F396998

General Info

Members Datasets Scaffolds Average Seq Length
303 149 606 244

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10542680|Ga0105248_105426801
Length 268
Sequence LSPPVFLTKDAPMPIPDIAPAALAYFDPGDGRRIAYRQHAPKGGAPTVLFLPGYASDMEGAKALALDGFCAARGLGCLRLDYSGTGSSGGDFADGTLTRWLEEVLSAIDLLTEGDLVLAGSSMGGWLALHAALRRPDRVKALLGIAAAPDFTDWGYTPDEKEAMRRDGKLERPNPYGPEPSVTWRAFWESGAQHRLLNNVIDLVIPIRLVHGEQDQEVHGGVPLKLMADLRSADVQLRLIKGAGHRLSEPHEIHAILVELLGLLERIA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
116 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.98
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10542680 3300009177 Bacteria 1312
2 JGI24741J21665_1005794 3300001915 Bacteria 2539
3 JGI24749J21850_1000760 3300002076 Bacteria 4653
4 rootH1_10321081 3300003323 Bacteria 1538
5 Ga0070658_10180999 3300005327 Bacteria 1773
6 Ga0070676_10001636 3300005328 Bacteria 11384
7 Ga0070670_100012807 3300005331 Bacteria 7175
8 Ga0070677_10000762 3300005333 Bacteria 10721
9 Ga0070680_100135099 3300005336 Bacteria 2065
10 Ga0070680_100188694 3300005336 Bacteria 1737
11 Ga0070660_100024829 3300005339 Bacteria 4451
12 Ga0070660_100066341 3300005339 Bacteria 2809
13 Ga0070691_10119971 3300005341 Bacteria 1323
14 Ga0070675_100001043 3300005354 Bacteria 19948
15 Ga0070673_100005920 3300005364 Bacteria 7899
16 Ga0070659_100277291 3300005366 Bacteria 1394
17 Ga0070667_100038627 3300005367 Bacteria 4002
18 Ga0070701_10027003 3300005438 Bacteria 2807
19 Ga0070663_100005111 3300005455 Bacteria 7764
20 Ga0070663_100014299 3300005455 Bacteria 5092
21 Ga0070663_100025774 3300005455 Bacteria 3974
22 Ga0070662_100000996 3300005457 Bacteria 17316
23 Ga0070662_100003560 3300005457 Bacteria 9718
24 Ga0068867_100003831 3300005459 Bacteria 10569
25 Ga0070706_100235859 3300005467 Bacteria 1708
26 Ga0070679_100147319 3300005530 Bacteria 2332
27 Ga0068853_100063845 3300005539 Bacteria 3191
28 Ga0068853_100080512 3300005539 Bacteria 2850
29 Ga0068853_100172240 3300005539 Bacteria 1959
30 Ga0070672_100000170 3300005543 Bacteria 36164
31 Ga0070672_100152015 3300005543 Bacteria 1915
32 Ga0070686_100414881 3300005544 Bacteria 1027
33 Ga0070695_100063879 3300005545 Bacteria 2394
34 Ga0070696_100065007 3300005546 Bacteria 2557
35 Ga0070665_100285026 3300005548 Bacteria 1654
36 Ga0070665_100882499 3300005548 Bacteria 907
37 Ga0068855_100035502 3300005563 Bacteria 5938
38 Ga0068855_100164277 3300005563 Bacteria 2518
39 Ga0068857_100832236 3300005577 Bacteria 882
40 Ga0068854_100007421 3300005578 Bacteria 7002
41 Ga0068856_100015472 3300005614 Bacteria 7371
42 Ga0068852_100033583 3300005616 Bacteria 4262
43 Ga0068852_100092232 3300005616 Bacteria 2712
44 Ga0068859_100001742 3300005617 Bacteria 22162
45 Ga0068864_100033605 3300005618 Bacteria 4361
46 Ga0068863_100487211 3300005841 Bacteria 1213
47 Ga0068862_100002498 3300005844 Bacteria 16270
48 Ga0068862_100657689 3300005844 Bacteria 1011
49 Ga0075428_100052052 3300006844 Bacteria 4489
50 Ga0075431_100023028 3300006847 Bacteria 6368
51 Ga0075429_100797992 3300006880 Bacteria 827
52 Ga0097620_100001742 3300006931 Bacteria 22162
53 Ga0105240_10081642 3300009093 Bacteria 3972
