | 3300005329 | Bacteria | 18864 |
| 6 | Ga0068869_100197625 | 3300005334 | Bacteria | 1584 |
| 7 | Ga0068868_100329609 | 3300005338 | Bacteria | 1303 |
| 8 | Ga0070660_100253337 | 3300005339 | Bacteria | 1436 |
| 9 | Ga0070691_10095689 | 3300005341 | Bacteria | 1469 |
| 10 | Ga0070668_100003831 | 3300005347 | Bacteria | 11117 |
| 11 | Ga0070668_100027673 | 3300005347 | Bacteria | 4304 |
| 12 | Ga0070668_100142166 | 3300005347 | Bacteria | 1935 |
| 13 | Ga0070671_100256222 | 3300005355 | Bacteria | 1487 |
| 14 | Ga0070659_100014895 | 3300005366 | Bacteria | 5816 |
| 15 | Ga0070667_100019814 | 3300005367 | Bacteria | 5581 |
| 16 | Ga0070713_100087336 | 3300005436 | Bacteria | 2675 |
| 17 | Ga0070700_100087159 | 3300005441 | Bacteria | 2029 |
| 18 | Ga0068867_100019169 | 3300005459 | Bacteria | 4873 |
| 19 | Ga0070679_101201272 | 3300005530 | Bacteria | 704 |
| 20 | Ga0070684_100080600 | 3300005535 | Bacteria | 2880 |
| 21 | Ga0070684_100084689 | 3300005535 | Bacteria | 2810 |
| 22 | Ga0068853_100153330 | 3300005539 | Bacteria | 2075 |
| 23 | Ga0068853_100174374 | 3300005539 | Bacteria | 1947 |
| 24 | Ga0068855_100231443 | 3300005563 | Bacteria | 2069 |
| 25 | Ga0070664_100047832 | 3300005564 | Bacteria | 3615 |
| 26 | Ga0068857_100067307 | 3300005577 | Bacteria | 3188 |
| 27 | Ga0068857_100069115 | 3300005577 | Bacteria | 3145 |
| 28 | Ga0068856_100342554 | 3300005614 | Bacteria | 1513 |
| 29 | Ga0068856_100605157 | 3300005614 | Bacteria | 1117 |
| 30 | Ga0068864_100003346 | 3300005618 | Bacteria | 13256 |
| 31 | Ga0068866_10062601 | 3300005718 | Bacteria | 1936 |
| 32 | Ga0068861_100027982 | 3300005719 | Bacteria | 4111 |
| 33 | Ga0068861_100157331 | 3300005719 | Bacteria | 1871 |
| 34 | Ga0068861_100280312 | 3300005719 | Bacteria | 1435 |
| 35 | Ga0068863_100135730 | 3300005841 | Bacteria | 2350 |
| 36 | Ga0068863_100426525 | 3300005841 | Bacteria | 1299 |
| 37 | Ga0068860_100243724 | 3300005843 | Bacteria | 1749 |
| 38 | Ga0068860_100453106 | 3300005843 | Bacteria | 1276 |
| 39 | Ga0068862_100064819 | 3300005844 | Bacteria | 3146 |
| 40 | Ga0068862_100115317 | 3300005844 | Bacteria | 2362 |
| 41 | Ga0081455_10000117 | 3300005937 | Bacteria | 91308 |
| 42 | Ga0081455_10002874 | 3300005937 | Bacteria | 20265 |
| 43 | Ga0081455_10015769 | 3300005937 | Bacteria | 7320 |
| 44 | Ga0081455_10150662 | 3300005937 | Bacteria | 1794 |
| 45 | Ga0081538_10049604 | 3300005981 | Bacteria | 2545 |
| 46 | Ga0081540_1008507 | 3300005983 | Bacteria | 7163 |
| 47 | Ga0081539_10000613 | 3300005985 | Bacteria | 72150 |
| 48 | Ga0081539_10004121 | 3300005985 | Bacteria | 16553 |
| 49 | Ga0081539_10017055 | 3300005985 | Bacteria | 5129 |
| 50 | Ga0081539_10021053 | 3300005985 | Bacteria | 4374 |
| 51 | Ga0081539_10173333 | 3300005985 | Bacteria | 1018 |
| 52 | Ga0075364_10038009 | 3300006051 | Bacteria | 3119 |
| 53 | Ga0075432_10000257 | 3300006058 | Bacteria | 14537 |
| 54 | Ga0075432_10000605 | 3300006058 | Bacteria | 10873 |
| 55 | Ga0070716_100276233 | 3300006173 | Bacteria | 1157 |
| 56 | Ga0070712_100061884 | 3300006175 | Bacteria | 2645 |
| 57 | Ga0075428_100000650 | 3300006844 | Bacteria | 35770 |
| 58 | Ga0075428_100004381 | 3300006844 | Bacteria | 15581 |
| 59 | Ga0075428_100041843 | 3300006844 | Bacteria | 5038 |
| 60 | Ga0075428_100046365 | 3300006844 | Bacteria | 4774 |
| 61 | Ga0075428_100080880 | 3300006844 | Bacteria | 3546 |
| 62 | Ga0075430_100002384 | 3300006846 | Bacteria | 15616 |
| 63 | Ga0075430_100007033 | 3300006846 | Bacteria | 9487 |
| 64 | Ga0075430_100132196 | 3300006846 | Bacteria | 2080 |
| 65 | Ga0075431_100013458 | 3300006847 | Bacteria | 8262 |
| 66 | Ga0075431_100033264 | 3300006847 | Bacteria | 5314 |
| 67 | Ga0075433_10000376 | 3300006852 | Bacteria | 28135 |
| 68 | Ga0075433_10002577 | 3300006852 | Bacteria | 13817 |
| 69 | Ga0075434_100001579 | 3300006871 | Bacteria | 19302 |
| 70 | Ga0075434_100004645 | 3300006871 | Bacteria | 12415 |
| 71 | Ga0075429_100014321 | 3300006880 | Bacteria | 6878 |
| 72 | Ga0075429_100024272 | 3300006880 | Bacteria | 5260 |
| 73 | Ga0075429_100026795 | 3300006880 | Bacteria | 5004 |
| 74 | Ga0075429_100028910 | 3300006880 | Bacteria | 4815 |
| 75 | Ga0068865_100063408 | 3300006881 | Bacteria | 2597 |
| 76 | Ga0068865_100115032 | 3300006881 | Bacteria | 1990 |
| 77 | Ga0075436_100000378 | 3300006914 | Bacteria | 28438 |
| 78 | Ga0075436_100058162 | 3300006914 | Bacteria | 2670 |
| 79 | Ga0075435_100004207 | 3300007076 | Bacteria | 9877 |
| 80 | Ga0075435_100044526 | 3300007076 | Bacteria | 3554 |
| 81 | Ga0111539_10002609 | 3300009094 | Bacteria | 23891 |
| 82 | Ga0111539_10047446 | 3300009094 | Bacteria | 5133 |
| 83 | Ga0111539_10496800 | 3300009094 | Bacteria | 1421 |
| 84 | Ga0105247_10249459 | 3300009101 | Bacteria | 1213 |
| 85 | Ga0114129_10000082 | 3300009147 | Bacteria | 88174 |
