F397020

General Info

Members Datasets Scaffolds Average Seq Length
303 194 606 337

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10032016|Ga0157374_100320165
Length 374
Sequence MDAIRVSVLNSNASVAMKSPTHSMTNSKTNPNNYLLRAAADLFPGYFALVMATGIISIACFFLEMKTISRVLLIINVIAYLILWVLLLLRLVFFFSRVKADMNDHVRGPGFFTVVAGTCVLGSALLIVVNQFQIAAGLWFAGLLLWAVIMYTFFAAMTVRENKPSIEVGLNGGWLLTVVATQSISVLGTLLSGRLVGSRTPVLFFTLCMFLLGCMLYLPLITLIFYRFTFVNVTMASLTPPYWINMGAVAITTLAGARLIIAAPGWPLLNEVVPFLKGFTLFFWAAGTWWIPFLFILGFWRHVYKRFPLKYDPQYWGMVFPFGMYTVCTFQLSKAIDFQPLLVIPRYFIYLALAGWIAVSVGLISKLTFRKQAG

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
150 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
151 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
159 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
160 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
161 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
162 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
165 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
166 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
167 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
168 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
169 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
170 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
171 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
172 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
173 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
176 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
177 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
178 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
183 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
184 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
185 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
186 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 18.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10032016 3300013296 Bacteria 4785
2 MRS1b_contig_3560302 2162886011 Bacteria 1952
3 MBSR1b_contig_10970623 2162886012 Bacteria 1578
4 Ga0065714_10064430 3300005288 Bacteria 140636
5 Ga0065712_10067738 3300005290 Bacteria 92500
6 Ga0065712_10070180 3300005290 Archaea 6251
7 Ga0065712_10131295 3300005290 Bacteria 1547
8 Ga0065715_10010345 3300005293 Bacteria 2423
9 Ga0065715_10089039 3300005293 Bacteria 15988
10 Ga0065715_10098564 3300005293 Bacteria 3515
11 Ga0065707_10111358 3300005295 Unclassified 2397
12 Ga0070676_10134811 3300005328 Bacteria 1565
13 Ga0070690_100111839 3300005330 Bacteria 1823
14 Ga0070670_100000076 3300005331 Bacteria 95513
15 Ga0070670_100101927 3300005331 Bacteria 2472
16 Ga0070680_100194226 3300005336 Unclassified 1711
17 Ga0068868_100048221 3300005338 Unclassified 3341
18 Ga0070687_100149522 3300005343 Bacteria 1369
19 Ga0070661_100041004 3300005344 Bacteria 3378
20 Ga0070668_100000175 3300005347 Bacteria 41128
21 Ga0070669_100007222 3300005353 Bacteria 7978
22 Ga0070669_100033579 3300005353 Bacteria 3712
23 Ga0070669_100069043 3300005353 Unclassified 2609
24 Ga0070675_100119071 3300005354 Bacteria 2242
25 Ga0070671_100044447 3300005355 Unclassified 3691