54 Ga0111539_10010849 3300009094 Bacteria 11468
55 Ga0114129_11122497 3300009147 Bacteria 983
56 Ga0105242_10673340 3300009176 Bacteria 1009
57 Ga0105248_10248378 3300009177 Bacteria 2003
58 Ga0105249_10003435 3300009553 Bacteria 13719
59 Ga0105249_10346927 3300009553 Bacteria 1503
60 Ga0157373_10006028 3300013100 Bacteria 9064
61 Ga0157373_10037760 3300013100 Bacteria 3461
62 Ga0157373_10045042 3300013100 Bacteria 3149
63 Ga0157373_10164266 3300013100 Bacteria 1562
64 Ga0157371_10005550 3300013102 Bacteria 10611
65 Ga0157371_10312206 3300013102 Bacteria 1140
66 Ga0157370_10242117 3300013104 Bacteria 1669
67 Ga0157369_10000137 3300013105 Bacteria 103542
68 Ga0157369_10005909 3300013105 Bacteria 14216
69 Ga0157369_10029105 3300013105 Bacteria 6107
70 Ga0157369_10066035 3300013105 Bacteria 3893
71 Ga0157369_10752058 3300013105 Bacteria 1003
72 Ga0157374_10003253 3300013296 Bacteria 13645
73 Ga0163162_10294292 3300013306 Bacteria 1755
74 Ga0157372_10240370 3300013307 Bacteria 2101
75 Ga0157380_10107962 3300014326 Bacteria 2332
76 Ga0157380_10166842 3300014326 Bacteria 1920
77 Ga0163161_10090006 3300017792 Bacteria 2270
78 Ga0206353_11818985 3300020082 Bacteria 1798
79 Ga0213875_10000515 3300021388 Bacteria 32119
80 Ga0207697_10001248 3300025315 Bacteria 13940
81 Ga0207682_10000177 3300025893 Bacteria 28884
82 Ga0207647_10005204 3300025904 Bacteria 9570
83 Ga0207647_10086977 3300025904 Bacteria 1867
84 Ga0207645_10003504 3300025907 Bacteria 11876
85 Ga0207705_10062574 3300025909 Bacteria 2688
86 Ga0207705_10222824 3300025909 Bacteria 1433
87 Ga0207695_10045960 3300025913 Bacteria 4630
88 Ga0207695_10062590 3300025913 Bacteria 3840
89 Ga0207660_10029821 3300025917 Bacteria 3746
90 Ga0207657_10014760 3300025919 Bacteria 7606
91 Ga0207649_10269060 3300025920 Bacteria 1234
92 Ga0207652_10014318 3300025921 Bacteria 6422
93 Ga0207681_10005518 3300025923 Bacteria 7770
94 Ga0207650_10011357 3300025925 Bacteria 6129
95 Ga0207650_10030612 3300025925 Bacteria 3878
96 Ga0207659_10029856 3300025926 Bacteria 3719
97 Ga0207644_10054537 3300025931 Bacteria 2879
98 Ga0207706_10001367 3300025933 Bacteria 24404
99 Ga0207706_10004272 3300025933 Bacteria 13439
100 Ga0207709_10174663 3300025935 Bacteria 1511
101 Ga0207691_10000765 3300025940 Bacteria 31799
102 Ga0207711_10038472 3300025941 Bacteria 4068
103 Ga0207711_10225874 3300025941 Bacteria 1714
104 Ga0207679_10011665 3300025945 Bacteria 5704
105 Ga0207667_10039472 3300025949 Bacteria 5031
106 Ga0207651_10073722 3300025960 Bacteria 2428
107 Ga0207712_10124509 3300025961 Bacteria 1955
108 Ga0207668_10001486 3300025972 Bacteria 13717
109 Ga0207668_10072503 3300025972 Bacteria 2464
110 Ga0207640_10001528 3300025981 Bacteria 12472
111 Ga0207658_10030580 3300025986 Bacteria 3814
112 Ga0207658_10495583 3300025986 Bacteria 1087
113 Ga0207639_10183179 3300026041 Bacteria 1783
114 Ga0207678_10009642 3300026067 Bacteria 8492
115 Ga0207678_10023390 3300026067 Bacteria 5404
116 Ga0207678_10079220 3300026067 Bacteria 2813
117 Ga0207702_10004666 3300026078 Bacteria 12107
118 Ga0207702_10025805 3300026078 Bacteria 4878
119 Ga0207641_10012915 3300026088 Bacteria 6853
120 Ga0207648_10005135 3300026089 Bacteria 13253
