F397240

General Info

Members Datasets Scaffolds Average Seq Length
303 195 264 235

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0268725|Ga0496102_0268725_500_1198
Length 232
Sequence VIDEQTSKPRSSFWRELPFLLGVAILVAVLVRAFVLQTFYIPSPSMQHTLELQDRVLVNKLVYDFRDPHRGEIIVFKSPLDWRSDPSEEDFIKRVIGVAGDHVICCDAKGRITVNEQPLDETSYLYTDSTGQQSAPSDIKFDVVVPDGRIFVLGDNRGESRDSRCHLNDPGTLKGENAFVSEDLVVGRAIAVAWPLADAARLPIPTTYDSVPPGKTPAPSTPEIHAGADANC

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
8 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
9 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
10 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
11 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
12 2855683550 Micromonospora sp. RP3T Isolate Unclassified
13 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
14 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
15 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
16 2858868258 Micromonospora sp. MH33 Isolate Unclassified
17 2858882152 Micromonospora noduli MED15 Isolate Nodule
18 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
19 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
20 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
21 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
22 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
23 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
24 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
25 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
26 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
27 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
28 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
29 2902582711 Micromonospora sp. AP08 Isolate Unclassified
30 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
31 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
32 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
153 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
184 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
185 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
186 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 649633069 Micromonospora sp. L5 Isolate Unclassified
190 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
191 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
192 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
193 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
194 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
195 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.8
Metatranscriptomes 0.33
Isolates 12.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 1.98
Rhizoplane 3.96
Rhizosphere 79.21
Stem 0
Stem Tuber 0
Unclassified 11.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10016792 3300003203 Bacteria 3042
2 JGI25406J46586_10070632 3300003203 Bacteria 1097
3 rootH1_10052087 3300003316 Bacteria 1463
4 Ga0070658_10683394 3300005327 Bacteria 891
5 Ga0070683_100001322 3300005329 Bacteria 18864
6 Ga0068869_100197625 3300005334 Bacteria 1584
7 Ga0068868_100329609 3300005338 Bacteria 1303
8 Ga0070660_100253337 3300005339 Bacteria 1436
9 Ga0070691_10095689 3300005341 Bacteria 1469
10 Ga0070668_100003831 3300005347 Bacteria 11117
11 Ga0070668_100027673 3300005347 Bacteria 4304
12 Ga0070668_100142166 3300005347 Bacteria 1935
13 Ga0070671_100256222 3300005355 Bacteria 1487
14 Ga0070659_100014895 3300005366 Bacteria 5816
15 Ga0070667_100019814 3300005367 Bacteria 5581
16 Ga0070713_100087336 3300005436 Bacteria 2675
17 Ga0070700_100087159 3300005441 Bacteria 2029
18 Ga0068867_100019169 3300005459 Bacteria 4873
19 Ga0070679_101201272 3300005530 Bacteria 704
20 Ga0070684_100080600 3300005535 Bacteria 2880
21 Ga0070684_100084689 3300005535 Bacteria 2810
22 Ga0068853_100153330 3300005539 Bacteria 2075
23 Ga0068853_100174374 3300005539 Bacteria 1947
24 Ga0068855_100231443 3300005563 Bacteria 2069
25 Ga0070664_100047832 3300005564 Bacteria 3615
26 Ga0068857_100067307 3300005577 Bacteria 3188
27 Ga0068857_100069115 3300005577 Bacteria 3145
28 Ga0068856_100342554 3300005614 Bacteria 1513
29 Ga0068856_100605157 3300005614 Bacteria 1117
30 Ga0068864_100003346 3300005618 Bacteria 13256
31 Ga0068866_10062601 3300005718 Bacteria 1936
32 Ga0068861_100027982 3300005719 Bacteria 4111
33 Ga0068861_100157331 3300005719 Bacteria 1871