26 Ga0070671_100099085 3300005355 Bacteria 2444
27 Ga0070674_100240478 3300005356 Bacteria 1417
28 Ga0070673_100002309 3300005364 Bacteria 11590
29 Ga0070688_100049043 3300005365 Bacteria 2626
30 Ga0070659_100008179 3300005366 Bacteria 7631
31 Ga0070705_100033261 3300005440 Bacteria 2873
32 Ga0070700_100051848 3300005441 Bacteria 2556
33 Ga0070694_100024407 3300005444 Archaea 3902
34 Ga0070694_100167172 3300005444 Bacteria 1618
35 Ga0070694_100306200 3300005444 Bacteria 1219
36 Ga0070708_100000508 3300005445 Bacteria 29318
37 Ga0070678_100038180 3300005456 Bacteria 3379
38 Ga0070681_10030522 3300005458 Bacteria 5408
39 Ga0070681_10097468 3300005458 Unclassified 2888
40 Ga0068867_100041483 3300005459 Bacteria 3363
41 Ga0068867_100062262 3300005459 Bacteria 2772
42 Ga0068867_100158413 3300005459 Bacteria 1784
43 Ga0070685_10111051 3300005466 Bacteria 1688
44 Ga0070706_100000376 3300005467 Bacteria 53604
45 Ga0070706_100004927 3300005467 Bacteria 12777
46 Ga0070706_100089054 3300005467 Bacteria 2862
47 Ga0070707_100103874 3300005468 Bacteria 2754
48 Ga0070698_100087748 3300005471 Bacteria 3096
49 Ga0070699_100001427 3300005518 Bacteria 21970
50 Ga0070679_100022032 3300005530 Bacteria 6224
51 Ga0070697_100000055 3300005536 Bacteria 86691
52 Ga0070697_100022757 3300005536 Bacteria 4980
53 Ga0068853_100007830 3300005539 Bacteria 8569
54 Ga0068853_100014348 3300005539 Bacteria 6486
55 Ga0068853_100209364 3300005539 Bacteria 1777
56 Ga0068853_100228602 3300005539 Bacteria 1701
57 Ga0070686_100097323 3300005544 Bacteria 1980
58 Ga0070696_100115029 3300005546 Bacteria 1941
59 Ga0070665_100037798 3300005548 Bacteria 4853
60 Ga0070704_100012242 3300005549 Bacteria 5296
61 Ga0068855_100001800 3300005563 Bacteria 26788
62 Ga0068855_100073664 3300005563 Unclassified 3967
63 Ga0068855_100508309 3300005563 Bacteria 1308
64 Ga0070664_100056656 3300005564 Bacteria 3330
65 Ga0070664_100102187 3300005564 Bacteria 2494
66 Ga0068857_100008943 3300005577 Bacteria 8676
67 Ga0068854_100060215 3300005578 Bacteria 2746
68 Ga0068854_100065210 3300005578 Bacteria 2647
69 Ga0068856_100238077 3300005614 Bacteria 1836
70 Ga0070702_100001697 3300005615 Bacteria 9144
71 Ga0068852_100147698 3300005616 Unclassified 2182
72 Ga0068859_100004878 3300005617 Bacteria 13658
73 Ga0068859_100160195 3300005617 Bacteria 2329
74 Ga0068864_100004159 3300005618 Bacteria 11884
75 Ga0068864_100027058 3300005618 Bacteria 4839
76 Ga0068864_100139731 3300005618 Bacteria 2184
77 Ga0068866_10099384 3300005718 Bacteria 1602
78 Ga0068861_100130068 3300005719 Bacteria 2042
79 Ga0068870_10008307 3300005840 Bacteria 4664
80 Ga0068870_10028747 3300005840 Bacteria 2794
81 Ga0068863_100120298 3300005841 Bacteria 2503
82 Ga0068858_100022231 3300005842 Bacteria 5922
83 Ga0068860_100005912 3300005843 Bacteria 12316
84 Ga0068860_100075117 3300005843 Bacteria 3214
85 Ga0068860_100103269 3300005843 Bacteria 2720
86 Ga0068860_100152653 3300005843 Archaea 2225
87 Ga0068860_100396869 3300005843 Unclassified 1364
88 Ga0068862_100022805 3300005844 Bacteria 5239
89 Ga0097621_100126710 3300006237 Bacteria 2169
90 Ga0068871_100002687 3300006358 Bacteria 12129
91 Ga0068871_100107396 3300006358 Bacteria 2344