121 Ga0207676_10237338 3300026095 Bacteria 1633
122 Ga0207674_10004612 3300026116 Bacteria 16545
123 Ga0207675_100004923 3300026118 Bacteria 12869
124 Ga0207683_10015054 3300026121 Bacteria 6583
125 Ga0207698_10052269 3300026142 Bacteria 3129
126 Ga0207698_10145756 3300026142 Bacteria 2047
127 Ga0209974_10104878 3300027876 Bacteria 990
128 Ga0307408_100003350 3300031548 Bacteria 11002
129 Ga0307408_100092402 3300031548 Bacteria 2287
130 Ga0307408_100113265 3300031548 Bacteria 2088
131 Ga0307405_10011242 3300031731 Bacteria 4679
132 Ga0307405_10011538 3300031731 Bacteria 4639
133 Ga0307405_10059456 3300031731 Bacteria 2408
134 Ga0307405_10159802 3300031731 Bacteria 1594
135 Ga0307413_10006844 3300031824 Bacteria 5243
136 Ga0307413_10017808 3300031824 Bacteria 3709
137 Ga0307413_10063179 3300031824 Bacteria 2294
138 Ga0307413_10120444 3300031824 Bacteria 1776
139 Ga0307413_10205247 3300031824 Bacteria 1426
140 Ga0307410_10003414 3300031852 Bacteria 7967
141 Ga0307410_10018492 3300031852 Bacteria 4212
142 Ga0307410_10023910 3300031852 Bacteria 3809
143 Ga0307410_10031074 3300031852 Bacteria 3422
144 Ga0307410_10039497 3300031852 Bacteria 3099
145 Ga0307410_10066534 3300031852 Bacteria 2483
146 Ga0307410_10070205 3300031852 Unclassified 2426
147 Ga0307410_10082686 3300031852 Bacteria 2259
148 Ga0307410_10090388 3300031852 Bacteria 2171
149 Ga0307410_10117197 3300031852 Bacteria 1936
150 Ga0307410_10162744 3300031852 Bacteria 1674
151 Ga0307410_10205807 3300031852 Bacteria 1505
152 Ga0307410_10300458 3300031852 Bacteria 1266
153 Ga0307406_10028236 3300031901 Bacteria 3388
154 Ga0307406_10040372 3300031901 Bacteria 2901
155 Ga0307406_10062050 3300031901 Bacteria 2417
156 Ga0307406_10095931 3300031901 Bacteria 2008
157 Ga0307406_10104950 3300031901 Bacteria 1932
158 Ga0307406_10128233 3300031901 Unclassified 1776
159 Ga0307407_10009234 3300031903 Bacteria 4580
160 Ga0307407_10011706 3300031903 Bacteria 4189
161 Ga0307407_10016789 3300031903 Bacteria 3654
162 Ga0307407_10030905 3300031903 Bacteria 2894
163 Ga0307407_10033886 3300031903 Bacteria 2790
164 Ga0307412_10042727 3300031911 Bacteria 2947
165 Ga0307412_10054054 3300031911 Bacteria 2664
166 Ga0307412_10056783 3300031911 Bacteria 2611
167 Ga0307412_10110593 3300031911 Bacteria 1961
168 Ga0307412_10189743 3300031911 Bacteria 1553
169 Ga0307409_100012455 3300031995 Bacteria 5420
170 Ga0307409_100019791 3300031995 Bacteria 4569
171 Ga0307409_100025104 3300031995 Bacteria 4173
172 Ga0307409_100033984 3300031995 Bacteria 3718
173 Ga0307409_100072005 3300031995 Bacteria 2750
174 Ga0307409_100120023 3300031995 Bacteria 2224
175 Ga0307409_100121929 3300031995 Bacteria 2210
176 Ga0307409_100129200 3300031995 Bacteria 2155
177 Ga0307409_100313989 3300031995 Bacteria 1464
178 Ga0307416_100130599 3300032002 Bacteria 2260
179 Ga0307416_100140161 3300032002 Bacteria 2196
180 Ga0307416_100163670 3300032002 Bacteria 2060
181 Ga0307416_100204853 3300032002 Bacteria 1875
182 Ga0307414_10002743 3300032004 Bacteria 9268
183 Ga0307414_10004232 3300032004 Bacteria 7774
184 Ga0307414_10015715 3300032004 Bacteria 4577
185 Ga0307414_10024200 3300032004 Bacteria 3867