| 86 | Ga0114129_10006488 | 3300009147 | Bacteria | 16596 |
| 87 | Ga0114129_10088909 | 3300009147 | Bacteria | 4282 |
| 88 | Ga0114129_10238953 | 3300009147 | Bacteria | 2443 |
| 89 | Ga0105243_10044232 | 3300009148 | Bacteria | 3493 |
| 90 | Ga0105243_10197088 | 3300009148 | Bacteria | 1763 |
| 91 | Ga0105243_10657086 | 3300009148 | Bacteria | 1017 |
| 92 | Ga0105242_10011595 | 3300009176 | Bacteria | 6779 |
| 93 | Ga0105242_10181730 | 3300009176 | Bacteria | 1856 |
| 94 | Ga0105237_10333135 | 3300009545 | Bacteria | 1522 |
| 95 | Ga0105237_10549632 | 3300009545 | Bacteria | 1161 |
| 96 | Ga0105238_10367158 | 3300009551 | Bacteria | 1429 |
| 97 | Ga0105249_10025834 | 3300009553 | Bacteria | 5289 |
| 98 | Ga0157342_1001149 | 3300012507 | Bacteria | 1873 |
| 99 | Ga0157372_10029314 | 3300013307 | Bacteria | 6008 |
| 100 | Ga0157372_10100256 | 3300013307 | Bacteria | 3305 |
| 101 | Ga0163163_10106912 | 3300014325 | Bacteria | 2824 |
| 102 | Ga0163163_10343943 | 3300014325 | Bacteria | 1547 |
| 103 | Ga0157380_10529167 | 3300014326 | Bacteria | 1151 |
| 104 | Ga0157376_11212568 | 3300014969 | Bacteria | 783 |
| 105 | Ga0163161_10104244 | 3300017792 | Bacteria | 2114 |
| 106 | Ga0207688_10032378 | 3300025901 | Bacteria | 2889 |
| 107 | Ga0207649_10622469 | 3300025920 | Bacteria | 832 |
| 108 | Ga0207652_10915689 | 3300025921 | Bacteria | 774 |
| 109 | Ga0207687_10125868 | 3300025927 | Bacteria | 1924 |
| 110 | Ga0207700_10130626 | 3300025928 | Bacteria | 2050 |
| 111 | Ga0207644_10067789 | 3300025931 | Bacteria | 2602 |
| 112 | Ga0207690_10040689 | 3300025932 | Bacteria | 3041 |
| 113 | Ga0207706_10034552 | 3300025933 | Bacteria | 4497 |
| 114 | Ga0207706_10094157 | 3300025933 | Bacteria | 2635 |
| 115 | Ga0207686_10033090 | 3300025934 | Bacteria | 3083 |
| 116 | Ga0207686_10140613 | 3300025934 | Bacteria | 1668 |
| 117 | Ga0207709_10012902 | 3300025935 | Bacteria | 4608 |
| 118 | Ga0207709_10243495 | 3300025935 | Bacteria | 1309 |
| 119 | Ga0207709_10523843 | 3300025935 | Bacteria | 928 |
| 120 | Ga0207704_10027444 | 3300025938 | Bacteria | 3142 |
| 121 | Ga0207704_10064350 | 3300025938 | Bacteria | 2291 |
| 122 | Ga0207665_10162700 | 3300025939 | Bacteria | 1606 |
| 123 | Ga0207691_10324978 | 3300025940 | Bacteria | 1318 |
| 124 | Ga0207711_10160053 | 3300025941 | Bacteria | 2037 |
| 125 | Ga0207689_10258458 | 3300025942 | Bacteria | 1441 |
| 126 | Ga0207661_10004856 | 3300025944 | Bacteria | 9420 |
| 127 | Ga0207679_10207026 | 3300025945 | Bacteria | 1643 |
| 128 | Ga0207667_10648371 | 3300025949 | Bacteria | 1062 |
| 129 | Ga0207668_10002358 | 3300025972 | Bacteria | 11036 |
| 130 | Ga0207658_10017469 | 3300025986 | Bacteria | 4944 |
| 131 | Ga0207639_10158474 | 3300026041 | Bacteria | 1905 |
| 132 | Ga0207708_10121849 | 3300026075 | Bacteria | 2032 |
| 133 | Ga0207641_10214802 | 3300026088 | Bacteria | 1780 |
| 134 | Ga0207648_10028483 | 3300026089 | Bacteria | 4951 |
| 135 | Ga0207676_10195473 | 3300026095 | Bacteria | 1783 |
| 136 | Ga0207674_10063758 | 3300026116 | Bacteria | 3718 |
| 137 | Ga0207674_10151407 | 3300026116 | Bacteria | 2277 |
| 138 | Ga0207675_100005342 | 3300026118 | Bacteria | 12344 |
| 139 | Ga0207675_100418639 | 3300026118 | Bacteria | 1323 |
| 140 | Ga0207428_10002093 | 3300027907 | Bacteria | 20115 |
| 141 | Ga0207428_10005110 | 3300027907 | Bacteria | 12316 |
| 142 | Ga0268266_10141064 | 3300028379 | Bacteria | 2163 |
| 143 | Ga0268265_10132600 | 3300028380 | Bacteria | 2073 |
| 144 | Ga0268265_10206449 | 3300028380 | Bacteria | 1708 |
| 145 | Ga0268264_10035833 | 3300028381 | Bacteria | 4085 |
| 146 | Ga0268264_10384965 | 3300028381 | Bacteria | 1344 |
| 147 | Ga0307515_10015993 | 3300028794 | Bacteria | 13773 |
| 148 | Ga0307515_10032705 | 3300028794 | Bacteria | 8600 |
| 149 | Ga0307512_10007169 | 3300030522 | Bacteria | 11093 |
| 150 | Ga0307512_10112069 | 3300030522 | Bacteria | 1792 |
| 151 | Ga0307513_10005290 | 3300031456 | Bacteria | 17083 |
| 152 | Ga0307509_10129915 | 3300031507 | Bacteria | 2477 |
| 153 | Ga0307408_100009037 | 3300031548 | Bacteria | 6582 |
| 154 | Ga0307408_100036992 | 3300031548 | Bacteria | 3435 |
| 155 | Ga0307508_10001514 | 3300031616 | Bacteria | 25941 |
| 156 | Ga0307508_10018782 | 3300031616 | Bacteria | 6283 |
| 157 | Ga0307508_10027035 | 3300031616 | Bacteria | 5198 |
| 158 | Ga0307405_10034653 | 3300031731 | Bacteria | 3006 |
| 159 | Ga0307405_10057729 | 3300031731 | Bacteria | 2439 |
| 160 | Ga0307405_10144308 | 3300031731 | Bacteria | 1665 |
| 161 | Ga0307405_10246298 | 3300031731 | Bacteria | 1327 |
| 162 | Ga0307405_10438592 | 3300031731 | Bacteria | 1032 |
| 163 | Ga0307413_10003453 | 3300031824 | Bacteria | 6654 |
| 164 | Ga0307413_10018733 | 3300031824 | Bacteria | 3639 |
| 165 | Ga0307413_10557769 | 3300031824 | Bacteria | 930 |
| 166 | Ga0307410_10007316 | 3300031852 | Bacteria | 6035 |