92 Ga0068871_100210075 3300006358 Bacteria 1683
93 Ga0075428_100121847 3300006844 Bacteria 2840
94 Ga0075431_100051221 3300006847 Bacteria 4258
95 Ga0075431_100189432 3300006847 Bacteria 2108
96 Ga0075433_10375512 3300006852 Bacteria 1255
97 Ga0075434_100166559 3300006871 Bacteria 2224
98 Ga0075434_100535406 3300006871 Unclassified 1191
99 Ga0075429_100082877 3300006880 Bacteria 2796
100 Ga0075429_100258674 3300006880 Unclassified 1524
101 Ga0068865_100026846 3300006881 Bacteria 3799
102 Ga0075436_100000026 3300006914 Bacteria 102984
103 Ga0097620_100004878 3300006931 Bacteria 13658
104 Ga0097620_100160194 3300006931 Bacteria 2329
105 Ga0075435_100006194 3300007076 Bacteria 8441
106 Ga0105240_10161260 3300009093 Unclassified 2663
107 Ga0111539_10050535 3300009094 Bacteria 4953
108 Ga0111539_10157294 3300009094 Bacteria 2659
109 Ga0105245_10109713 3300009098 Bacteria 2564
110 Ga0105247_10000823 3300009101 Bacteria 23675
111 Ga0105247_10038044 3300009101 Unclassified 2935
112 Ga0105247_10097344 3300009101 Bacteria 1877
113 Ga0114129_10174678 3300009147 Bacteria 2926
114 Ga0114129_10282547 3300009147 Bacteria 2217
115 Ga0114129_10388678 3300009147 Bacteria 1841
116 Ga0105241_10148754 3300009174 Bacteria 1914
117 Ga0105242_10032242 3300009176 Bacteria 4189
118 Ga0105242_10042747 3300009176 Bacteria 3662
119 Ga0105248_10067305 3300009177 Unclassified 4021
120 Ga0105248_10115279 3300009177 Unclassified 3030
121 Ga0105237_10128429 3300009545 Bacteria 2529
122 Ga0105238_10005220 3300009551 Bacteria 12835
123 Ga0105249_10000156 3300009553 Bacteria 83676
124 Ga0105249_10026896 3300009553 Bacteria 5187
125 Ga0105249_10109964 3300009553 Bacteria 2604
126 Ga0105239_10472921 3300010375 Unclassified 1423
127 Ga0105246_10046649 3300011119 Bacteria 2956
128 Ga0157373_10137011 3300013100 Bacteria 1721
129 Ga0157369_10419636 3300013105 Unclassified 1387
130 Ga0157378_10027045 3300013297 Bacteria 5061
131 Ga0163162_10000009 3300013306 Bacteria 316099
132 Ga0163162_10240631 3300013306 Archaea 1941
133 Ga0163162_10249034 3300013306 Unclassified 1909
134 Ga0163162_10417309 3300013306 Bacteria 1474
135 Ga0157372_10045109 3300013307 Bacteria 4888
136 Ga0157372_10098792 3300013307 Unclassified 3330
137 Ga0157375_10266396 3300013308 Bacteria 1875
138 Ga0157375_10564536 3300013308 Unclassified 1299
139 Ga0163163_10000227 3300014325 Bacteria 58267
140 Ga0163163_10005682 3300014325 Bacteria 10813
141 Ga0163163_10007595 3300014325 Bacteria 9577
142 Ga0163163_10071919 3300014325 Unclassified 3447
143 Ga0157380_10005600 3300014326 Bacteria 8774
144 Ga0157380_10019719 3300014326 Bacteria 5029
145 Ga0157380_10051124 3300014326 Unclassified 3267
146 Ga0157377_10025450 3300014745 Bacteria 3156
147 Ga0157376_10051510 3300014969 Bacteria 3420
148 Ga0163161_10025276 3300017792 Bacteria 4202
149 Ga0207697_10021479 3300025315 Unclassified 2642
150 Ga0207642_10040008 3300025899 Bacteria 2042
151 Ga0207710_10000521 3300025900 Bacteria 23589
152 Ga0207699_10215897 3300025906 Bacteria 1307
153 Ga0207645_10062519 3300025907 Bacteria 2379
154 Ga0207643_10021055 3300025908 Bacteria 3581
155 Ga0207684_10022466 3300025910 Bacteria 5384