186 Ga0307414_10051050 3300032004 Bacteria 2868
187 Ga0307414_10064844 3300032004 Bacteria 2603
188 Ga0307414_10197646 3300032004 Bacteria 1633
189 Ga0307414_10448064 3300032004 Bacteria 1131
190 Ga0307414_10475192 3300032004 Unclassified 1101
191 Ga0307411_10000529 3300032005 Bacteria 13456
192 Ga0307411_10000664 3300032005 Bacteria 12562
193 Ga0307411_10010851 3300032005 Bacteria 4881
194 Ga0307411_10011069 3300032005 Bacteria 4847
195 Ga0307411_10014426 3300032005 Bacteria 4395
196 Ga0307411_10016119 3300032005 Bacteria 4223
197 Ga0307411_10025456 3300032005 Bacteria 3545
198 Ga0307411_10045319 3300032005 Bacteria 2828
199 Ga0307411_10271024 3300032005 Bacteria 1346
200 Ga0307411_10553910 3300032005 Bacteria 981
201 Ga0307415_100021037 3300032126 Bacteria 3999
202 Ga0307415_100043793 3300032126 Bacteria 2988
203 Ga0307415_100056765 3300032126 Bacteria 2687
204 Ga0307415_100149371 3300032126 Bacteria 1796
205 Ga0373936_0090308 3300035113 Bacteria 1284
206 Ga0373947_0009841 3300035725 Bacteria 5487
207 Ga0373925_0003304 3300037068 Bacteria 12536
208 Ga0395899_0000302 3300037312 Bacteria 63367
209 Ga0395899_0062515 3300037312 Bacteria 2742
210 Ga0395899_0076095 3300037312 Bacteria 2450
211 Ga0395899_0093073 3300037312 Bacteria 2182
212 Ga0395899_0181860 3300037312 Bacteria 1475
213 Ga0395900_0000380 3300037418 Bacteria 64150
214 Ga0395900_0004490 3300037418 Bacteria 14773
215 Ga0395900_0016744 3300037418 Bacteria 7479
216 Ga0395900_0112900 3300037418 Bacteria 2789
217 Ga0395900_0116497 3300037418 Bacteria 2742
218 Ga0395900_0143806 3300037418 Bacteria 2440
219 Ga0395900_0215558 3300037418 Bacteria 1937
220 Ga0395900_0234598 3300037418 Unclassified 1843
221 Ga0395900_0437128 3300037418 Bacteria 1267
222 Ga0395900_0485604 3300037418 Bacteria 1187
223 Ga0395900_0790189 3300037418 Bacteria 877
224 Ga0395898_0000054 3300037466 Bacteria 279561
225 Ga0395898_0011186 3300037466 Bacteria 9343
226 Ga0395898_0084610 3300037466 Bacteria 3057
227 Ga0395898_0134462 3300037466 Bacteria 2367
228 Ga0395905_0000046 3300037471 Bacteria 240463
229 Ga0395905_0000500 3300037471 Bacteria 53853
230 Ga0395905_0003223 3300037471 Bacteria 17551
231 Ga0395905_0014089 3300037471 Bacteria 7644
232 Ga0395905_0022794 3300037471 Bacteria 5920
233 Ga0395905_0043892 3300037471 Bacteria 4195
234 Ga0395905_0066738 3300037471 Bacteria 3370
235 Ga0395905_0163181 3300037471 Bacteria 2094
236 Ga0395905_0179123 3300037471 Bacteria 1990
237 Ga0395905_0180805 3300037471 Bacteria 1980
238 Ga0395905_0318574 3300037471 Bacteria 1444
239 Ga0436364_0518085 3300037853 Bacteria 102110
240 Ga0395901_0000181 3300038443 Bacteria 81816
241 Ga0395901_0002307 3300038443 Bacteria 19441
242 Ga0395901_0005438 3300038443 Bacteria 12892
243 Ga0395901_0012705 3300038443 Bacteria 8541
244 Ga0395901_0070253 3300038443 Bacteria 3648
245 Ga0395901_0238059 3300038443 Bacteria 1899
246 Ga0395901_0345859 3300038443 Bacteria 1535
247 Ga0395901_0347536 3300038443 Bacteria 1531
248 Ga0395901_0965078 3300038443 Unclassified 830
249 Ga0436365_0652341 3300039437 Bacteria 2861
250 Ga0439453_0003791 3300041408 Bacteria 2203
251 Ga0450914_005893 3300042118 Bacteria 1055