| 167 | Ga0307410_10028241 | 3300031852 | Bacteria | 3556 |
| 168 | Ga0307410_10029560 | 3300031852 | Bacteria | 3491 |
| 169 | Ga0307410_10039952 | 3300031852 | Bacteria | 3084 |
| 170 | Ga0326468_10000643 | 3300031889 | Bacteria | 3589 |
| 171 | Ga0307406_10000612 | 3300031901 | Bacteria | 20402 |
| 172 | Ga0307406_10002273 | 3300031901 | Bacteria | 10449 |
| 173 | Ga0307406_10029630 | 3300031901 | Bacteria | 3315 |
| 174 | Ga0307406_10089697 | 3300031901 | Bacteria | 2066 |
| 175 | Ga0307406_10310747 | 3300031901 | Bacteria | 1215 |
| 176 | Ga0307407_10001808 | 3300031903 | Bacteria | 8012 |
| 177 | Ga0307407_10025696 | 3300031903 | Bacteria | 3107 |
| 178 | Ga0307407_10069136 | 3300031903 | Bacteria | 2095 |
| 179 | Ga0307407_10267050 | 3300031903 | Bacteria | 1179 |
| 180 | Ga0307412_10022858 | 3300031911 | Bacteria | 3840 |
| 181 | Ga0307412_10054620 | 3300031911 | Bacteria | 2652 |
| 182 | Ga0307412_10143059 | 3300031911 | Bacteria | 1754 |
| 183 | Ga0307409_100000177 | 3300031995 | Bacteria | 24831 |
| 184 | Ga0307409_100000437 | 3300031995 | Bacteria | 17686 |
| 185 | Ga0307409_100207330 | 3300031995 | Bacteria | 1759 |
| 186 | Ga0307409_100579301 | 3300031995 | Bacteria | 1106 |
| 187 | Ga0307416_100000144 | 3300032002 | Bacteria | 41697 |
| 188 | Ga0307416_100001161 | 3300032002 | Bacteria | 14156 |
| 189 | Ga0307416_100087642 | 3300032002 | Bacteria | 2658 |
| 190 | Ga0307416_100101846 | 3300032002 | Bacteria | 2502 |
| 191 | Ga0307416_100110638 | 3300032002 | Bacteria | 2419 |
| 192 | Ga0307416_100211482 | 3300032002 | Bacteria | 1851 |
| 193 | Ga0307414_10046149 | 3300032004 | Bacteria | 2988 |
| 194 | Ga0307414_10106782 | 3300032004 | Bacteria | 2120 |
| 195 | Ga0307411_10010013 | 3300032005 | Bacteria | 5025 |
| 196 | Ga0307411_10011528 | 3300032005 | Bacteria | 4777 |
| 197 | Ga0307415_100000190 | 3300032126 | Bacteria | 27293 |
| 198 | Ga0307415_100000923 | 3300032126 | Bacteria | 13447 |
| 199 | Ga0307415_100004484 | 3300032126 | Bacteria | 7252 |
| 200 | Ga0307415_100027773 | 3300032126 | Bacteria | 3590 |
| 201 | Ga0307415_100038836 | 3300032126 | Bacteria | 3141 |
| 202 | Ga0307510_10348285 | 3300033180 | Bacteria | 932 |
| 203 | Ga0373939_0046863 | 3300035114 | Bacteria | 1325 |
| 204 | Ga0373962_0000172 | 3300035242 | Bacteria | 13751 |
| 205 | Ga0373935_0100549 | 3300035692 | Bacteria | 1905 |
| 206 | Ga0395899_0037634 | 3300037312 | Bacteria | 3627 |
| 207 | Ga0395900_0006872 | 3300037418 | Bacteria | 11801 |
| 208 | Ga0395900_0068602 | 3300037418 | Bacteria | 3644 |
| 209 | Ga0395898_0005950 | 3300037466 | Bacteria | 13092 |
| 210 | Ga0395905_0006430 | 3300037471 | Bacteria | 11830 |
| 211 | Ga0436364_0810988 | 3300037853 | Bacteria | 1016 |
| 212 | Ga0395901_0009122 | 3300038443 | Bacteria | 10045 |
| 213 | Ga0451791_0836473 | 3300041451 | Bacteria | 3749 |
| 214 | Ga0439463_002961 | 3300042016 | Bacteria | 4310 |
| 215 | Ga0450888_002687 | 3300042126 | Bacteria | 1764 |
| 216 | Ga0466967_0262690 | 3300045976 | Bacteria | 1652 |
| 217 | Ga0495603_0034009 | 3300046455 | Bacteria | 3066 |
| 218 | Ga0495629_0075964 | 3300046459 | Bacteria | 2346 |
| 219 | Ga0495584_0121102 | 3300046491 | Bacteria | 1325 |
| 220 | Ga0495631_0120232 | 3300046518 | Bacteria | 1130 |
| 221 | Ga0495632_0011770 | 3300046519 | Bacteria | 5091 |
| 222 | Ga0495632_0233035 | 3300046519 | Bacteria | 830 |
| 223 | Ga0495670_0052242 | 3300046691 | Bacteria | 2046 |
| 224 | Ga0496102_0268725 | 3300048905 | Bacteria | 1608 |
| 225 | Ga0496104_0108085 | 3300048907 | Bacteria | 2665 |
| 226 | Ga0496105_0051774 | 3300048908 | Bacteria | 3391 |
| 227 | Ga0496108_0000048 | 3300048911 | Bacteria | 133539 |
| 228 | Ga0496108_0013100 | 3300048911 | Bacteria | 6760 |
| 229 | Ga0496109_0010985 | 3300048912 | Bacteria | 7759 |
| 230 | Ga0496109_0172865 | 3300048912 | Bacteria | 2027 |
| 231 | Ga0496110_0332226 | 3300048913 | Bacteria | 1385 |
| 232 | Ga0496111_0013992 | 3300048914 | Bacteria | 5471 |
| 233 | Ga0496112_0015312 | 3300048915 | Bacteria | 7151 |
| 234 | Ga0496113_0001480 | 3300048916 | Bacteria | 13119 |
| 235 | nmdc:mga00v17_29927_c1 | 3300050491 | Bacteria | 3198 |
| 236 | nmdc:mga05p37_126_c1 | 3300050507 | Bacteria | 69639 |
| 237 | nmdc:mga05p37_138655_c1 | 3300050507 | Bacteria | 2981 |
| 238 | nmdc:mga05p37_3246_c1 | 3300050507 | Bacteria | 18936 |
| 239 | nmdc:mga09592_12_c1 | 3300050508 | Bacteria | 104148 |
| 240 | nmdc:mga09592_30488_c1 | 3300050508 | Bacteria | 4488 |
| 241 | nmdc:mga09592_52251_c1 | 3300050508 | Bacteria | 3449 |
| 242 | nmdc:mga09592_5401_c1 | 3300050508 | Bacteria | 10389 |
| 243 | nmdc:mga0qj67_140033_c1 | 3300050509 | Bacteria | 1961 |
| 244 | nmdc:mga0qj67_26976_c1 | 3300050509 | Bacteria | 4449 |
| 245 | nmdc:mga0qj67_6_c2 | 3300050509 | Bacteria | 123818 |
| 246 | nmdc:mga06r32_10_c1 | 3300050510 | Bacteria | 113242 |