34 Ga0068861_100280312 3300005719 Bacteria 1435
35 Ga0068863_100135730 3300005841 Bacteria 2350
36 Ga0068863_100426525 3300005841 Bacteria 1299
37 Ga0068860_100243724 3300005843 Bacteria 1749
38 Ga0068860_100453106 3300005843 Bacteria 1276
39 Ga0068862_100064819 3300005844 Bacteria 3146
40 Ga0068862_100115317 3300005844 Bacteria 2362
41 Ga0081455_10000117 3300005937 Bacteria 91308
42 Ga0081455_10002874 3300005937 Bacteria 20265
43 Ga0081455_10015769 3300005937 Bacteria 7320
44 Ga0081455_10150662 3300005937 Bacteria 1794
45 Ga0081538_10049604 3300005981 Bacteria 2545
46 Ga0081540_1008507 3300005983 Bacteria 7163
47 Ga0081539_10000613 3300005985 Bacteria 72150
48 Ga0081539_10004121 3300005985 Bacteria 16553
49 Ga0081539_10017055 3300005985 Bacteria 5129
50 Ga0081539_10021053 3300005985 Bacteria 4374
51 Ga0081539_10173333 3300005985 Bacteria 1018
52 Ga0075364_10038009 3300006051 Bacteria 3119
53 Ga0075432_10000257 3300006058 Bacteria 14537
54 Ga0075432_10000605 3300006058 Bacteria 10873
55 Ga0070716_100276233 3300006173 Bacteria 1157
56 Ga0070712_100061884 3300006175 Bacteria 2645
57 Ga0075428_100000650 3300006844 Bacteria 35770
58 Ga0075428_100004381 3300006844 Bacteria 15581
59 Ga0075428_100041843 3300006844 Bacteria 5038
60 Ga0075428_100046365 3300006844 Bacteria 4774
61 Ga0075428_100080880 3300006844 Bacteria 3546
62 Ga0075430_100002384 3300006846 Bacteria 15616
63 Ga0075430_100007033 3300006846 Bacteria 9487
64 Ga0075430_100132196 3300006846 Bacteria 2080
65 Ga0075431_100013458 3300006847 Bacteria 8262
66 Ga0075431_100033264 3300006847 Bacteria 5314
67 Ga0075433_10000376 3300006852 Bacteria 28135
68 Ga0075433_10002577 3300006852 Bacteria 13817
69 Ga0075434_100001579 3300006871 Bacteria 19302
70 Ga0075434_100004645 3300006871 Bacteria 12415
71 Ga0075429_100014321 3300006880 Bacteria 6878
72 Ga0075429_100024272 3300006880 Bacteria 5260
73 Ga0075429_100026795 3300006880 Bacteria 5004
74 Ga0075429_100028910 3300006880 Bacteria 4815
75 Ga0068865_100063408 3300006881 Bacteria 2597
76 Ga0068865_100115032 3300006881 Bacteria 1990
77 Ga0075436_100000378 3300006914 Bacteria 28438
78 Ga0075436_100058162 3300006914 Bacteria 2670
79 Ga0075435_100004207 3300007076 Bacteria 9877
80 Ga0075435_100044526 3300007076 Bacteria 3554
81 Ga0111539_10002609 3300009094 Bacteria 23891
82 Ga0111539_10047446 3300009094 Bacteria 5133
83 Ga0111539_10496800 3300009094 Bacteria 1421
84 Ga0105247_10249459 3300009101 Bacteria 1213
85 Ga0114129_10000082 3300009147 Bacteria 88174
86 Ga0114129_10006488 3300009147 Bacteria 16596
87 Ga0114129_10088909 3300009147 Bacteria 4282
88 Ga0114129_10238953 3300009147 Bacteria 2443
89 Ga0105243_10044232 3300009148 Bacteria 3493
90 Ga0105243_10197088 3300009148 Bacteria 1763
91 Ga0105243_10657086 3300009148 Bacteria 1017
92 Ga0105242_10011595 3300009176 Bacteria 6779
93 Ga0105242_10181730 3300009176 Bacteria 1856
94 Ga0105237_10333135 3300009545 Bacteria 1522
95 Ga0105237_10549632 3300009545 Bacteria 1161
96 Ga0105238_10367158 3300009551 Bacteria 1429
97 Ga0105249_10025834 3300009553 Bacteria 5289
98 Ga0157342_1001149 3300012507 Bacteria 1873
99 Ga0157372_10029314 3300013307 Bacteria 6008
100 Ga0157372_10100256 3300013307 Bacteria 3305
101 Ga0163163_10106912 3300014325 Bacteria 2824
102 Ga0163163_10343943 3300014325 Bacteria 1547
103 Ga0157380_10529167 3300014326 Bacteria 1151
104 Ga0157376_11212568 3300014969 Bacteria 783
105 Ga0163161_10104244 3300017792 Bacteria 2114
106 Ga0207688_10032378 3300025901 Bacteria 2889
107 Ga0207649_10622469 3300025920 Bacteria 832
108 Ga0207652_10915689 3300025921 Bacteria 774
109 Ga0207687_10125868 3300025927 Bacteria 1924
110 Ga0207700_10130626 3300025928 Bacteria 2050
111 Ga0207644_10067789 3300025931 Bacteria 2602
112 Ga0207690_10040689 3300025932 Bacteria 3041
113 Ga0207706_10034552 3300025933 Bacteria 4497
114 Ga0207706_10094157 3300025933 Bacteria 2635
115 Ga0207686_10033090 3300025934 Bacteria 3083
116 Ga0207686_10140613 3300025934 Bacteria 1668
117 Ga0207709_10012902 3300025935 Bacteria 4608
118 Ga0207709_10243495 3300025935 Bacteria 1309
119 Ga0207709_10523843 3300025935 Bacteria 928
120 Ga0207704_10027444 3300025938 Bacteria 3142
121 Ga0207704_10064350 3300025938 Bacteria 2291
122 Ga0207665_10162700 3300025939 Bacteria 1606
123 Ga0207691_10324978 3300025940 Bacteria 1318
124 Ga0207711_10160053 3300025941 Bacteria 2037