252 Ga0439464_0001132 3300042439 Bacteria 6173
253 Ga0466969_0001858 3300044656 Bacteria 11293
254 Ga0466972_0131832 3300044658 Bacteria 1177
255 Ga0466966_0002814 3300044684 Bacteria 11446
256 Ga0466966_0028259 3300044684 Bacteria 3654
257 Ga0466966_0063333 3300044684 Bacteria 2330
258 Ga0466961_0021050 3300044693 Bacteria 4197
259 Ga0466961_0057306 3300044693 Bacteria 2480
260 Ga0466961_0112732 3300044693 Bacteria 1710
261 Ga0466963_0006287 3300044694 Bacteria 7023
262 Ga0466963_0006830 3300044694 Bacteria 6791
263 Ga0466963_0181414 3300044694 Bacteria 1470
264 Ga0466971_0014848 3300044719 Bacteria 3427
265 Ga0466971_0046608 3300044719 Bacteria 1948
266 Ga0466970_0038023 3300044765 Bacteria 2552
267 Ga0466957_0005815 3300044842 Bacteria 6941
268 Ga0466957_0065771 3300044842 Bacteria 2234
269 Ga0466959_0018405 3300045049 Bacteria 5127
270 Ga0466959_0024959 3300045049 Bacteria 4427
271 Ga0466959_0055538 3300045049 Bacteria 2891
272 Ga0466958_0000563 3300045836 Bacteria 15795
273 Ga0466958_0016344 3300045836 Bacteria 4272
274 Ga0466958_0323767 3300045836 Bacteria 991
275 Ga0466967_0015378 3300045976 Bacteria 5995
276 Ga0466967_0214331 3300045976 Bacteria 1827
277 Ga0495629_0431795 3300046459 Bacteria 893
278 Ga0495596_0042362 3300046500 Bacteria 1794
279 Ga0495663_0008693 3300046525 Bacteria 2816
280 Ga0495598_0013257 3300046537 Bacteria 2039
281 Ga0495621_0001171 3300046539 Bacteria 6781
282 Ga0495621_0016322 3300046539 Bacteria 2381
283 Ga0495633_0051089 3300046558 Bacteria 1948
284 Ga0495659_0003172 3300046664 Bacteria 5275
285 Ga0495669_0020548 3300046684 Bacteria 2859
286 Ga0495669_0175151 3300046684 Bacteria 1021
287 Ga0495670_0039415 3300046691 Bacteria 2356
288 Ga0495670_0046707 3300046691 Bacteria 2163
289 Ga0495670_0053523 3300046691 Bacteria 2021
290 Ga0495677_0006711 3300047445 Bacteria 4333
291 Ga0496107_0011020 3300048910 Bacteria 6289
292 Ga0496109_0117679 3300048912 Bacteria 2474
293 Ga0496109_0462705 3300048912 Bacteria 1198
294 Ga0496112_0000950 3300048915 Bacteria 21045
295 Ga0496112_0006417 3300048915 Bacteria 10321
296 Ga0496113_0000977 3300048916 Bacteria 15240
297 Ga0501067_0087373 3300049583 Bacteria 1730
298 nmdc:mga05p37_1167233_c1 3300050507 Bacteria 799
299 nmdc:mga09592_514436_c1 3300050508 Bacteria 1030
300 nmdc:mga06r32_2074_c2 3300050510 Bacteria 10087
301 Ga0495655_0001821 3300053083 Bacteria 3322
302 Ga0466962_0021880 3300061719 Bacteria 3069
303 2896431643 2896429255 Bacteria 2557483
304 Ga0105248_10542680
305 JGI24741J21665_1005794
306 JGI24749J21850_1000760
307 rootH1_10321081
308 Ga0070658_10180999
309 Ga0070676_10001636
310 Ga0070670_100012807
311 Ga0070677_10000762
312 Ga0070680_100135099
313 Ga0070680_100188694
314 Ga0070660_100024829
315 Ga0070660_100066341
316 Ga0070691_10119971
317 Ga0070675_100001043
318 Ga0070673_100005920
319 Ga0070659_100277291
320 Ga0070667_100038627
321 Ga0070701_10027003
322 Ga0070663_100005111
323 Ga0070663_100014299
324 Ga0070663_100025774
325 Ga0070662_100000996
326 Ga0070662_100003560
327 Ga0068867_100003831
328 Ga0070706_100235859
329 Ga0070679_100147319
330 Ga0068853_100063845
331 Ga0068853_100080512
332 Ga0068853_100172240