| 247 | nmdc:mga06r32_38330_c1 | 3300050510 | Bacteria | 4541 |
| 248 | nmdc:mga06r32_628540_c1 | 3300050510 | Bacteria | 1043 |
| 249 | nmdc:mga08y16_1650_c1 | 3300050511 | Bacteria | 22607 |
| 250 | nmdc:mga08y16_443031_c1 | 3300050511 | Bacteria | 1325 |
| 251 | nmdc:mga0n895_13990_c1 | 3300050512 | Bacteria | 7267 |
| 252 | nmdc:mga0n895_1625_c1 | 3300050512 | Bacteria | 16963 |
| 253 | nmdc:mga0rr50_14563_c1 | 3300050513 | Bacteria | 5164 |
| 254 | nmdc:mga08x19_3323_c1 | 3300050514 | Bacteria | 9619 |
| 255 | nmdc:mga0a205_10147_c1 | 3300050515 | Bacteria | 8648 |
| 256 | Ga0500644_0172944 | 3300053088 | Bacteria | 879 |
| 257 | Ga0500651_0109001 | 3300053093 | Bacteria | 1691 |
| 258 | Ga0500641_0006753 | 3300053096 | Bacteria | 4082 |
| 259 | Ga0500650_0042201 | 3300053098 | Bacteria | 2107 |
| 260 | Ga0500569_007025 | 3300053109 | Bacteria | 2505 |
| 261 | Ga0500594_0003735 | 3300053118 | Bacteria | 3354 |
| 262 | Ga0500621_051329 | 3300053126 | Bacteria | 1669 |
| 263 | Ga0500652_004425 | 3300053131 | Bacteria | 4351 |
| 264 | Ga0587079_062311 | 3300059647 | Bacteria | 811 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0172865 | Ga0496109_0172865_1367_2008 | 166 |
| 2 | 3300025935 | Ga0207709_10523843 | Ga0207709_105238432 | 180 |
| 3 | 3300005937 | Ga0081455_10002874 | Ga0081455_100028743 | 183 |
| 4 | 3300005614 | Ga0068856_100605157 | Ga0068856_1006051572 | 184 |
| 5 | 3300014325 | Ga0163163_10343943 | Ga0163163_103439432 | 185 |
| 6 | 3300046455 | Ga0495603_0034009 | Ga0495603_0034009_2287_2976 | 185 |
| 7 | 3300005459 | Ga0068867_100019169 | Ga0068867_1000191694 | 193 |
| 8 | 3300012507 | Ga0157342_1001149 | Ga0157342_10011493 | 193 |
| 9 | 3300005329 | Ga0070683_100001322 | Ga0070683_10000132214 | 199 |
| 10 | 3300005535 | Ga0070684_100080600 | Ga0070684_1000806003 | 199 |
| 11 | 3300005577 | Ga0068857_100069115 | Ga0068857_1000691154 | 199 |
| 12 | 3300025944 | Ga0207661_10004856 | Ga0207661_1000485613 | 199 |
| 13 | 3300026116 | Ga0207674_10063758 | Ga0207674_100637583 | 199 |
| 14 | 3300005614 | Ga0068856_100342554 | Ga0068856_1003425542 | 200 |
| 15 | 3300013307 | Ga0157372_10100256 | Ga0157372_101002564 | 200 |
| 16 | 3300032126 | Ga0307415_100038836 | Ga0307415_1000388364 | 201 |
| 17 | iso_pu_bacteria | 2622736626 | 2623587221 | 201 |
| 18 | 3300005347 | Ga0070668_100142166 | Ga0070668_1001421663 | 202 |
| 19 | 3300005937 | Ga0081455_10000117 | Ga0081455_1000011770 | 202 |
| 20 | 3300006844 | Ga0075428_100046365 | Ga0075428_1000463653 | 202 |
| 21 | 3300006844 | Ga0075428_100080880 | Ga0075428_1000808802 | 202 |
| 22 | 3300006846 | Ga0075430_100132196 | Ga0075430_1001321961 | 202 |
| 23 | 3300009148 | Ga0105243_10197088 | Ga0105243_101970882 | 202 |
| 24 | 3300048913 | Ga0496110_0332226 | Ga0496110_0332226_197_1045 | 202 |
| 25 | iso_pu_bacteria | 2501939600 | 2501941384 | 202 |
| 26 | iso_pu_bacteria | 2855683550 | 2855689275 | 202 |
| 27 | iso_pu_bacteria | 2856858025 | 2856861056 | 202 |
| 28 | iso_pu_bacteria | 2858868258 | 2858869418 | 202 |
| 29 | iso_pu_bacteria | 2902582711 | 2902588027 | 202 |
| 30 | iso_pu_bacteria | 2996221748 | 2996222776 | 202 |
| 31 | iso_pu_bacteria | 649633069 | 649811804 | 202 |
| 32 | iso_pu_bacteria | 8055412473 | 8055417504 | 202 |
| 33 | 3300005339 | Ga0070660_100253337 | Ga0070660_1002533371 | 203 |
| 34 | 3300005341 | Ga0070691_10095689 | Ga0070691_100956892 | 203 |
| 35 | 3300005347 | Ga0070668_100027673 | Ga0070668_1000276734 | 203 |
| 36 | 3300005366 | Ga0070659_100014895 | Ga0070659_1000148952 | 203 |
| 37 | 3300005441 | Ga0070700_100087159 | Ga0070700_1000871592 | 203 |
| 38 | 3300005539 | Ga0068853_100153330 | Ga0068853_1001533302 | 203 |
| 39 | 3300005539 | Ga0068853_100174374 | Ga0068853_1001743742 | 203 |
| 40 | 3300005563 | Ga0068855_100231443 | Ga0068855_1002314432 | 203 |
| 41 | 3300005718 | Ga0068866_10062601 | Ga0068866_100626012 | 203 |
| 42 | 3300005719 | Ga0068861_100027982 | Ga0068861_1000279823 | 203 |
| 43 | 3300005843 | Ga0068860_100453106 | Ga0068860_1004531062 | 203 |
| 44 | 3300005937 | Ga0081455_10015769 | Ga0081455_1001576911 | 203 |
| 45 | 3300005937 | Ga0081455_10150662 | Ga0081455_101506622 | 203 |
| 46 | 3300005981 | Ga0081538_10049604 | Ga0081538_100496042 | 203 |
| 47 | 3300006058 | Ga0075432_10000257 | Ga0075432_100002579 | 203 |
| 48 | 3300006058 | Ga0075432_10000605 | Ga0075432_1000060511 | 203 |
| 49 | 3300006852 | Ga0075433_10000376 | Ga0075433_1000037621 | 203 |
| 50 | 3300006852 | Ga0075433_10002577 | Ga0075433_1000257711 | 203 |
| 51 | 3300006871 | Ga0075434_100001579 | Ga0075434_1000015799 | 203 |
| 52 | 3300006871 | Ga0075434_100004645 | Ga0075434_1000046456 | 203 |
| 53 | 3300006880 | Ga0075429_100028910 | Ga0075429_1000289103 | 203 |
| 54 | 3300006881 | Ga0068865_100063408 | Ga0068865_1000634083 | 203 |
| 55 | 3300006881 | Ga0068865_100115032 | Ga0068865_1001150322 | 203 |