125 Ga0207689_10258458 3300025942 Bacteria 1441
126 Ga0207661_10004856 3300025944 Bacteria 9420
127 Ga0207679_10207026 3300025945 Bacteria 1643
128 Ga0207667_10648371 3300025949 Bacteria 1062
129 Ga0207668_10002358 3300025972 Bacteria 11036
130 Ga0207658_10017469 3300025986 Bacteria 4944
131 Ga0207639_10158474 3300026041 Bacteria 1905
132 Ga0207708_10121849 3300026075 Bacteria 2032
133 Ga0207641_10214802 3300026088 Bacteria 1780
134 Ga0207648_10028483 3300026089 Bacteria 4951
135 Ga0207676_10195473 3300026095 Bacteria 1783
136 Ga0207674_10063758 3300026116 Bacteria 3718
137 Ga0207674_10151407 3300026116 Bacteria 2277
138 Ga0207675_100005342 3300026118 Bacteria 12344
139 Ga0207675_100418639 3300026118 Bacteria 1323
140 Ga0207428_10002093 3300027907 Bacteria 20115
141 Ga0207428_10005110 3300027907 Bacteria 12316
142 Ga0268266_10141064 3300028379 Bacteria 2163
143 Ga0268265_10132600 3300028380 Bacteria 2073
144 Ga0268265_10206449 3300028380 Bacteria 1708
145 Ga0268264_10035833 3300028381 Bacteria 4085
146 Ga0268264_10384965 3300028381 Bacteria 1344
147 Ga0307515_10015993 3300028794 Bacteria 13773
148 Ga0307515_10032705 3300028794 Bacteria 8600
149 Ga0307512_10007169 3300030522 Bacteria 11093
150 Ga0307512_10112069 3300030522 Bacteria 1792
151 Ga0307513_10005290 3300031456 Bacteria 17083
152 Ga0307509_10129915 3300031507 Bacteria 2477
153 Ga0307408_100009037 3300031548 Bacteria 6582
154 Ga0307408_100036992 3300031548 Bacteria 3435
155 Ga0307508_10001514 3300031616 Bacteria 25941
156 Ga0307508_10018782 3300031616 Bacteria 6283
157 Ga0307508_10027035 3300031616 Bacteria 5198
158 Ga0307405_10034653 3300031731 Bacteria 3006
159 Ga0307405_10057729 3300031731 Bacteria 2439
160 Ga0307405_10144308 3300031731 Bacteria 1665
161 Ga0307405_10246298 3300031731 Bacteria 1327
162 Ga0307405_10438592 3300031731 Bacteria 1032
163 Ga0307413_10003453 3300031824 Bacteria 6654
164 Ga0307413_10018733 3300031824 Bacteria 3639
165 Ga0307413_10557769 3300031824 Bacteria 930
166 Ga0307410_10007316 3300031852 Bacteria 6035
167 Ga0307410_10028241 3300031852 Bacteria 3556
168 Ga0307410_10029560 3300031852 Bacteria 3491
169 Ga0307410_10039952 3300031852 Bacteria 3084
170 Ga0326468_10000643 3300031889 Bacteria 3589
171 Ga0307406_10000612 3300031901 Bacteria 20402
172 Ga0307406_10002273 3300031901 Bacteria 10449
173 Ga0307406_10029630 3300031901 Bacteria 3315
174 Ga0307406_10089697 3300031901 Bacteria 2066
175 Ga0307406_10310747 3300031901 Bacteria 1215
176 Ga0307407_10001808 3300031903 Bacteria 8012
177 Ga0307407_10025696 3300031903 Bacteria 3107
178 Ga0307407_10069136 3300031903 Bacteria 2095
179 Ga0307407_10267050 3300031903 Bacteria 1179
180 Ga0307412_10022858 3300031911 Bacteria 3840
181 Ga0307412_10054620 3300031911 Bacteria 2652
182 Ga0307412_10143059 3300031911 Bacteria 1754
183 Ga0307409_100000177 3300031995 Bacteria 24831
184 Ga0307409_100000437 3300031995 Bacteria 17686
185 Ga0307409_100207330 3300031995 Bacteria 1759
186 Ga0307409_100579301 3300031995 Bacteria 1106
187 Ga0307416_100000144 3300032002 Bacteria 41697
188 Ga0307416_100001161 3300032002 Bacteria 14156
189 Ga0307416_100087642 3300032002 Bacteria 2658
190 Ga0307416_100101846 3300032002 Bacteria 2502
191 Ga0307416_100110638 3300032002 Bacteria 2419
192 Ga0307416_100211482 3300032002 Bacteria 1851
193 Ga0307414_10046149 3300032004 Bacteria 2988
194 Ga0307414_10106782 3300032004 Bacteria 2120
195 Ga0307411_10010013 3300032005 Bacteria 5025
196 Ga0307411_10011528 3300032005 Bacteria 4777
197 Ga0307415_100000190 3300032126 Bacteria 27293
198 Ga0307415_100000923 3300032126 Bacteria 13447
199 Ga0307415_100004484 3300032126 Bacteria 7252
200 Ga0307415_100027773 3300032126 Bacteria 3590
201 Ga0307415_100038836 3300032126 Bacteria 3141
202 Ga0307510_10348285 3300033180 Bacteria 932
203 Ga0373939_0046863 3300035114 Bacteria 1325
204 Ga0373962_0000172 3300035242 Bacteria 13751
205 Ga0373935_0100549 3300035692 Bacteria 1905
206 Ga0395899_0037634 3300037312 Bacteria 3627
207 Ga0395900_0006872 3300037418 Bacteria 11801
208 Ga0395900_0068602 3300037418 Bacteria 3644
209 Ga0395898_0005950 3300037466 Bacteria 13092
210 Ga0395905_0006430 3300037471 Bacteria 11830
211 Ga0436364_0810988 3300037853 Bacteria 1016
212 Ga0395901_0009122 3300038443 Bacteria 10045
213 Ga0451791_0836473 3300041451 Bacteria 3749
214 Ga0439463_002961 3300042016 Bacteria 4310