333 Ga0070672_100000170
334 Ga0070672_100152015
335 Ga0070686_100414881
336 Ga0070695_100063879
337 Ga0070696_100065007
338 Ga0070665_100285026
339 Ga0070665_100882499
340 Ga0068855_100035502
341 Ga0068855_100164277
342 Ga0068857_100832236
343 Ga0068854_100007421
344 Ga0068856_100015472
345 Ga0068852_100033583
346 Ga0068852_100092232
347 Ga0068859_100001742
348 Ga0068864_100033605
349 Ga0068863_100487211
350 Ga0068862_100002498
351 Ga0068862_100657689
352 Ga0075428_100052052
353 Ga0075431_100023028
354 Ga0075429_100797992
355 Ga0097620_100001742
356 Ga0105240_10081642
357 Ga0111539_10010849
358 Ga0114129_11122497
359 Ga0105242_10673340
360 Ga0105248_10248378
361 Ga0105249_10003435
362 Ga0105249_10346927
363 Ga0157373_10006028
364 Ga0157373_10037760
365 Ga0157373_10045042
366 Ga0157373_10164266
367 Ga0157371_10005550
368 Ga0157371_10312206
369 Ga0157370_10242117
370 Ga0157369_10000137
371 Ga0157369_10005909
372 Ga0157369_10029105
373 Ga0157369_10066035
374 Ga0157369_10752058
375 Ga0157374_10003253
376 Ga0163162_10294292
377 Ga0157372_10240370
378 Ga0157380_10107962
379 Ga0157380_10166842
380 Ga0163161_10090006
381 Ga0206353_11818985
382 Ga0213875_10000515
383 Ga0207697_10001248
384 Ga0207682_10000177
385 Ga0207647_10005204
386 Ga0207647_10086977
387 Ga0207645_10003504
388 Ga0207705_10062574
389 Ga0207705_10222824
390 Ga0207695_10045960
391 Ga0207695_10062590
392 Ga0207660_10029821
393 Ga0207657_10014760
394 Ga0207649_10269060
395 Ga0207652_10014318
396 Ga0207681_10005518
397 Ga0207650_10011357
398 Ga0207650_10030612
399 Ga0207659_10029856
400 Ga0207644_10054537
401 Ga0207706_10001367
402 Ga0207706_10004272
403 Ga0207709_10174663
404 Ga0207691_10000765
405 Ga0207711_10038472
406 Ga0207711_10225874
407 Ga0207679_10011665
408 Ga0207667_10039472
409 Ga0207651_10073722
410 Ga0207712_10124509
411 Ga0207668_10001486
412 Ga0207668_10072503
413 Ga0207640_10001528
414 Ga0207658_10030580
415 Ga0207658_10495583
416 Ga0207639_10183179
417 Ga0207678_10009642
418 Ga0207678_10023390
419 Ga0207678_10079220
420 Ga0207702_10004666
421 Ga0207702_10025805
422 Ga0207641_10012915
423 Ga0207648_10005135
424 Ga0207676_10237338
425 Ga0207674_10004612
426 Ga0207675_100004923
427 Ga0207683_10015054
428 Ga0207698_10052269
429 Ga0207698_10145756
430 Ga0209974_10104878
431 Ga0307408_100003350
432 Ga0307408_100092402
433 Ga0307408_100113265
434 Ga0307405_10011242
435 Ga0307405_10011538
436 Ga0307405_10059456
437 Ga0307405_10159802
438 Ga0307413_10006844
439 Ga0307413_10017808
440 Ga0307413_10063179
441 Ga0307413_10120444
442 Ga0307413_10205247
443 Ga0307410_10003414
444 Ga0307410_10018492
445 Ga0307410_10023910
446 Ga0307410_10031074
447 Ga0307410_10039497
448 Ga0307410_10066534
449 Ga0307410_10070205
450 Ga0307410_10082686
451 Ga0307410_10090388
452 Ga0307410_10117197
453 Ga0307410_10162744
454 Ga0307410_10205807
455 Ga0307410_10300458
456 Ga0307406_10028236
457 Ga0307406_10040372
458 Ga0307406_10062050
459 Ga0307406_10095931
460 Ga0307406_10104950
461 Ga0307406_10128233
462 Ga0307407_10009234
463 Ga0307407_10011706
464 Ga0307407_10016789
465 Ga0307407_10030905
466 Ga0307407_10033886
467 Ga0307412_10042727
468 Ga0307412_10054054