| 56 | 3300006914 | Ga0075436_100000378 | Ga0075436_10000037823 | 203 |
| 57 | 3300006914 | Ga0075436_100058162 | Ga0075436_1000581623 | 203 |
| 58 | 3300007076 | Ga0075435_100004207 | Ga0075435_1000042077 | 203 |
| 59 | 3300007076 | Ga0075435_100044526 | Ga0075435_1000445262 | 203 |
| 60 | 3300009094 | Ga0111539_10002609 | Ga0111539_1000260918 | 203 |
| 61 | 3300009094 | Ga0111539_10047446 | Ga0111539_100474466 | 203 |
| 62 | 3300009094 | Ga0111539_10496800 | Ga0111539_104968002 | 203 |
| 63 | 3300009147 | Ga0114129_10238953 | Ga0114129_102389532 | 203 |
| 64 | 3300009148 | Ga0105243_10044232 | Ga0105243_100442322 | 203 |
| 65 | 3300009176 | Ga0105242_10011595 | Ga0105242_100115954 | 203 |
| 66 | 3300009176 | Ga0105242_10181730 | Ga0105242_101817303 | 203 |
| 67 | 3300009553 | Ga0105249_10025834 | Ga0105249_100258346 | 203 |
| 68 | 3300013307 | Ga0157372_10029314 | Ga0157372_100293144 | 203 |
| 69 | 3300017792 | Ga0163161_10104244 | Ga0163161_101042443 | 203 |
| 70 | 3300025901 | Ga0207688_10032378 | Ga0207688_100323782 | 203 |
| 71 | 3300025927 | Ga0207687_10125868 | Ga0207687_101258682 | 203 |
| 72 | 3300025932 | Ga0207690_10040689 | Ga0207690_100406892 | 203 |
| 73 | 3300025933 | Ga0207706_10034552 | Ga0207706_100345525 | 203 |
| 74 | 3300025933 | Ga0207706_10094157 | Ga0207706_100941573 | 203 |
| 75 | 3300025934 | Ga0207686_10033090 | Ga0207686_100330902 | 203 |
| 76 | 3300025934 | Ga0207686_10140613 | Ga0207686_101406131 | 203 |
| 77 | 3300025935 | Ga0207709_10012902 | Ga0207709_100129025 | 203 |
| 78 | 3300025935 | Ga0207709_10243495 | Ga0207709_102434952 | 203 |
| 79 | 3300025938 | Ga0207704_10027444 | Ga0207704_100274442 | 203 |
| 80 | 3300025938 | Ga0207704_10064350 | Ga0207704_100643502 | 203 |
| 81 | 3300025942 | Ga0207689_10258458 | Ga0207689_102584582 | 203 |
| 82 | 3300026041 | Ga0207639_10158474 | Ga0207639_101584742 | 203 |
| 83 | 3300026075 | Ga0207708_10121849 | Ga0207708_101218492 | 203 |
| 84 | 3300026089 | Ga0207648_10028483 | Ga0207648_100284834 | 203 |
| 85 | 3300026118 | Ga0207675_100005342 | Ga0207675_1000053426 | 203 |
| 86 | 3300027907 | Ga0207428_10002093 | Ga0207428_1000209317 | 203 |
| 87 | 3300027907 | Ga0207428_10005110 | Ga0207428_100051104 | 203 |
| 88 | 3300028381 | Ga0268264_10384965 | Ga0268264_103849652 | 203 |
| 89 | 3300031548 | Ga0307408_100009037 | Ga0307408_1000090374 | 203 |
| 90 | 3300031731 | Ga0307405_10034653 | Ga0307405_100346532 | 203 |
| 91 | 3300031731 | Ga0307405_10246298 | Ga0307405_102462981 | 203 |
| 92 | 3300031824 | Ga0307413_10003453 | Ga0307413_100034535 | 203 |
| 93 | 3300031824 | Ga0307413_10018733 | Ga0307413_100187335 | 203 |
| 94 | 3300031852 | Ga0307410_10028241 | Ga0307410_100282413 | 203 |
| 95 | 3300031852 | Ga0307410_10039952 | Ga0307410_100399522 | 203 |
| 96 | 3300031901 | Ga0307406_10000612 | Ga0307406_1000061210 | 203 |
| 97 | 3300031901 | Ga0307406_10089697 | Ga0307406_100896973 | 203 |
| 98 | 3300031903 | Ga0307407_10001808 | Ga0307407_100018088 | 203 |
| 99 | 3300031903 | Ga0307407_10025696 | Ga0307407_100256963 | 203 |
| 100 | 3300031911 | Ga0307412_10022858 | Ga0307412_100228583 | 203 |
| 101 | 3300031911 | Ga0307412_10143059 | Ga0307412_101430592 | 203 |
| 102 | 3300031995 | Ga0307409_100000177 | Ga0307409_10000017713 | 203 |
| 103 | 3300031995 | Ga0307409_100579301 | Ga0307409_1005793012 | 203 |
| 104 | 3300032002 | Ga0307416_100000144 | Ga0307416_10000014418 | 203 |
| 105 | 3300032002 | Ga0307416_100101846 | Ga0307416_1001018463 | 203 |
| 106 | 3300032004 | Ga0307414_10046149 | Ga0307414_100461493 | 203 |
| 107 | 3300032004 | Ga0307414_10106782 | Ga0307414_101067822 | 203 |
| 108 | 3300032005 | Ga0307411_10010013 | Ga0307411_100100133 | 203 |
| 109 | 3300032005 | Ga0307411_10011528 | Ga0307411_100115283 | 203 |
| 110 | 3300032126 | Ga0307415_100000923 | Ga0307415_1000009236 | 203 |
| 111 | 3300042016 | Ga0439463_002961 | Ga0439463_002961_2935_3786 | 203 |
| 112 | 3300042126 | Ga0450888_002687 | Ga0450888_002687_462_1304 | 203 |
| 113 | 3300046491 | Ga0495584_0121102 | Ga0495584_0121102_138_986 | 203 |
| 114 | 3300046518 | Ga0495631_0120232 | Ga0495631_0120232_11_859 | 203 |
| 115 | 3300046691 | Ga0495670_0052242 | Ga0495670_0052242_970_1818 | 203 |
| 116 | 3300050508 | nmdc:mga09592_5401_c1 | nmdc:mga09592_5401_c1_2549_3394 | 203 |
| 117 | 3300050509 | nmdc:mga0qj67_140033_c1 | nmdc:mga0qj67_140033_c1_966_1811 | 203 |
| 118 | 3300050511 | nmdc:mga08y16_1650_c1 | nmdc:mga08y16_1650_c1_16256_17107 | 203 |
| 119 | 3300050511 | nmdc:mga08y16_443031_c1 | nmdc:mga08y16_443031_c1_336_1187 | 203 |
| 120 | 3300050512 | nmdc:mga0n895_13990_c1 | nmdc:mga0n895_13990_c1_3596_4441 | 203 |
| 121 | 3300050512 | nmdc:mga0n895_1625_c1 | nmdc:mga0n895_1625_c1_4139_4990 | 203 |
| 122 | 3300050513 | nmdc:mga0rr50_14563_c1 | nmdc:mga0rr50_14563_c1_2386_3237 | 203 |