215 Ga0450888_002687 3300042126 Bacteria 1764
216 Ga0466967_0262690 3300045976 Bacteria 1652
217 Ga0495603_0034009 3300046455 Bacteria 3066
218 Ga0495629_0075964 3300046459 Bacteria 2346
219 Ga0495584_0121102 3300046491 Bacteria 1325
220 Ga0495631_0120232 3300046518 Bacteria 1130
221 Ga0495632_0011770 3300046519 Bacteria 5091
222 Ga0495632_0233035 3300046519 Bacteria 830
223 Ga0495670_0052242 3300046691 Bacteria 2046
224 Ga0496102_0268725 3300048905 Bacteria 1608
225 Ga0496104_0108085 3300048907 Bacteria 2665
226 Ga0496105_0051774 3300048908 Bacteria 3391
227 Ga0496108_0000048 3300048911 Bacteria 133539
228 Ga0496108_0013100 3300048911 Bacteria 6760
229 Ga0496109_0010985 3300048912 Bacteria 7759
230 Ga0496109_0172865 3300048912 Bacteria 2027
231 Ga0496110_0332226 3300048913 Bacteria 1385
232 Ga0496111_0013992 3300048914 Bacteria 5471
233 Ga0496112_0015312 3300048915 Bacteria 7151
234 Ga0496113_0001480 3300048916 Bacteria 13119
235 nmdc:mga00v17_29927_c1 3300050491 Bacteria 3198
236 nmdc:mga05p37_126_c1 3300050507 Bacteria 69639
237 nmdc:mga05p37_138655_c1 3300050507 Bacteria 2981
238 nmdc:mga05p37_3246_c1 3300050507 Bacteria 18936
239 nmdc:mga09592_12_c1 3300050508 Bacteria 104148
240 nmdc:mga09592_30488_c1 3300050508 Bacteria 4488
241 nmdc:mga09592_52251_c1 3300050508 Bacteria 3449
242 nmdc:mga09592_5401_c1 3300050508 Bacteria 10389
243 nmdc:mga0qj67_140033_c1 3300050509 Bacteria 1961
244 nmdc:mga0qj67_26976_c1 3300050509 Bacteria 4449
245 nmdc:mga0qj67_6_c2 3300050509 Bacteria 123818
246 nmdc:mga06r32_10_c1 3300050510 Bacteria 113242
247 nmdc:mga06r32_38330_c1 3300050510 Bacteria 4541
248 nmdc:mga06r32_628540_c1 3300050510 Bacteria 1043
249 nmdc:mga08y16_1650_c1 3300050511 Bacteria 22607
250 nmdc:mga08y16_443031_c1 3300050511 Bacteria 1325
251 nmdc:mga0n895_13990_c1 3300050512 Bacteria 7267
252 nmdc:mga0n895_1625_c1 3300050512 Bacteria 16963
253 nmdc:mga0rr50_14563_c1 3300050513 Bacteria 5164
254 nmdc:mga08x19_3323_c1 3300050514 Bacteria 9619
255 nmdc:mga0a205_10147_c1 3300050515 Bacteria 8648
256 Ga0500644_0172944 3300053088 Bacteria 879
257 Ga0500651_0109001 3300053093 Bacteria 1691
258 Ga0500641_0006753 3300053096 Bacteria 4082
259 Ga0500650_0042201 3300053098 Bacteria 2107
260 Ga0500569_007025 3300053109 Bacteria 2505
261 Ga0500594_0003735 3300053118 Bacteria 3354
262 Ga0500621_051329 3300053126 Bacteria 1669
263 Ga0500652_004425 3300053131 Bacteria 4351
264 Ga0587079_062311 3300059647 Bacteria 811

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0172865 Ga0496109_0172865_1367_2008 166
2 3300025935 Ga0207709_10523843 Ga0207709_105238432 180
3 3300005937 Ga0081455_10002874 Ga0081455_100028743 183
4 3300005614 Ga0068856_100605157 Ga0068856_1006051572 184
5 3300014325 Ga0163163_10343943 Ga0163163_103439432 185
6 3300046455 Ga0495603_0034009 Ga0495603_0034009_2287_2976 185
7 3300005459 Ga0068867_100019169 Ga0068867_1000191694 193
8 3300012507 Ga0157342_1001149 Ga0157342_10011493 193
9 3300005329 Ga0070683_100001322 Ga0070683_10000132214 199
10 3300005535 Ga0070684_100080600 Ga0070684_1000806003 199
11 3300005577 Ga0068857_100069115 Ga0068857_1000691154 199
12 3300025944 Ga0207661_10004856 Ga0207661_1000485613 199
13 3300026116 Ga0207674_10063758 Ga0207674_100637583 199
14 3300005614 Ga0068856_100342554 Ga0068856_1003425542 200
15 3300013307 Ga0157372_10100256 Ga0157372_101002564 200
16 3300032126 Ga0307415_100038836 Ga0307415_1000388364 201
17 iso_pu_bacteria 2622736626 2623587221 201
18 3300005347 Ga0070668_100142166 Ga0070668_1001421663 202
19 3300005937 Ga0081455_10000117 Ga0081455_1000011770 202
20 3300006844 Ga0075428_100046365 Ga0075428_1000463653 202
21 3300006844 Ga0075428_100080880 Ga0075428_1000808802 202
22 3300006846 Ga0075430_100132196 Ga0075430_1001321961 202
23 3300009148 Ga0105243_10197088 Ga0105243_101970882 202
24 3300048913 Ga0496110_0332226 Ga0496110_0332226_197_1045 202
25 iso_pu_bacteria 2501939600 2501941384 202
26 iso_pu_bacteria 2855683550 2855689275 202
27 iso_pu_bacteria 2856858025 2856861056 202
28 iso_pu_bacteria 2858868258 2858869418 202
29 iso_pu_bacteria 2902582711 2902588027 202
30 iso_pu_bacteria 2996221748 2996222776 202
31 iso_pu_bacteria 649633069 649811804 202
32 iso_pu_bacteria 8055412473 8055417504 202
33 3300005339 Ga0070660_100253337 Ga0070660_1002533371 203
34 3300005341 Ga0070691_10095689 Ga0070691_100956892 203