469 Ga0307412_10056783
470 Ga0307412_10110593
471 Ga0307412_10189743
472 Ga0307409_100012455
473 Ga0307409_100019791
474 Ga0307409_100025104
475 Ga0307409_100033984
476 Ga0307409_100072005
477 Ga0307409_100120023
478 Ga0307409_100121929
479 Ga0307409_100129200
480 Ga0307409_100313989
481 Ga0307416_100130599
482 Ga0307416_100140161
483 Ga0307416_100163670
484 Ga0307416_100204853
485 Ga0307414_10002743
486 Ga0307414_10004232
487 Ga0307414_10015715
488 Ga0307414_10024200
489 Ga0307414_10051050
490 Ga0307414_10064844
491 Ga0307414_10197646
492 Ga0307414_10448064
493 Ga0307414_10475192
494 Ga0307411_10000529
495 Ga0307411_10000664
496 Ga0307411_10010851
497 Ga0307411_10011069
498 Ga0307411_10014426
499 Ga0307411_10016119
500 Ga0307411_10025456
501 Ga0307411_10045319
502 Ga0307411_10271024
503 Ga0307411_10553910
504 Ga0307415_100021037
505 Ga0307415_100043793
506 Ga0307415_100056765
507 Ga0307415_100149371
508 Ga0373936_0090308
509 Ga0373947_0009841
510 Ga0373925_0003304
511 Ga0395899_0000302
512 Ga0395899_0062515
513 Ga0395899_0076095
514 Ga0395899_0093073
515 Ga0395899_0181860
516 Ga0395900_0000380
517 Ga0395900_0004490
518 Ga0395900_0016744
519 Ga0395900_0112900
520 Ga0395900_0116497
521 Ga0395900_0143806
522 Ga0395900_0215558
523 Ga0395900_0234598
524 Ga0395900_0437128
525 Ga0395900_0485604
526 Ga0395900_0790189
527 Ga0395898_0000054
528 Ga0395898_0011186
529 Ga0395898_0084610
530 Ga0395898_0134462
531 Ga0395905_0000046
532 Ga0395905_0000500
533 Ga0395905_0003223
534 Ga0395905_0014089
535 Ga0395905_0022794
536 Ga0395905_0043892
537 Ga0395905_0066738
538 Ga0395905_0163181
539 Ga0395905_0179123
540 Ga0395905_0180805
541 Ga0395905_0318574
542 Ga0436364_0518085
543 Ga0395901_0000181
544 Ga0395901_0002307
545 Ga0395901_0005438
546 Ga0395901_0012705
547 Ga0395901_0070253
548 Ga0395901_0238059
549 Ga0395901_0345859
550 Ga0395901_0347536
551 Ga0395901_0965078
552 Ga0436365_0652341
553 Ga0439453_0003791
554 Ga0450914_005893
555 Ga0439464_0001132
556 Ga0466969_0001858
557 Ga0466972_0131832
558 Ga0466966_0002814
559 Ga0466966_0028259
560 Ga0466966_0063333
561 Ga0466961_0021050
562 Ga0466961_0057306
563 Ga0466961_0112732
564 Ga0466963_0006287
565 Ga0466963_0006830
566 Ga0466963_0181414
567 Ga0466971_0014848
568 Ga0466971_0046608
569 Ga0466970_0038023
570 Ga0466957_0005815
571 Ga0466957_0065771
572 Ga0466959_0018405
573 Ga0466959_0024959
574 Ga0466959_0055538
575 Ga0466958_0000563
576 Ga0466958_0016344
577 Ga0466958_0323767
578 Ga0466967_0015378
579 Ga0466967_0214331
580 Ga0495629_0431795
581 Ga0495596_0042362
582 Ga0495663_0008693
583 Ga0495598_0013257
584 Ga0495621_0001171
585 Ga0495621_0016322
586 Ga0495633_0051089
587 Ga0495659_0003172
588 Ga0495669_0020548
589 Ga0495669_0175151
590 Ga0495670_0039415
591 Ga0495670_0046707
592 Ga0495670_0053523
593 Ga0495677_0006711
594 Ga0496107_0011020
595 Ga0496109_0117679
596 Ga0496109_0462705
597 Ga0496112_0000950
598 Ga0496112_0006417
599 Ga0496113_0000977
600 Ga0501067_0087373
601 nmdc:mga05p37_1167233_c1
602 nmdc:mga09592_514436_c1
603 nmdc:mga06r32_2074_c2
604 Ga0495655_0001821
605 Ga0466962_0021880
606 2896431643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

30

170

0.86

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

46

168

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

45

173

0.84

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

48

256

0.72

PF00326

Peptidase_S9

Prolyl oligopeptidase family

68

266

0.71

PF00756

Esterase

Putative esterase

91

246

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ny9-assembly1.cif.gz_B alpha/beta hydrolase domain-containing protein 10 from mouse 0.9002 5 227
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.884 5 227
6ny9-assembly1.cif.gz_B alpha/beta hydrolase domain-containing protein 10 from mouse 0.8773 5 227
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.8634 7 226
3llc-assembly1.cif.gz_A crystal structure of putative hydrolase (yp_002548124.1) from agrobacterium vitis s4 at 1.80 a resolution 0.8623 5 227
ID Description Score Start End Superfamily
af_E7F9Y7_35_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9085 4 227 3.40.50.1820
af_E7F9Y7_35_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8893 4 227 3.40.50.1820
3llcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.841 5 225 3.40.50.1820
2wtnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8344 5 226 3.40.50.1820
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8297 6 119 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A672K8L8-F1-model_v4 Mycophenolic acid acyl-glucuronide esterase, mitochondrial-like 0.9645 4 98 GO:0004553
GO:0005739
GO:0008474
AF-A0A401PSI8-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9621 5 100 GO:0004553
GO:0005739
GO:0008474
AF-A0A2D4J452-F1-model_v4 PH domain-containing protein 0.9612 6 132 GO:0045180
GO:0070507
AF-A1L2D7-F1-model_v4 deleted 0.9385 5 139
AF-A0A418NP98-F1-model_v4 Alpha/beta hydrolase 0.9337 5 225 GO:0004553
GO:0006508
GO:0008236

Map