| 123 | 3300050514 | nmdc:mga08x19_3323_c1 | nmdc:mga08x19_3323_c1_2023_2874 | 203 |
| 124 | 3300050515 | nmdc:mga0a205_10147_c1 | nmdc:mga0a205_10147_c1_584_1435 | 203 |
| 125 | iso_pu_bacteria | 2515154129 | 2515719795 | 204 |
| 126 | iso_pu_bacteria | 2515154202 | 2516082345 | 204 |
| 127 | iso_pu_bacteria | 2867302475 | 2867304861 | 205 |
| 128 | iso_pu_bacteria | 2867312974 | 2867315648 | 205 |
| 129 | iso_pu_bacteria | 2867319477 | 2867324386 | 205 |
| 130 | iso_pu_bacteria | 2515154088 | 2515496024 | 206 |
| 131 | iso_pu_bacteria | 2515154137 | 2515757862 | 206 |
| 132 | iso_pu_bacteria | 2515154203 | 2516090288 | 206 |
| 133 | iso_pu_bacteria | 2751185782 | 2753264711 | 206 |
| 134 | iso_pu_bacteria | 2772190715 | 2772642637 | 206 |
| 135 | iso_pu_bacteria | 2855670206 | 2855671065 | 206 |
| 136 | iso_pu_bacteria | 2855676851 | 2855682261 | 206 |
| 137 | iso_pu_bacteria | 2857288857 | 2857290055 | 206 |
| 138 | iso_pu_bacteria | 2858848962 | 2858852986 | 206 |
| 139 | iso_pu_bacteria | 2858882152 | 2858884078 | 206 |
| 140 | iso_pu_bacteria | 2858888857 | 2858889767 | 206 |
| 141 | iso_pu_bacteria | 2858895516 | 2858896686 | 206 |
| 142 | iso_pu_bacteria | 2858902515 | 2858903780 | 206 |
| 143 | iso_pu_bacteria | 2869048445 | 2869050379 | 206 |
| 144 | iso_pu_bacteria | 2869061728 | 2869062841 | 206 |
| 145 | iso_pu_bacteria | 2869068681 | 2869073605 | 206 |
| 146 | iso_pu_bacteria | 2880489317 | 2880493049 | 206 |
| 147 | iso_pu_bacteria | 2880495981 | 2880499254 | 206 |
| 148 | iso_pu_bacteria | 2929219909 | 2929221239 | 206 |
| 149 | iso_pu_bacteria | 2929226422 | 2929227853 | 206 |
| 150 | iso_pu_bacteria | 8003830390 | 8003832318 | 206 |
| 151 | iso_pu_bacteria | 8003870546 | 8003876357 | 206 |
| 152 | iso_pu_bacteria | 8054704163 | 8054707536 | 206 |
| 153 | iso_pu_bacteria | 8054727385 | 8054731901 | 206 |
| 154 | iso_pu_bacteria | 8054734606 | 8054739162 | 206 |
| 155 | 3300048905 | Ga0496102_0268725 | Ga0496102_0268725_500_1198 | 207 |
| 156 | 3300005436 | Ga0070713_100087336 | Ga0070713_1000873363 | 208 |
| 157 | 3300005535 | Ga0070684_100084689 | Ga0070684_1000846892 | 208 |
| 158 | 3300005564 | Ga0070664_100047832 | Ga0070664_1000478322 | 208 |
| 159 | 3300005577 | Ga0068857_100067307 | Ga0068857_1000673074 | 208 |
| 160 | 3300005618 | Ga0068864_100003346 | Ga0068864_10000334614 | 208 |
| 161 | 3300005841 | Ga0068863_100135730 | Ga0068863_1001357301 | 208 |
| 162 | 3300006173 | Ga0070716_100276233 | Ga0070716_1002762332 | 208 |
| 163 | 3300006175 | Ga0070712_100061884 | Ga0070712_1000618842 | 208 |
| 164 | 3300009545 | Ga0105237_10333135 | Ga0105237_103331352 | 208 |
| 165 | 3300009551 | Ga0105238_10367158 | Ga0105238_103671582 | 208 |
| 166 | 3300014325 | Ga0163163_10106912 | Ga0163163_101069122 | 208 |
| 167 | 3300025928 | Ga0207700_10130626 | Ga0207700_101306262 | 208 |
| 168 | 3300025939 | Ga0207665_10162700 | Ga0207665_101627002 | 208 |
| 169 | 3300025941 | Ga0207711_10160053 | Ga0207711_101600532 | 208 |
| 170 | 3300025945 | Ga0207679_10207026 | Ga0207679_102070262 | 208 |
| 171 | 3300025949 | Ga0207667_10648371 | Ga0207667_106483712 | 208 |
| 172 | 3300026088 | Ga0207641_10214802 | Ga0207641_102148023 | 208 |
| 173 | 3300026095 | Ga0207676_10195473 | Ga0207676_101954731 | 208 |
| 174 | 3300026116 | Ga0207674_10151407 | Ga0207674_101514072 | 208 |
| 175 | 3300037312 | Ga0395899_0037634 | Ga0395899_0037634_1341_1970 | 208 |
| 176 | 3300037418 | Ga0395900_0006872 | Ga0395900_0006872_4063_4692 | 208 |
| 177 | 3300037466 | Ga0395898_0005950 | Ga0395898_0005950_6437_7066 | 208 |
| 178 | 3300037471 | Ga0395905_0006430 | Ga0395905_0006430_7812_8441 | 208 |
| 179 | 3300038443 | Ga0395901_0009122 | Ga0395901_0009122_6023_6652 | 208 |
| 180 | 3300046459 | Ga0495629_0075964 | Ga0495629_0075964_469_1098 | 208 |
| 181 | 3300048907 | Ga0496104_0108085 | Ga0496104_0108085_63_692 | 208 |
| 182 | 3300048908 | Ga0496105_0051774 | Ga0496105_0051774_2498_3127 | 208 |
| 183 | 3300048911 | Ga0496108_0013100 | Ga0496108_0013100_6073_6702 | 208 |
| 184 | 3300048912 | Ga0496109_0010985 | Ga0496109_0010985_5508_6137 | 208 |
| 185 | 3300048914 | Ga0496111_0013992 | Ga0496111_0013992_4418_5047 | 208 |
| 186 | 3300048915 | Ga0496112_0015312 | Ga0496112_0015312_962_1591 | 208 |
| 187 | 3300048916 | Ga0496113_0001480 | Ga0496113_0001480_7913_8542 | 208 |
| 188 | 3300005334 | Ga0068869_100197625 | Ga0068869_1001976252 | 209 |
| 189 | 3300005347 | Ga0070668_100003831 | Ga0070668_10000383113 | 209 |
| 190 | 3300005719 | Ga0068861_100280312 | Ga0068861_1002803123 | 209 |
| 191 | 3300005844 | Ga0068862_100115317 | Ga0068862_1001153174 | 209 |
| 192 | 3300005985 | Ga0081539_10173333 | Ga0081539_101733332 | 209 |
| 193 | 3300006844 | Ga0075428_100000650 | Ga0075428_10000065012 | 209 |
| 194 | 3300006844 | Ga0075428_100004381 | Ga0075428_10000438110 | 209 |