156 Ga0207684_10077593 3300025910 Bacteria 2825
157 Ga0207707_10090834 3300025912 Bacteria 2669
158 Ga0207671_10235850 3300025914 Bacteria 1436
159 Ga0207657_10090842 3300025919 Bacteria 2548
160 Ga0207649_10027925 3300025920 Unclassified 3318
161 Ga0207646_10116763 3300025922 Bacteria 2397
162 Ga0207681_10028395 3300025923 Bacteria 3623
163 Ga0207681_10121899 3300025923 Unclassified 1913
164 Ga0207650_10000126 3300025925 Bacteria 95820
165 Ga0207650_10082902 3300025925 Bacteria 2435
166 Ga0207659_10019740 3300025926 Bacteria 4442
167 Ga0207644_10020797 3300025931 Bacteria 4464
168 Ga0207644_10189222 3300025931 Unclassified 1617
169 Ga0207690_10013059 3300025932 Unclassified 4983
170 Ga0207686_10025344 3300025934 Bacteria 3448
171 Ga0207686_10039496 3300025934 Bacteria 2864
172 Ga0207709_10019641 3300025935 Bacteria 3803
173 Ga0207709_10104571 3300025935 Unclassified 1879
174 Ga0207670_10072662 3300025936 Bacteria 2382
175 Ga0207704_10039502 3300025938 Bacteria 2748
176 Ga0207665_10033192 3300025939 Bacteria 3420
177 Ga0207711_10117108 3300025941 Unclassified 2376
178 Ga0207689_10006356 3300025942 Bacteria 10463
179 Ga0207689_10047968 3300025942 Unclassified 3523
180 Ga0207679_10049097 3300025945 Unclassified 3077
181 Ga0207679_10057269 3300025945 Bacteria 2882
182 Ga0207667_10002168 3300025949 Bacteria 24599
183 Ga0207651_10004662 3300025960 Bacteria 6949
184 Ga0207651_10051714 3300025960 Bacteria 2797
185 Ga0207651_10078419 3300025960 Bacteria 2369
186 Ga0207712_10000123 3300025961 Bacteria 83597
187 Ga0207712_10005270 3300025961 Bacteria 8172
188 Ga0207712_10050966 3300025961 Bacteria 2893
189 Ga0207712_10090915 3300025961 Bacteria 2247
190 Ga0207668_10000593 3300025972 Bacteria 22515
191 Ga0207640_10040670 3300025981 Bacteria 2951
192 Ga0207677_10042711 3300026023 Bacteria 3008
193 Ga0207703_10030498 3300026035 Bacteria 4262
194 Ga0207703_10067544 3300026035 Bacteria 2942
195 Ga0207639_10004233 3300026041 Bacteria 9671
196 Ga0207639_10010234 3300026041 Bacteria 6489
197 Ga0207639_10015416 3300026041 Bacteria 5393
198 Ga0207708_10011578 3300026075 Bacteria 6574
199 Ga0207702_10087458 3300026078 Bacteria 2721
200 Ga0207641_10071492 3300026088 Bacteria 2984
201 Ga0207641_10075492 3300026088 Bacteria 2911
202 Ga0207641_10145046 3300026088 Bacteria 2146
203 Ga0207641_10170012 3300026088 Bacteria 1989
204 Ga0207648_10056866 3300026089 Bacteria 3413
205 Ga0207676_10045436 3300026095 Bacteria 3393
206 Ga0207674_10002071 3300026116 Bacteria 25430
207 Ga0207674_10206243 3300026116 Bacteria 1915
208 Ga0207675_100041197 3300026118 Bacteria 4313
209 Ga0207675_100092154 3300026118 Bacteria 2850
210 Ga0207428_10181596 3300027907 Bacteria 1589
211 Ga0268265_10024211 3300028380 Bacteria 4292
212 Ga0268265_10027284 3300028380 Bacteria 4074
213 Ga0268264_10001270 3300028381 Bacteria 23952
214 Ga0268264_10073040 3300028381 Bacteria 2910
215 Ga0268264_10088893 3300028381 Bacteria 2659
216 Ga0268264_10205499 3300028381 Bacteria 1804
217 Ga0268264_10336251 3300028381 Unclassified 1433
218 Ga0307408_100014039 3300031548 Bacteria 5322
219 Ga0307405_10120390 3300031731 Bacteria 1795
220 Ga0316577_10039806 3300031733 Unclassified 2629