35 3300005347 Ga0070668_100027673 Ga0070668_1000276734 203
36 3300005366 Ga0070659_100014895 Ga0070659_1000148952 203
37 3300005441 Ga0070700_100087159 Ga0070700_1000871592 203
38 3300005539 Ga0068853_100153330 Ga0068853_1001533302 203
39 3300005539 Ga0068853_100174374 Ga0068853_1001743742 203
40 3300005563 Ga0068855_100231443 Ga0068855_1002314432 203
41 3300005718 Ga0068866_10062601 Ga0068866_100626012 203
42 3300005719 Ga0068861_100027982 Ga0068861_1000279823 203
43 3300005843 Ga0068860_100453106 Ga0068860_1004531062 203
44 3300005937 Ga0081455_10015769 Ga0081455_1001576911 203
45 3300005937 Ga0081455_10150662 Ga0081455_101506622 203
46 3300005981 Ga0081538_10049604 Ga0081538_100496042 203
47 3300006058 Ga0075432_10000257 Ga0075432_100002579 203
48 3300006058 Ga0075432_10000605 Ga0075432_1000060511 203
49 3300006852 Ga0075433_10000376 Ga0075433_1000037621 203
50 3300006852 Ga0075433_10002577 Ga0075433_1000257711 203
51 3300006871 Ga0075434_100001579 Ga0075434_1000015799 203
52 3300006871 Ga0075434_100004645 Ga0075434_1000046456 203
53 3300006880 Ga0075429_100028910 Ga0075429_1000289103 203
54 3300006881 Ga0068865_100063408 Ga0068865_1000634083 203
55 3300006881 Ga0068865_100115032 Ga0068865_1001150322 203
56 3300006914 Ga0075436_100000378 Ga0075436_10000037823 203
57 3300006914 Ga0075436_100058162 Ga0075436_1000581623 203
58 3300007076 Ga0075435_100004207 Ga0075435_1000042077 203
59 3300007076 Ga0075435_100044526 Ga0075435_1000445262 203
60 3300009094 Ga0111539_10002609 Ga0111539_1000260918 203
61 3300009094 Ga0111539_10047446 Ga0111539_100474466 203
62 3300009094 Ga0111539_10496800 Ga0111539_104968002 203
63 3300009147 Ga0114129_10238953 Ga0114129_102389532 203
64 3300009148 Ga0105243_10044232 Ga0105243_100442322 203
65 3300009176 Ga0105242_10011595 Ga0105242_100115954 203
66 3300009176 Ga0105242_10181730 Ga0105242_101817303 203
67 3300009553 Ga0105249_10025834 Ga0105249_100258346 203
68 3300013307 Ga0157372_10029314 Ga0157372_100293144 203
69 3300017792 Ga0163161_10104244 Ga0163161_101042443 203
70 3300025901 Ga0207688_10032378 Ga0207688_100323782 203
71 3300025927 Ga0207687_10125868 Ga0207687_101258682 203
72 3300025932 Ga0207690_10040689 Ga0207690_100406892 203
73 3300025933 Ga0207706_10034552 Ga0207706_100345525 203
74 3300025933 Ga0207706_10094157 Ga0207706_100941573 203
75 3300025934 Ga0207686_10033090 Ga0207686_100330902 203
76 3300025934 Ga0207686_10140613 Ga0207686_101406131 203
77 3300025935 Ga0207709_10012902 Ga0207709_100129025 203
78 3300025935 Ga0207709_10243495 Ga0207709_102434952 203
79 3300025938 Ga0207704_10027444 Ga0207704_100274442 203
80 3300025938 Ga0207704_10064350 Ga0207704_100643502 203
81 3300025942 Ga0207689_10258458 Ga0207689_102584582 203
82 3300026041 Ga0207639_10158474 Ga0207639_101584742 203
83 3300026075 Ga0207708_10121849 Ga0207708_101218492 203
84 3300026089 Ga0207648_10028483 Ga0207648_100284834 203
85 3300026118 Ga0207675_100005342 Ga0207675_1000053426 203
86 3300027907 Ga0207428_10002093 Ga0207428_1000209317 203
87 3300027907 Ga0207428_10005110 Ga0207428_100051104 203
88 3300028381 Ga0268264_10384965 Ga0268264_103849652 203
89 3300031548 Ga0307408_100009037 Ga0307408_1000090374 203
90 3300031731 Ga0307405_10034653 Ga0307405_100346532 203
91 3300031731 Ga0307405_10246298 Ga0307405_102462981 203
92 3300031824 Ga0307413_10003453 Ga0307413_100034535 203
93 3300031824 Ga0307413_10018733 Ga0307413_100187335 203
94 3300031852 Ga0307410_10028241 Ga0307410_100282413 203
95 3300031852 Ga0307410_10039952 Ga0307410_100399522 203
96 3300031901 Ga0307406_10000612 Ga0307406_1000061210 203
97 3300031901 Ga0307406_10089697 Ga0307406_100896973 203
98 3300031903 Ga0307407_10001808 Ga0307407_100018088 203
99 3300031903 Ga0307407_10025696 Ga0307407_100256963 203
100 3300031911 Ga0307412_10022858 Ga0307412_100228583 203
101 3300031911 Ga0307412_10143059 Ga0307412_101430592 203
102 3300031995 Ga0307409_100000177 Ga0307409_10000017713 203
103 3300031995 Ga0307409_100579301 Ga0307409_1005793012 203
104 3300032002 Ga0307416_100000144 Ga0307416_10000014418 203
105 3300032002 Ga0307416_100101846 Ga0307416_1001018463 203
106 3300032004 Ga0307414_10046149 Ga0307414_100461493 203
107 3300032004 Ga0307414_10106782 Ga0307414_101067822 203
108 3300032005 Ga0307411_10010013 Ga0307411_100100133 203
109 3300032005 Ga0307411_10011528 Ga0307411_100115283 203
110 3300032126 Ga0307415_100000923 Ga0307415_1000009236 203
111 3300042016 Ga0439463_002961 Ga0439463_002961_2935_3786 203
112 3300042126 Ga0450888_002687 Ga0450888_002687_462_1304 203
113 3300046491 Ga0495584_0121102 Ga0495584_0121102_138_986 203
114 3300046518 Ga0495631_0120232 Ga0495631_0120232_11_859 203
115 3300046691 Ga0495670_0052242 Ga0495670_0052242_970_1818 203
116 3300050508 nmdc:mga09592_5401_c1 nmdc:mga09592_5401_c1_2549_3394 203
117 3300050509 nmdc:mga0qj67_140033_c1 nmdc:mga0qj67_140033_c1_966_1811 203
118 3300050511 nmdc:mga08y16_1650_c1 nmdc:mga08y16_1650_c1_16256_17107 203
119 3300050511 nmdc:mga08y16_443031_c1 nmdc:mga08y16_443031_c1_336_1187 203
120 3300050512 nmdc:mga0n895_13990_c1 nmdc:mga0n895_13990_c1_3596_4441 203
121 3300050512 nmdc:mga0n895_1625_c1 nmdc:mga0n895_1625_c1_4139_4990 203
122 3300050513 nmdc:mga0rr50_14563_c1 nmdc:mga0rr50_14563_c1_2386_3237 203
123 3300050514 nmdc:mga08x19_3323_c1 nmdc:mga08x19_3323_c1_2023_2874 203
124 3300050515 nmdc:mga0a205_10147_c1 nmdc:mga0a205_10147_c1_584_1435 203
125 iso_pu_bacteria 2515154129 2515719795 204
126 iso_pu_bacteria 2515154202 2516082345 204
127 iso_pu_bacteria 2867302475 2867304861 205
128 iso_pu_bacteria 2867312974 2867315648 205
129 iso_pu_bacteria 2867319477 2867324386 205
130 iso_pu_bacteria 2515154088 2515496024 206
131 iso_pu_bacteria 2515154137 2515757862 206
132 iso_pu_bacteria 2515154203 2516090288 206
133 iso_pu_bacteria 2751185782 2753264711 206
134 iso_pu_bacteria 2772190715 2772642637 206
135 iso_pu_bacteria 2855670206 2855671065 206
136 iso_pu_bacteria 2855676851 2855682261 206
137 iso_pu_bacteria 2857288857 2857290055 206
138 iso_pu_bacteria 2858848962 2858852986 206
139 iso_pu_bacteria 2858882152 2858884078 206
140 iso_pu_bacteria 2858888857 2858889767 206
141 iso_pu_bacteria 2858895516 2858896686 206
142 iso_pu_bacteria 2858902515 2858903780 206
143 iso_pu_bacteria 2869048445 2869050379 206
144 iso_pu_bacteria 2869061728 2869062841 206
145 iso_pu_bacteria 2869068681 2869073605 206
146 iso_pu_bacteria 2880489317 2880493049 206
147 iso_pu_bacteria 2880495981 2880499254 206
148 iso_pu_bacteria 2929219909 2929221239 206
149 iso_pu_bacteria 2929226422 2929227853 206
150 iso_pu_bacteria 8003830390 8003832318 206
151 iso_pu_bacteria 8003870546 8003876357 206
152 iso_pu_bacteria 8054704163 8054707536 206
153 iso_pu_bacteria 8054727385 8054731901 206
154 iso_pu_bacteria 8054734606 8054739162 206
155 3300048905 Ga0496102_0268725 Ga0496102_0268725_500_1198 207
156 3300005436 Ga0070713_100087336 Ga0070713_1000873363 208
157 3300005535 Ga0070684_100084689 Ga0070684_1000846892 208
158 3300005564 Ga0070664_100047832 Ga0070664_1000478322 208
159 3300005577 Ga0068857_100067307 Ga0068857_1000673074 208
160 3300005618 Ga0068864_100003346 Ga0068864_10000334614 208
161 3300005841 Ga0068863_100135730 Ga0068863_1001357301 208
162 3300006173 Ga0070716_100276233 Ga0070716_1002762332 208
163 3300006175 Ga0070712_100061884 Ga0070712_1000618842 208
164 3300009545 Ga0105237_10333135 Ga0105237_103331352 208
165 3300009551 Ga0105238_10367158 Ga0105238_103671582 208
166 3300014325 Ga0163163_10106912 Ga0163163_101069122 208
167 3300025928 Ga0207700_10130626 Ga0207700_101306262 208
168 3300025939 Ga0207665_10162700 Ga0207665_101627002 208
169 3300025941 Ga0207711_10160053 Ga0207711_101600532 208
170 3300025945 Ga0207679_10207026 Ga0207679_102070262 208
171 3300025949 Ga0207667_10648371 Ga0207667_106483712 208
172 3300026088 Ga0207641_10214802 Ga0207641_102148023 208
173 3300026095 Ga0207676_10195473 Ga0207676_101954731 208
174 3300026116 Ga0207674_10151407 Ga0207674_101514072 208
175 3300037312 Ga0395899_0037634 Ga0395899_0037634_1341_1970 208
176 3300037418 Ga0395900_0006872 Ga0395900_0006872_4063_4692 208
177 3300037466 Ga0395898_0005950 Ga0395898_0005950_6437_7066 208
178 3300037471 Ga0395905_0006430 Ga0395905_0006430_7812_8441 208
179 3300038443 Ga0395901_0009122 Ga0395901_0009122_6023_6652 208
180 3300046459 Ga0495629_0075964 Ga0495629_0075964_469_1098 208
181 3300048907 Ga0496104_0108085 Ga0496104_0108085_63_692 208
182 3300048908 Ga0496105_0051774 Ga0496105_0051774_2498_3127 208
183 3300048911 Ga0496108_0013100 Ga0496108_0013100_6073_6702 208
184 3300048912 Ga0496109_0010985 Ga0496109_0010985_5508_6137 208
185 3300048914 Ga0496111_0013992 Ga0496111_0013992_4418_5047 208
186 3300048915 Ga0496112_0015312 Ga0496112_0015312_962_1591 208
187 3300048916 Ga0496113_0001480 Ga0496113_0001480_7913_8542 208
188 3300005334 Ga0068869_100197625 Ga0068869_1001976252 209
189 3300005347 Ga0070668_100003831 Ga0070668_10000383113 209
190 3300005719 Ga0068861_100280312 Ga0068861_1002803123 209
191 3300005844 Ga0068862_100115317 Ga0068862_1001153174 209
192 3300005985 Ga0081539_10173333 Ga0081539_101733332 209
193 3300006844 Ga0075428_100000650 Ga0075428_10000065012 209
194 3300006844 Ga0075428_100004381 Ga0075428_10000438110 209
195 3300006846 Ga0075430_100002384 Ga0075430_10000238410 209
196 3300006846 Ga0075430_100007033 Ga0075430_10000703311 209
197 3300006847 Ga0075431_100013458 Ga0075431_1000134589 209
198 3300006847 Ga0075431_100033264 Ga0075431_1000332646 209
199 3300006880 Ga0075429_100014321 Ga0075429_1000143214 209
200 3300006880 Ga0075429_100024272 Ga0075429_1000242722 209
201 3300006880 Ga0075429_100026795 Ga0075429_1000267952 209
202 3300009147 Ga0114129_10000082 Ga0114129_1000008220 209
203 3300009147 Ga0114129_10006488 Ga0114129_100064888 209
204 3300009147 Ga0114129_10088909 Ga0114129_100889094 209
205 3300009545 Ga0105237_10549632 Ga0105237_105496321 209
206 3300025972 Ga0207668_10002358 Ga0207668_100023583 209
207 3300026118 Ga0207675_100418639 Ga0207675_1004186392 209
208 3300028380 Ga0268265_10206449 Ga0268265_102064491 209
209 3300031616 Ga0307508_10027035 Ga0307508_100270352 209
210 3300031824 Ga0307413_10557769 Ga0307413_105577691 209
211 3300031901 Ga0307406_10310747 Ga0307406_103107472 209
212 3300032002 Ga0307416_100211482 Ga0307416_1002114822 209
213 3300032126 Ga0307415_100004484 Ga0307415_1000044849 209
214 3300050507 nmdc:mga05p37_126_c1 nmdc:mga05p37_126_c1_58518_59159 209
215 3300050507 nmdc:mga05p37_138655_c1 nmdc:mga05p37_138655_c1_1745_2386 209
216 3300050507 nmdc:mga05p37_3246_c1 nmdc:mga05p37_3246_c1_845_1483 209
217 3300050508 nmdc:mga09592_12_c1 nmdc:mga09592_12_c1_93217_93858 209
218 3300050508 nmdc:mga09592_30488_c1 nmdc:mga09592_30488_c1_3705_4343 209
219 3300050508 nmdc:mga09592_52251_c1 nmdc:mga09592_52251_c1_901_1542 209
220 3300050509 nmdc:mga0qj67_26976_c1 nmdc:mga0qj67_26976_c1_502_1140 209
221 3300050509 nmdc:mga0qj67_6_c2 nmdc:mga0qj67_6_c2_112887_113528 209
222 3300050510 nmdc:mga06r32_10_c1 nmdc:mga06r32_10_c1_102991_103632 209
223 3300050510 nmdc:mga06r32_38330_c1 nmdc:mga06r32_38330_c1_2699_3337 209
224 3300050510 nmdc:mga06r32_628540_c1 nmdc:mga06r32_628540_c1_179_820 209
225 3300003203 JGI25406J46586_10070632 JGI25406J46586_100706322 210
226 3300003316 rootH1_10052087 rootH1_100520872 210
227 3300005327 Ga0070658_10683394 Ga0070658_106833941 210
228 3300005338 Ga0068868_100329609 Ga0068868_1003296092 210
229 3300005355 Ga0070671_100256222 Ga0070671_1002562222 210
230 3300005367 Ga0070667_100019814 Ga0070667_1000198142 210
231 3300005530 Ga0070679_101201272 Ga0070679_1012012721 210
232 3300005719 Ga0068861_100157331 Ga0068861_1001573312 210
233 3300005841 Ga0068863_100426525 Ga0068863_1004265252 210
234 3300005843 Ga0068860_100243724 Ga0068860_1002437242 210
235 3300005844 Ga0068862_100064819 Ga0068862_1000648194 210
236 3300005983 Ga0081540_1008507 Ga0081540_10085078 210
237 3300005985 Ga0081539_10004121 Ga0081539_100041212 210
238 3300005985 Ga0081539_10017055 Ga0081539_100170553 210
239 3300005985 Ga0081539_10021053 Ga0081539_100210532 210
240 3300006051 Ga0075364_10038009 Ga0075364_100380091 210
241 3300006844 Ga0075428_100041843 Ga0075428_1000418434 210
242 3300009101 Ga0105247_10249459 Ga0105247_102494592 210
243 3300009148 Ga0105243_10657086 Ga0105243_106570861 210
244 3300014326 Ga0157380_10529167 Ga0157380_105291672 210
245 3300014969 Ga0157376_11212568 Ga0157376_112125681 210
246 3300025920 Ga0207649_10622469 Ga0207649_106224691 210
247 3300025921 Ga0207652_10915689 Ga0207652_109156892 210
248 3300025931 Ga0207644_10067789 Ga0207644_100677894 210
249 3300025940 Ga0207691_10324978 Ga0207691_103249782 210
250 3300025986 Ga0207658_10017469 Ga0207658_100174695 210
251 3300028379 Ga0268266_10141064 Ga0268266_101410641 210
252 3300028380 Ga0268265_10132600 Ga0268265_101326003 210
253 3300028381 Ga0268264_10035833 Ga0268264_100358333 210
254 3300028794 Ga0307515_10015993 Ga0307515_100159937 210
255 3300028794 Ga0307515_10032705 Ga0307515_100327058 210
256 3300030522 Ga0307512_10007169 Ga0307512_100071697 210
257 3300030522 Ga0307512_10112069 Ga0307512_101120692 210
258 3300031456 Ga0307513_10005290 Ga0307513_1000529017 210
259 3300031507 Ga0307509_10129915 Ga0307509_101299152 210
260 3300031548 Ga0307408_100036992 Ga0307408_1000369922 210
261 3300031616 Ga0307508_10001514 Ga0307508_1000151426 210
262 3300031616 Ga0307508_10018782 Ga0307508_100187829 210
263 3300031731 Ga0307405_10057729 Ga0307405_100577294 210
264 3300031731 Ga0307405_10144308 Ga0307405_101443082 210
265 3300031731 Ga0307405_10438592 Ga0307405_104385922 210
266 3300031852 Ga0307410_10007316 Ga0307410_100073162 210
267 3300031852 Ga0307410_10029560 Ga0307410_100295602 210
268 3300031889 Ga0326468_10000643 Ga0326468_100006434 210
269 3300031901 Ga0307406_10002273 Ga0307406_100022738 210
270 3300031901 Ga0307406_10029630 Ga0307406_100296306 210
271 3300031903 Ga0307407_10069136 Ga0307407_100691362 210
272 3300031903 Ga0307407_10267050 Ga0307407_102670502 210
273 3300031911 Ga0307412_10054620 Ga0307412_100546202 210
274 3300031995 Ga0307409_100000437 Ga0307409_1000004372 210
275 3300032002 Ga0307416_100001161 Ga0307416_10000116110 210
276 3300032002 Ga0307416_100087642 Ga0307416_1000876422 210
277 3300032002 Ga0307416_100110638 Ga0307416_1001106384 210
278 3300032126 Ga0307415_100000190 Ga0307415_10000019015 210
279 3300033180 Ga0307510_10348285 Ga0307510_103482851 210
280 3300035114 Ga0373939_0046863 Ga0373939_0046863_491_1138 210
281 3300035242 Ga0373962_0000172 Ga0373962_0000172_5577_6227 210
282 3300035692 Ga0373935_0100549 Ga0373935_0100549_1156_1803 210
283 3300037418 Ga0395900_0068602 Ga0395900_0068602_484_1131 210
284 3300045976 Ga0466967_0262690 Ga0466967_0262690_880_1530 210
285 3300046519 Ga0495632_0011770 Ga0495632_0011770_3893_4540 210
286 3300048911 Ga0496108_0000048 Ga0496108_0000048_35951_36598 210
287 3300050491 nmdc:mga00v17_29927_c1 nmdc:mga00v17_29927_c1_49_684 210
288 3300053088 Ga0500644_0172944 Ga0500644_0172944_83_730 210
289 3300053093 Ga0500651_0109001 Ga0500651_0109001_700_1347 210
290 3300053096 Ga0500641_0006753 Ga0500641_0006753_1444_2091 210
291 3300053098 Ga0500650_0042201 Ga0500650_0042201_522_1169 210
292 3300053109 Ga0500569_007025 Ga0500569_007025_1710_2357 210
293 3300053118 Ga0500594_0003735 Ga0500594_0003735_1532_2179 210
294 3300053126 Ga0500621_051329 Ga0500621_051329_577_1224 210
295 3300053131 Ga0500652_004425 Ga0500652_004425_2285_2932 210
296 3300059647 Ga0587079_062311 Ga0587079_062311_76_723 210
297 3300037853 Ga0436364_0810988 Ga0436364_0810988_158_808 211
298 3300046519 Ga0495632_0233035 Ga0495632_0233035_80_730 211
299 3300031995 Ga0307409_100207330 Ga0307409_1002073302 212
300 3300032126 Ga0307415_100027773 Ga0307415_1000277735 212
301 3300041451 Ga0451791_0836473 Ga0451791_0836473_648_1304 212
302 3300003203 JGI25406J46586_10016792 JGI25406J46586_100167922 213
303 3300005985 Ga0081539_10000613 Ga0081539_100006132 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

14

194

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7999 37 188
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7799 37 188
4wvg-assembly1.cif.gz_A crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb). 0.765 38 193
4wvi-assembly1.cif.gz_A crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb) in complex with a substrate peptide (pep2). 0.732 38 205
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7274 37 188
ID Description Score Start End Superfamily
af_Q96LU5_28_157_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8781 37 204 2.10.109.10
af_O74800_20_156_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8661 34 203 2.10.109.10
af_Q96LU5_28_157_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8654 37 204 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8582 33 188 2.10.109.10
af_A0A1D6L5X4_1_100_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8581 52 188 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A0M8XZN0-F1-model_v4 deleted 0.9769 21 213
AF-A0A7W7H9X5-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9709 27 212 GO:0004252
GO:0006465
GO:0016020
AF-A0A0M8XZN0-F1-model_v4 deleted 0.9621 21 213
AF-A0A4S8Q690-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9407 1 212 GO:0004252
GO:0006465
GO:0016020
AF-A0A1S2JKA2-F1-model_v4 deleted 0.9394 49 203

Feature Viewer

pLDDT pTM Quality
88.54 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map