| 195 | 3300006846 | Ga0075430_100002384 | Ga0075430_10000238410 | 209 |
| 196 | 3300006846 | Ga0075430_100007033 | Ga0075430_10000703311 | 209 |
| 197 | 3300006847 | Ga0075431_100013458 | Ga0075431_1000134589 | 209 |
| 198 | 3300006847 | Ga0075431_100033264 | Ga0075431_1000332646 | 209 |
| 199 | 3300006880 | Ga0075429_100014321 | Ga0075429_1000143214 | 209 |
| 200 | 3300006880 | Ga0075429_100024272 | Ga0075429_1000242722 | 209 |
| 201 | 3300006880 | Ga0075429_100026795 | Ga0075429_1000267952 | 209 |
| 202 | 3300009147 | Ga0114129_10000082 | Ga0114129_1000008220 | 209 |
| 203 | 3300009147 | Ga0114129_10006488 | Ga0114129_100064888 | 209 |
| 204 | 3300009147 | Ga0114129_10088909 | Ga0114129_100889094 | 209 |
| 205 | 3300009545 | Ga0105237_10549632 | Ga0105237_105496321 | 209 |
| 206 | 3300025972 | Ga0207668_10002358 | Ga0207668_100023583 | 209 |
| 207 | 3300026118 | Ga0207675_100418639 | Ga0207675_1004186392 | 209 |
| 208 | 3300028380 | Ga0268265_10206449 | Ga0268265_102064491 | 209 |
| 209 | 3300031616 | Ga0307508_10027035 | Ga0307508_100270352 | 209 |
| 210 | 3300031824 | Ga0307413_10557769 | Ga0307413_105577691 | 209 |
| 211 | 3300031901 | Ga0307406_10310747 | Ga0307406_103107472 | 209 |
| 212 | 3300032002 | Ga0307416_100211482 | Ga0307416_1002114822 | 209 |
| 213 | 3300032126 | Ga0307415_100004484 | Ga0307415_1000044849 | 209 |
| 214 | 3300050507 | nmdc:mga05p37_126_c1 | nmdc:mga05p37_126_c1_58518_59159 | 209 |
| 215 | 3300050507 | nmdc:mga05p37_138655_c1 | nmdc:mga05p37_138655_c1_1745_2386 | 209 |
| 216 | 3300050507 | nmdc:mga05p37_3246_c1 | nmdc:mga05p37_3246_c1_845_1483 | 209 |
| 217 | 3300050508 | nmdc:mga09592_12_c1 | nmdc:mga09592_12_c1_93217_93858 | 209 |
| 218 | 3300050508 | nmdc:mga09592_30488_c1 | nmdc:mga09592_30488_c1_3705_4343 | 209 |
| 219 | 3300050508 | nmdc:mga09592_52251_c1 | nmdc:mga09592_52251_c1_901_1542 | 209 |
| 220 | 3300050509 | nmdc:mga0qj67_26976_c1 | nmdc:mga0qj67_26976_c1_502_1140 | 209 |
| 221 | 3300050509 | nmdc:mga0qj67_6_c2 | nmdc:mga0qj67_6_c2_112887_113528 | 209 |
| 222 | 3300050510 | nmdc:mga06r32_10_c1 | nmdc:mga06r32_10_c1_102991_103632 | 209 |
| 223 | 3300050510 | nmdc:mga06r32_38330_c1 | nmdc:mga06r32_38330_c1_2699_3337 | 209 |
| 224 | 3300050510 | nmdc:mga06r32_628540_c1 | nmdc:mga06r32_628540_c1_179_820 | 209 |
| 225 | 3300003203 | JGI25406J46586_10070632 | JGI25406J46586_100706322 | 210 |
| 226 | 3300003316 | rootH1_10052087 | rootH1_100520872 | 210 |
| 227 | 3300005327 | Ga0070658_10683394 | Ga0070658_106833941 | 210 |
| 228 | 3300005338 | Ga0068868_100329609 | Ga0068868_1003296092 | 210 |
| 229 | 3300005355 | Ga0070671_100256222 | Ga0070671_1002562222 | 210 |
| 230 | 3300005367 | Ga0070667_100019814 | Ga0070667_1000198142 | 210 |
| 231 | 3300005530 | Ga0070679_101201272 | Ga0070679_1012012721 | 210 |
| 232 | 3300005719 | Ga0068861_100157331 | Ga0068861_1001573312 | 210 |
| 233 | 3300005841 | Ga0068863_100426525 | Ga0068863_1004265252 | 210 |
| 234 | 3300005843 | Ga0068860_100243724 | Ga0068860_1002437242 | 210 |
| 235 | 3300005844 | Ga0068862_100064819 | Ga0068862_1000648194 | 210 |
| 236 | 3300005983 | Ga0081540_1008507 | Ga0081540_10085078 | 210 |
| 237 | 3300005985 | Ga0081539_10004121 | Ga0081539_100041212 | 210 |
| 238 | 3300005985 | Ga0081539_10017055 | Ga0081539_100170553 | 210 |
| 239 | 3300005985 | Ga0081539_10021053 | Ga0081539_100210532 | 210 |
| 240 | 3300006051 | Ga0075364_10038009 | Ga0075364_100380091 | 210 |
| 241 | 3300006844 | Ga0075428_100041843 | Ga0075428_1000418434 | 210 |
| 242 | 3300009101 | Ga0105247_10249459 | Ga0105247_102494592 | 210 |
| 243 | 3300009148 | Ga0105243_10657086 | Ga0105243_106570861 | 210 |
| 244 | 3300014326 | Ga0157380_10529167 | Ga0157380_105291672 | 210 |
| 245 | 3300014969 | Ga0157376_11212568 | Ga0157376_112125681 | 210 |
| 246 | 3300025920 | Ga0207649_10622469 | Ga0207649_106224691 | 210 |
| 247 | 3300025921 | Ga0207652_10915689 | Ga0207652_109156892 | 210 |
| 248 | 3300025931 | Ga0207644_10067789 | Ga0207644_100677894 | 210 |
| 249 | 3300025940 | Ga0207691_10324978 | Ga0207691_103249782 | 210 |
| 250 | 3300025986 | Ga0207658_10017469 | Ga0207658_100174695 | 210 |
| 251 | 3300028379 | Ga0268266_10141064 | Ga0268266_101410641 | 210 |
| 252 | 3300028380 | Ga0268265_10132600 | Ga0268265_101326003 | 210 |
| 253 | 3300028381 | Ga0268264_10035833 | Ga0268264_100358333 | 210 |
| 254 | 3300028794 | Ga0307515_10015993 | Ga0307515_100159937 | 210 |
| 255 | 3300028794 | Ga0307515_10032705 | Ga0307515_100327058 | 210 |
| 256 | 3300030522 | Ga0307512_10007169 | Ga0307512_100071697 | 210 |
| 257 | 3300030522 | Ga0307512_10112069 | Ga0307512_101120692 | 210 |
| 258 | 3300031456 | Ga0307513_10005290 | Ga0307513_1000529017 | 210 |
| 259 | 3300031507 | Ga0307509_10129915 | Ga0307509_101299152 | 210 |
| 260 | 3300031548 | Ga0307408_100036992 | Ga0307408_1000369922 | 210 |