221 Ga0307406_10001282 3300031901 Bacteria 14084
222 Ga0307406_10015500 3300031901 Bacteria 4413
223 Ga0307412_10009748 3300031911 Bacteria 5516
224 Ga0307412_10098043 3300031911 Unclassified 2066
225 Ga0307411_10004295 3300032005 Bacteria 6803
226 Ga0307411_10059521 3300032005 Bacteria 2533
227 Ga0307415_100009520 3300032126 Bacteria 5452
228 Ga0450892_001948 3300042130 Bacteria 1840
229 Ga0453684_0183536 3300044712 Unclassified 2454
230 Ga0495640_0242174 3300046533 Bacteria 1132
231 Ga0495636_0035276 3300047318 Bacteria 2060
232 Ga0496102_0315908 3300048905 Bacteria 1472
233 Ga0496108_0344215 3300048911 Unclassified 1301
234 Ga0501292_005081 3300049515 Bacteria 1822
235 Ga0501297_000963 3300049520 Bacteria 2605
236 Ga0501298_008551 3300049521 Bacteria 1722
237 Ga0501298_015700 3300049521 Bacteria 1366
238 Ga0501299_000373 3300049522 Bacteria 5280
239 Ga0501038_0007902 3300049574 Bacteria 9806
240 Ga0501069_0190340 3300049585 Bacteria 1187
241 Ga0501071_0056737 3300049587 Bacteria 2830
242 Ga0501073_0159156 3300049589 Bacteria 1565
243 Ga0501073_0169424 3300049589 Bacteria 1512
244 Ga0501198_001494 3300049649 Unclassified 3066
245 Ga0501198_003615 3300049649 Bacteria 2120
246 Ga0501198_003734 3300049649 Bacteria 2094
247 Ga0501202_010464 3300049652 Bacteria 1722
248 Ga0501202_012130 3300049652 Unclassified 1622
249 Ga0501206_004251 3300049653 Bacteria 1820
250 Ga0501207_000212 3300049654 Bacteria 5830
251 Ga0501207_011218 3300049654 Bacteria 1331
252 Ga0501214_001537 3300049659 Bacteria 1815
253 Ga0501217_001371 3300049661 Unclassified 4540
254 Ga0501217_002680 3300049661 Bacteria 3529
255 Ga0501217_006634 3300049661 Bacteria 2466
256 Ga0501223_000805 3300049663 Bacteria 7429
257 Ga0501224_000825 3300049664 Unclassified 3940
258 Ga0501227_000947 3300049665 Bacteria 6376
259 Ga0501227_006651 3300049665 Bacteria 2479
260 Ga0501227_028190 3300049665 Unclassified 1333
261 Ga0501233_000468 3300049668 Bacteria 6420
262 Ga0501233_010336 3300049668 Bacteria 1836
263 Ga0501235_001552 3300049669 Bacteria 4925
264 Ga0501235_010975 3300049669 Bacteria 1982
265 Ga0501236_002808 3300049670 Unclassified 2010
266 Ga0501240_003804 3300049673 Unclassified 1713
267 Ga0501242_002595 3300049674 Bacteria 1910
268 Ga0501243_001970 3300049675 Unclassified 2985
269 Ga0501243_015987 3300049675 Unclassified 1209
270 Ga0501249_014386 3300049679 Unclassified 1686
271 Ga0501249_048096 3300049679 Bacteria 976
272 Ga0501256_001733 3300049685 Bacteria 1657
273 Ga0501257_008060 3300049686 Bacteria 2362
274 Ga0501257_010172 3300049686 Bacteria 2131
275 Ga0501259_004135 3300049688 Unclassified 2310
276 Ga0501259_009171 3300049688 Unclassified 1602
277 Ga0501260_000850 3300049689 Bacteria 2431
278 Ga0501260_001774 3300049689 Unclassified 1816
279 Ga0501261_006725 3300049690 Unclassified 1466
280 Ga0501221_009156 3300049704 Unclassified 1734
281 Ga0501221_009431 3300049704 Bacteria 1713
282 Ga0501225_0001642 3300049705 Bacteria 6979
283 Ga0501225_0016439 3300049705 Bacteria 2058
284 Ga0501225_0026688 3300049705 Unclassified 1588
285 Ga0501229_003209 3300049706 Bacteria 1950
286 Ga0501229_006690 3300049706 Bacteria 1428
287 Ga0501234_000722 3300049707 Bacteria 5094
288 Ga0501245_003879 3300049708 Unclassified 2043
289 Ga0501241_021857 3300049758 Bacteria 1181
290 Ga0501283_001775 3300049779 Bacteria 2796
291 Ga0501212_007998 3300049851 Unclassified 1461
292 Ga0501226_001616 3300049853 Unclassified 2852
293 nmdc:mga05p37_110194_c1 3300050507 Bacteria 3386
294 nmdc:mga05p37_312572_c1 3300050507 Bacteria 1862
295 nmdc:mga09592_113452_c1 3300050508 Bacteria 2326
296 nmdc:mga06r32_276726_c1 3300050510 Bacteria 1666
297 nmdc:mga08y16_255121_c1 3300050511 Bacteria 1812
298 nmdc:mga08y16_394582_c1 3300050511 Bacteria 1417
299 nmdc:mga0rr50_255_c1 3300050513 Bacteria 18439
300 nmdc:mga08x19_26_c1 3300050514 Bacteria 228913
301 nmdc:mga0a205_126745_c1 3300050515 Bacteria 2453
302 nmdc:mga0a205_235235_c1 3300050515 Bacteria 1714
303 Ga0501082_0041333 3300060353 Bacteria 3975
304 Ga0157374_10032016
305 MRS1b_contig_3560302
306 MBSR1b_contig_10970623
307 Ga0065714_10064430
308 Ga0065712_10067738
309 Ga0065712_10070180
310 Ga0065712_10131295
311 Ga0065715_10010345
312 Ga0065715_10089039
313 Ga0065715_10098564
314 Ga0065707_10111358
315 Ga0070676_10134811
316 Ga0070690_100111839
317 Ga0070670_100000076
318 Ga0070670_100101927
319 Ga0070680_100194226
320 Ga0068868_100048221
321 Ga0070687_100149522
322 Ga0070661_100041004
323 Ga0070668_100000175
324 Ga0070669_100007222
325 Ga0070669_100033579
326 Ga0070669_100069043
327 Ga0070675_100119071
328 Ga0070671_100044447
329 Ga0070671_100099085
330 Ga0070674_100240478
331 Ga0070673_100002309
332 Ga0070688_100049043
333 Ga0070659_100008179
334 Ga0070705_100033261
335 Ga0070700_100051848
336 Ga0070694_100024407
337 Ga0070694_100167172
338 Ga0070694_100306200
339 Ga0070708_100000508
340 Ga0070678_100038180
341 Ga0070681_10030522
342 Ga0070681_10097468
343 Ga0068867_100041483
344 Ga0068867_100062262
345 Ga0068867_100158413
346 Ga0070685_10111051
347 Ga0070706_100000376
348 Ga0070706_100004927
349 Ga0070706_100089054
350 Ga0070707_100103874
351 Ga0070698_100087748
352 Ga0070699_100001427
353 Ga0070679_100022032
354 Ga0070697_100000055
355 Ga0070697_100022757
356 Ga0068853_100007830
357 Ga0068853_100014348
358 Ga0068853_100209364
359 Ga0068853_100228602
360 Ga0070686_100097323
361 Ga0070696_100115029
362 Ga0070665_100037798
363 Ga0070704_100012242
364 Ga0068855_100001800
365 Ga0068855_100073664
366 Ga0068855_100508309
367 Ga0070664_100056656
368 Ga0070664_100102187
369 Ga0068857_100008943
370 Ga0068854_100060215
371 Ga0068854_100065210
372 Ga0068856_100238077
373 Ga0070702_100001697
374 Ga0068852_100147698
375 Ga0068859_100004878
376 Ga0068859_100160195
377 Ga0068864_100004159
378 Ga0068864_100027058
379 Ga0068864_100139731
380 Ga0068866_10099384
381 Ga0068861_100130068
382 Ga0068870_10008307
383 Ga0068870_10028747
384 Ga0068863_100120298
385 Ga0068858_100022231
386 Ga0068860_100005912
387 Ga0068860_100075117
388 Ga0068860_100103269
389 Ga0068860_100152653
390 Ga0068860_100396869
391 Ga0068862_100022805
392 Ga0097621_100126710
393 Ga0068871_100002687
394 Ga0068871_100107396
395 Ga0068871_100210075
396 Ga0075428_100121847
397 Ga0075431_100051221
398 Ga0075431_100189432
399 Ga0075433_10375512
400 Ga0075434_100166559
401 Ga0075434_100535406
402 Ga0075429_100082877
403 Ga0075429_100258674
404 Ga0068865_100026846
405 Ga0075436_100000026
406 Ga0097620_100004878
407 Ga0097620_100160194
408 Ga0075435_100006194
409 Ga0105240_10161260
410 Ga0111539_10050535
411 Ga0111539_10157294
412 Ga0105245_10109713
413 Ga0105247_10000823
414 Ga0105247_10038044
415 Ga0105247_10097344
416 Ga0114129_10174678
417 Ga0114129_10282547
418 Ga0114129_10388678
419 Ga0105241_10148754
420 Ga0105242_10032242
421 Ga0105242_10042747
422 Ga0105248_10067305
423 Ga0105248_10115279
424 Ga0105237_10128429
425 Ga0105238_10005220
426 Ga0105249_10000156
427 Ga0105249_10026896
428 Ga0105249_10109964
429 Ga0105239_10472921
430 Ga0105246_10046649
431 Ga0157373_10137011
432 Ga0157369_10419636
433 Ga0157378_10027045
434 Ga0163162_10000009
435 Ga0163162_10240631
436 Ga0163162_10249034
437 Ga0163162_10417309
438 Ga0157372_10045109
439 Ga0157372_10098792
440 Ga0157375_10266396
441 Ga0157375_10564536
442 Ga0163163_10000227
443 Ga0163163_10005682
444 Ga0163163_10007595
445 Ga0163163_10071919
446 Ga0157380_10005600
447 Ga0157380_10019719
448 Ga0157380_10051124
449 Ga0157377_10025450
450 Ga0157376_10051510
451 Ga0163161_10025276
452 Ga0207697_10021479
453 Ga0207642_10040008
454 Ga0207710_10000521
455 Ga0207699_10215897
456 Ga0207645_10062519
457 Ga0207643_10021055
458 Ga0207684_10022466
459 Ga0207684_10077593
460 Ga0207707_10090834
461 Ga0207671_10235850
462 Ga0207657_10090842
463 Ga0207649_10027925
464 Ga0207646_10116763
465 Ga0207681_10028395
466 Ga0207681_10121899
467 Ga0207650_10000126
468 Ga0207650_10082902
469 Ga0207659_10019740
470 Ga0207644_10020797
471 Ga0207644_10189222
472 Ga0207690_10013059
473 Ga0207686_10025344
474 Ga0207686_10039496
475 Ga0207709_10019641
476 Ga0207709_10104571
477 Ga0207670_10072662
478 Ga0207704_10039502
479 Ga0207665_10033192
480 Ga0207711_10117108
481 Ga0207689_10006356
482 Ga0207689_10047968
483 Ga0207679_10049097
484 Ga0207679_10057269
485 Ga0207667_10002168
486 Ga0207651_10004662
487 Ga0207651_10051714
488 Ga0207651_10078419
489 Ga0207712_10000123
490 Ga0207712_10005270
491 Ga0207712_10050966
492 Ga0207712_10090915
493 Ga0207668_10000593
494 Ga0207640_10040670
495 Ga0207677_10042711
496 Ga0207703_10030498
497 Ga0207703_10067544
498 Ga0207639_10004233
499 Ga0207639_10010234
500 Ga0207639_10015416
501 Ga0207708_10011578
502 Ga0207702_10087458
503 Ga0207641_10071492
504 Ga0207641_10075492
505 Ga0207641_10145046
506 Ga0207641_10170012
507 Ga0207648_10056866
508 Ga0207676_10045436
509 Ga0207674_10002071
510 Ga0207674_10206243
511 Ga0207675_100041197
512 Ga0207675_100092154
513 Ga0207428_10181596
514 Ga0268265_10024211
515 Ga0268265_10027284
516 Ga0268264_10001270
517 Ga0268264_10073040
518 Ga0268264_10088893
519 Ga0268264_10205499
520 Ga0268264_10336251
521 Ga0307408_100014039
522 Ga0307405_10120390
523 Ga0316577_10039806
524 Ga0307406_10001282
525 Ga0307406_10015500
526 Ga0307412_10009748
527 Ga0307412_10098043
528 Ga0307411_10004295
529 Ga0307411_10059521
530 Ga0307415_100009520
531 Ga0450892_001948
532 Ga0453684_0183536
533 Ga0495640_0242174
534 Ga0495636_0035276
535 Ga0496102_0315908
536 Ga0496108_0344215
537 Ga0501292_005081
538 Ga0501297_000963
539 Ga0501298_008551
540 Ga0501298_015700
541 Ga0501299_000373
542 Ga0501038_0007902
543 Ga0501069_0190340
544 Ga0501071_0056737
545 Ga0501073_0159156
546 Ga0501073_0169424
547 Ga0501198_001494
548 Ga0501198_003615
549 Ga0501198_003734
550 Ga0501202_010464
551 Ga0501202_012130
552 Ga0501206_004251
553 Ga0501207_000212
554 Ga0501207_011218
555 Ga0501214_001537
556 Ga0501217_001371
557 Ga0501217_002680
558 Ga0501217_006634
559 Ga0501223_000805
560 Ga0501224_000825
561 Ga0501227_000947
562 Ga0501227_006651
563 Ga0501227_028190
564 Ga0501233_000468
565 Ga0501233_010336
566 Ga0501235_001552
567 Ga0501235_010975
568 Ga0501236_002808
569 Ga0501240_003804
570 Ga0501242_002595
571 Ga0501243_001970
572 Ga0501243_015987
573 Ga0501249_014386
574 Ga0501249_048096
575 Ga0501256_001733
576 Ga0501257_008060
577 Ga0501257_010172
578 Ga0501259_004135
579 Ga0501259_009171
580 Ga0501260_000850
581 Ga0501260_001774
582 Ga0501261_006725
583 Ga0501221_009156
584 Ga0501221_009431
585 Ga0501225_0001642
586 Ga0501225_0016439
587 Ga0501225_0026688
588 Ga0501229_003209
589 Ga0501229_006690
590 Ga0501234_000722
591 Ga0501245_003879
592 Ga0501241_021857
593 Ga0501283_001775
594 Ga0501212_007998
595 Ga0501226_001616
596 nmdc:mga05p37_110194_c1
597 nmdc:mga05p37_312572_c1
598 nmdc:mga09592_113452_c1
599 nmdc:mga06r32_276726_c1
600 nmdc:mga08y16_255121_c1
601 nmdc:mga08y16_394582_c1
602 nmdc:mga0rr50_255_c1
603 nmdc:mga08x19_26_c1
604 nmdc:mga0a205_126745_c1
605 nmdc:mga0a205_235235_c1
606 Ga0501082_0041333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03595

SLAC1

Voltage-dependent anion channel

41

364

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e0m-assembly1.cif.gz_A homotrimeric variant of tctrp9, bgl15 0.6291 129 289
4moa-assembly1.cif.gz_A crystal structure of cry4ba-r203q toxin 0.6241 119 286
7en0-assembly1.cif.gz_A structure and activity of slac1 channels for stomatal signaling in leaves 0.6163 21 320
8j0j-assembly1.cif.gz_A atslac1 8d mutant in closed state 0.6029 1 316
7en0-assembly1.cif.gz_A structure and activity of slac1 channels for stomatal signaling in leaves 0.5879 21 320
ID Description Score Start End Superfamily
af_Q57996_8_345_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.8158 15 319 1.50.10.150
af_P50537_27_382_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.792 13 323 1.50.10.150
af_Q57996_8_345_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.7671 15 319 1.50.10.150
af_A0A1D8PHX8_14_378_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.7644 14 320 1.50.10.150
af_P50537_27_382_1.50.10.150 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Voltage-dependent anion channel 0.759 13 323 1.50.10.150
ID Description Score Start End GO Terms
AF-A0A3A4ZQI8-F1-model_v4 C4-dicarboxylate ABC transporter 0.9836 131 324 GO:0000319
GO:0005886
AF-A0A1F8LVG7-F1-model_v4 C4-dicarboxylate ABC transporter 0.9797 168 324 GO:0016020
GO:0055085
AF-A0A2H5Z177-F1-model_v4 Putative membrane protein 0.9777 153 324 GO:0000319
GO:0005886
AF-A0A7T4X0V8-F1-model_v4 Tellurite resistance/C4-dicarboxylate transporter family protein 0.9696 185 325 GO:0016020
GO:0055085
AF-A0A171JUD3-F1-model_v4 deleted 0.9665 168 325

Map