| 261 | 3300031616 | Ga0307508_10001514 | Ga0307508_1000151426 | 210 |
| 262 | 3300031616 | Ga0307508_10018782 | Ga0307508_100187829 | 210 |
| 263 | 3300031731 | Ga0307405_10057729 | Ga0307405_100577294 | 210 |
| 264 | 3300031731 | Ga0307405_10144308 | Ga0307405_101443082 | 210 |
| 265 | 3300031731 | Ga0307405_10438592 | Ga0307405_104385922 | 210 |
| 266 | 3300031852 | Ga0307410_10007316 | Ga0307410_100073162 | 210 |
| 267 | 3300031852 | Ga0307410_10029560 | Ga0307410_100295602 | 210 |
| 268 | 3300031889 | Ga0326468_10000643 | Ga0326468_100006434 | 210 |
| 269 | 3300031901 | Ga0307406_10002273 | Ga0307406_100022738 | 210 |
| 270 | 3300031901 | Ga0307406_10029630 | Ga0307406_100296306 | 210 |
| 271 | 3300031903 | Ga0307407_10069136 | Ga0307407_100691362 | 210 |
| 272 | 3300031903 | Ga0307407_10267050 | Ga0307407_102670502 | 210 |
| 273 | 3300031911 | Ga0307412_10054620 | Ga0307412_100546202 | 210 |
| 274 | 3300031995 | Ga0307409_100000437 | Ga0307409_1000004372 | 210 |
| 275 | 3300032002 | Ga0307416_100001161 | Ga0307416_10000116110 | 210 |
| 276 | 3300032002 | Ga0307416_100087642 | Ga0307416_1000876422 | 210 |
| 277 | 3300032002 | Ga0307416_100110638 | Ga0307416_1001106384 | 210 |
| 278 | 3300032126 | Ga0307415_100000190 | Ga0307415_10000019015 | 210 |
| 279 | 3300033180 | Ga0307510_10348285 | Ga0307510_103482851 | 210 |
| 280 | 3300035114 | Ga0373939_0046863 | Ga0373939_0046863_491_1138 | 210 |
| 281 | 3300035242 | Ga0373962_0000172 | Ga0373962_0000172_5577_6227 | 210 |
| 282 | 3300035692 | Ga0373935_0100549 | Ga0373935_0100549_1156_1803 | 210 |
| 283 | 3300037418 | Ga0395900_0068602 | Ga0395900_0068602_484_1131 | 210 |
| 284 | 3300045976 | Ga0466967_0262690 | Ga0466967_0262690_880_1530 | 210 |
| 285 | 3300046519 | Ga0495632_0011770 | Ga0495632_0011770_3893_4540 | 210 |
| 286 | 3300048911 | Ga0496108_0000048 | Ga0496108_0000048_35951_36598 | 210 |
| 287 | 3300050491 | nmdc:mga00v17_29927_c1 | nmdc:mga00v17_29927_c1_49_684 | 210 |
| 288 | 3300053088 | Ga0500644_0172944 | Ga0500644_0172944_83_730 | 210 |
| 289 | 3300053093 | Ga0500651_0109001 | Ga0500651_0109001_700_1347 | 210 |
| 290 | 3300053096 | Ga0500641_0006753 | Ga0500641_0006753_1444_2091 | 210 |
| 291 | 3300053098 | Ga0500650_0042201 | Ga0500650_0042201_522_1169 | 210 |
| 292 | 3300053109 | Ga0500569_007025 | Ga0500569_007025_1710_2357 | 210 |
| 293 | 3300053118 | Ga0500594_0003735 | Ga0500594_0003735_1532_2179 | 210 |
| 294 | 3300053126 | Ga0500621_051329 | Ga0500621_051329_577_1224 | 210 |
| 295 | 3300053131 | Ga0500652_004425 | Ga0500652_004425_2285_2932 | 210 |
| 296 | 3300059647 | Ga0587079_062311 | Ga0587079_062311_76_723 | 210 |
| 297 | 3300037853 | Ga0436364_0810988 | Ga0436364_0810988_158_808 | 211 |
| 298 | 3300046519 | Ga0495632_0233035 | Ga0495632_0233035_80_730 | 211 |
| 299 | 3300031995 | Ga0307409_100207330 | Ga0307409_1002073302 | 212 |
| 300 | 3300032126 | Ga0307415_100027773 | Ga0307415_1000277735 | 212 |
| 301 | 3300041451 | Ga0451791_0836473 | Ga0451791_0836473_648_1304 | 212 |
| 302 | 3300003203 | JGI25406J46586_10016792 | JGI25406J46586_100167922 | 213 |
| 303 | 3300005985 | Ga0081539_10000613 | Ga0081539_100006132 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n31-assembly1.cif.gz_A | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7999 | 37 | 188 |
| 4n31-assembly1.cif.gz_B | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7799 | 37 | 188 |
| 4wvg-assembly1.cif.gz_A | crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb). | 0.765 | 38 | 193 |
| 4wvi-assembly1.cif.gz_A | crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb) in complex with a substrate peptide (pep2). | 0.732 | 38 | 205 |
| 4n31-assembly1.cif.gz_B | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7274 | 37 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q96LU5_28_157_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8781 | 37 | 204 | 2.10.109.10 |
| af_O74800_20_156_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8661 | 34 | 203 | 2.10.109.10 |
| af_Q96LU5_28_157_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8654 | 37 | 204 | 2.10.109.10 |
| af_Q54RP1_162_281_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8582 | 33 | 188 | 2.10.109.10 |
| af_A0A1D6L5X4_1_100_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.8581 | 52 | 188 | 2.10.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M8XZN0-F1-model_v4 | deleted | 0.9769 | 21 | 213 |
|
| AF-A0A7W7H9X5-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9709 | 27 | 212 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A0M8XZN0-F1-model_v4 | deleted | 0.9621 | 21 | 213 |
|
| AF-A0A4S8Q690-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.9407 | 1 | 212 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A1S2JKA2-F1-model_v4 | deleted | 0.9394 | 49 | 203 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar