F396969

General Info

Members Datasets Scaffolds Average Seq Length
303 188 606 218

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10008612|Ga0105240_100086129
Length 246
Sequence MPFRAPLERDDHRDRRRVRLLASRHGGSLFLGHFGVALAAKRVAPAASLGTTVLAAQLADGLWPIFALAGLEQVRIDPGITRVTPLDFVSYPYSHSLAADVGWAALFGIIYGFARKDWRTAGWMAVLVLSHWVLDFVAHRPDLPLFAGGPKVGLGLWNSLPATLIVEAALFAGGAWIYLRATRARDRLGTVLIGAFIAVLVALYVAAVFGPPPPSPRAVLVAGLGGWLFVAWGYWIDRHRVPAVCV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
118 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
119 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.31
Rhizosphere 97.03
Stem 0
Stem Tuber 0
Unclassified 18.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10008612 3300009093 Bacteria 14575
2 JGI25406J46586_10023711 3300003203 Unclassified 2422
3 Ga0065707_10107469 3300005295 Bacteria 2553
4 Ga0065707_10109345 3300005295 Unclassified 2473
5 Ga0070683_100013577 3300005329 Bacteria 7106
6 Ga0070683_100085449 3300005329 Unclassified 2958
7 Ga0070670_100913260 3300005331 Unclassified 796
8 Ga0068869_100603913 3300005334 Bacteria 927
9 Ga0070666_10028718 3300005335 Unclassified 3652
10 Ga0070666_10201624 3300005335 Bacteria 1400
11 Ga0068868_100107581 3300005338 Bacteria 2263
12 Ga0070660_100133917 3300005339 Bacteria 1985
13 Ga0070668_100176862 3300005347 Bacteria 1741
14 Ga0070675_100268362 3300005354 Bacteria 1497
15 Ga0070675_100296873 3300005354 Bacteria 1423
16 Ga0070671_100172229 3300005355 Bacteria 1831
17 Ga0070671_100197030 3300005355 Bacteria 1707
18 Ga0070674_100021552 3300005356 Bacteria 4140
19 Ga0070674_100395908 3300005356 Archaea 1127
20 Ga0070673_100037681 3300005364 Bacteria 3686
21 Ga0070659_100029431 3300005366 Bacteria 4244
22 Ga0070667_100069358 3300005367 Bacteria 3000
23 Ga0070709_10350869 3300005434 Bacteria 1090
24 Ga0070713_100019549 3300005436 Bacteria 5176
25 Ga0070713_100427962 3300005436 Bacteria 1240
26 Ga0070711_100142060 3300005439 Bacteria 1801
27 Ga0070705_100149150 3300005440 Unclassified 1549
28 Ga0070705_100254210 3300005440 Bacteria 1235
29 Ga0070700_100158556 3300005441 Bacteria 1555
30 Ga0070663_100358799 3300005455 Bacteria 1182
31 Ga0070678_100748315 3300005456 Bacteria 884
32 Ga0070662_100321835 3300005457 Bacteria 1261
33 Ga0070662_100558355 3300005457 Unclassified 960
34 Ga0070662_100672644 3300005457 Bacteria 874
35 Ga0070707_100269941 3300005468 Unclassified 1654
36 Ga0070684_100019536 3300005535 Bacteria 5606
37 Ga0070684_100040136 3300005535 Bacteria 4028
38 Ga0070684_100173639 3300005535 Bacteria 1958
39 Ga0070684_100271604 3300005535 Bacteria 1552
40 Ga0070697_100029568 3300005536 Bacteria 4394
41 Ga0070697_100213350 3300005536 Unclassified 1644
42 Ga0068853_100040537 3300005539 Bacteria 3974
43 Ga0070695_100073081 3300005545 Bacteria 2250
44 Ga0070695_100342538 3300005545 Bacteria 1117
45 Ga0070693_100056187 3300005547 Bacteria 2271
46 Ga0070693_100204604 3300005547 Bacteria 1284
47 Ga0070704_100492984 3300005549 Bacteria 1062
48 Ga0068855_100003550 3300005563 Bacteria 19078
49 Ga0070664_100027178 3300005564 Unclassified 4753
50 Ga0068857_100200818 3300005577 Bacteria 1817
51 Ga0068856_100248767 3300005614 Bacteria 1793
52 Ga0068856_100325271 3300005614 Unclassified 1555
53 Ga0070702_100662088 3300005615 Bacteria 791
54 Ga0068851_10163092 3300005834 Bacteria 1225
55 Ga0068863_100016095 3300005841 Bacteria 7172
56 Ga0068858_100060685 3300005842 Bacteria 3495
57 Ga0068858_100241886 3300005842 Unclassified 1713
58 Ga0068860_100038283 3300005843 Bacteria 4587
59 Ga0068862_100170900 3300005844 Unclassified 1946
60 Ga0068862_100272969 3300005844 Bacteria 1547
61 Ga0081538_10151464 3300005981 Bacteria 1049
62 Ga0081539_10000024 3300005985 Bacteria 354702
63 Ga0081539_10000228 3300005985 Bacteria 131823
64 Ga0097621_100088673 3300006237 Bacteria 2585
65 Ga0097621_100286192 3300006237 Unclassified 1452
66 Ga0097621_100346827 3300006237 Bacteria 1319
67 Ga0097621_100583599 3300006237 Unclassified 1020
68 Ga0068871_100024859 3300006358 Bacteria 4651
69 Ga0068871_100029003 3300006358 Bacteria 4344
70 Ga0068871_100080709 3300006358 Bacteria 2693
71 Ga0068871_100115571 3300006358 Bacteria 2262
72 Ga0075428_100238215 3300006844 Bacteria 1964
73 Ga0075433_10192261 3300006852 Bacteria 1815
74 Ga0075433_10206123 3300006852 Bacteria 1748
75 Ga0075434_100458296 3300006871 Bacteria 1296
76 Ga0068865_100255286 3300006881 Unclassified 1385
77 Ga0075436_100005486 3300006914 Bacteria 8719
78 Ga0075436_100020034 3300006914 Bacteria 4590
79 Ga0075436_100042125 3300006914 Bacteria 3149
80 Ga0099794_10000201 3300007265 Bacteria 21747
81 Ga0105240_10141311 3300009093 Bacteria 2878
82 Ga0111539_10000031 3300009094 Bacteria 165994
83 Ga0111539_10000586 3300009094 Bacteria 46881
84 Ga0111539_10004944 3300009094 Bacteria 17336
85 Ga0111539_10128092 3300009094 Bacteria 2973
86 Ga0111539_10341878 3300009094 Unclassified 1742
87 Ga0105245_10357782 3300009098 Unclassified 1448
88 Ga0105245_10928898 3300009098 Bacteria 912
89 Ga0105245_11338289 3300009098 Bacteria 766
90 Ga0114129_10010213 3300009147 Bacteria 13386
91 Ga0114129_10027409 3300009147 Bacteria 8066
92 Ga0114129_10068464 3300009147 Unclassified 4949
93 Ga0114129_10312982 3300009147 Unclassified 2089
94 Ga0114129_10385422 3300009147 Bacteria 1850
95 Ga0114129_11119371 3300009147 Bacteria 985
96 Ga0105241_10001616 3300009174 Bacteria 17178
97 Ga0105241_10141506 3300009174 Bacteria 1959
98 Ga0105241_10406849 3300009174 Bacteria 1195
99 Ga0105242_10091982 3300009176 Bacteria 2555
100 Ga0105248_10115609 3300009177 Bacteria 3026
101 Ga0105248_10221719 3300009177 Bacteria 2129
102 Ga0105237_10388529 3300009545 Bacteria 1400
103 Ga0105238_10015625 3300009551 Bacteria 7683
104 Ga0105238_10036344 3300009551 Bacteria 5006
105 Ga0105238_10044490 3300009551 Unclassified 4487
106 Ga0105239_10062088 3300010375 Bacteria 4102
107 Ga0105246_10210226 3300011119 Bacteria 1518
108 Ga0157373_10013305 3300013100 Bacteria 6038
109 Ga0157371_10050545 3300013102 Bacteria 2954
110 Ga0157369_10002459 3300013105 Bacteria 22215
111 Ga0157369_10064361 3300013105 Bacteria 3949
112 Ga0157374_10015324 3300013296 Bacteria 6723
113 Ga0157374_10705528 3300013296 Bacteria 1022
114 Ga0157378_10008201 3300013297 Bacteria 9109
115 Ga0163162_10406802 3300013306 Unclassified 1493
116 Ga0157372_10005068 3300013307 Bacteria 13999
117 Ga0157372_10021507 3300013307 Bacteria 6969
118 Ga0157372_10114128 3300013307 Unclassified 3097
119 Ga0157375_10113170 3300013308 Bacteria 2815
120 Ga0163163_10082629 3300014325 Bacteria 3216
121 Ga0157380_10027602 3300014326 Bacteria 4318
122 Ga0157376_10046731 3300014969 Unclassified 3572
123 Ga0157376_10092105 3300014969 Bacteria 2627
124 Ga0157376_10096450 3300014969 Bacteria 2573
125 Ga0157376_10129480 3300014969 Bacteria 2250
126 Ga0157376_10310672 3300014969 Bacteria 1495
127 Ga0207680_10176244 3300025903 Bacteria 1443
128 Ga0207654_10015014 3300025911 Bacteria 4011
129 Ga0207660_10019295 3300025917 Unclassified 4556
130 Ga0207657_10019821 3300025919 Bacteria 6376
131 Ga0207649_10097849 3300025920 Bacteria 1935
132 Ga0207649_10124152 3300025920 Bacteria 1745
133 Ga0207646_10326014 3300025922 Unclassified 1387
134 Ga0207650_10712851 3300025925 Unclassified 848
135 Ga0207659_10088885 3300025926 Bacteria 2302
136 Ga0207659_10107997 3300025926 Bacteria 2110
137 Ga0207659_10321355 3300025926 Bacteria 1277
138 Ga0207687_10876724 3300025927 Bacteria 767
139 Ga0207700_10006950 3300025928 Bacteria 6884
140 Ga0207644_10081309 3300025931 Bacteria 2394
141 Ga0207690_10072387 3300025932 Bacteria 2380
142 Ga0207706_10009963 3300025933 Bacteria 8710
143 Ga0207706_10029885 3300025933 Bacteria 4864
144 Ga0207706_10453275 3300025933 Bacteria 1109
145 Ga0207669_10016645 3300025937 Bacteria 3743
146 Ga0207704_10393204 3300025938 Unclassified 1092
147 Ga0207704_10530811 3300025938 Bacteria 953
148 Ga0207665_10154059 3300025939 Bacteria 1648
149 Ga0207711_10091679 3300025941 Bacteria 2673
150 Ga0207661_10035062 3300025944 Bacteria 3907
151 Ga0207661_10375402 3300025944 Unclassified 1286
152 Ga0207661_10529441 3300025944 Unclassified 1078
153 Ga0207679_10048206 3300025945 Bacteria 3099
154 Ga0207667_10020536 3300025949 Bacteria 7341
155 Ga0207651_10015158 3300025960 Bacteria 4471
156 Ga0207668_10212167 3300025972 Bacteria 1549
157 Ga0207658_10108907 3300025986 Bacteria 2186
158 Ga0207703_10214782 3300026035 Unclassified 1717
159 Ga0207703_10540893 3300026035 Bacteria 1097
160 Ga0207639_10113885 3300026041 Bacteria 2209
161 Ga0207639_10955870 3300026041 Bacteria 802
162 Ga0207708_10455164 3300026075 Bacteria 1066
163 Ga0207702_10092850 3300026078 Bacteria 2646
164 Ga0207702_10258000 3300026078 Bacteria 1640
165 Ga0207641_10049488 3300026088 Bacteria 3551
166 Ga0207648_10050656 3300026089 Bacteria 3630
167 Ga0207648_10155178 3300026089 Bacteria 2021
168 Ga0207676_10178937 3300026095 Bacteria 1855
169 Ga0207674_10000990 3300026116 Bacteria 37081
170 Ga0207675_100102865 3300026118 Bacteria 2692
171 Ga0207698_10400630 3300026142 Unclassified 1311
172 Ga0209999_1003714 3300027543 Bacteria 2737
173 Ga0209970_1001013 3300027614 Bacteria 4987
174 Ga0209983_1000123 3300027665 Bacteria 13740
175 Ga0209588_1000007 3300027671 Bacteria 183924
176 Ga0209971_1002345 3300027682 Bacteria 4572
177 Ga0209971_1009817 3300027682 Bacteria 2266
178 Ga0209966_1001833 3300027695 Bacteria 3600
179 Ga0209998_10000531 3300027717 Bacteria 10294
180 Ga0209974_10000401 3300027876 Bacteria 14419
181 Ga0207428_10000012 3300027907 Bacteria 354383
182 Ga0207428_10016303 3300027907 Bacteria 6394
183 Ga0268265_10817656 3300028380 Bacteria 909
184 Ga0268264_10226522 3300028381 Unclassified 1724
185 Ga0265326_10005246 3300028558 Bacteria 4086
186 Ga0265326_10037924 3300028558 Unclassified 1369
187 Ga0265319_1000036 3300028563 Bacteria 115781
188 Ga0265319_1000170 3300028563 Bacteria 49332
189 Ga0265334_10004460 3300028573 Bacteria 6211
190 Ga0265318_10001297 3300028577 Bacteria 15032
191 Ga0265318_10065482 3300028577 Unclassified 1351
192 Ga0265322_10000056 3300028654 Bacteria 55804
193 Ga0265336_10000066 3300028666 Bacteria 95677
194 Ga0265338_10000610 3300028800 Bacteria 62626
195 Ga0265338_10000639 3300028800 Bacteria 60597
196 Ga0265338_10003610 3300028800 Bacteria 21594
197 Ga0265338_10028382 3300028800 Bacteria 5581
198 Ga0265324_10000176 3300029957 Bacteria 49235
199 Ga0265324_10000640 3300029957 Bacteria 23734
200 Ga0265324_10003877 3300029957 Bacteria 6973
201 Ga0265330_10000067 3300031235 Bacteria 91033
202 Ga0265332_10000308 3300031238 Bacteria 37793
203 Ga0265332_10032343 3300031238 Bacteria 2280
204 Ga0265328_10000159 3300031239 Bacteria 30942
205 Ga0265320_10000386 3300031240 Bacteria 35710
206 Ga0265320_10205869 3300031240 Bacteria 878
207 Ga0265325_10047516 3300031241 Unclassified 2221
208 Ga0265325_10050323 3300031241 Unclassified 2146
209 Ga0265325_10052987 3300031241 Bacteria 2081
210 Ga0265329_10000023 3300031242 Bacteria 61537
211 Ga0265340_10000929 3300031247 Bacteria 16634
212 Ga0265340_10005368 3300031247 Bacteria 7118
213 Ga0265340_10098921 3300031247 Bacteria 1357
214 Ga0265340_10175899 3300031247 Unclassified 969
215 Ga0265339_10036239 3300031249 Bacteria 2762
216 Ga0265339_10071115 3300031249 Bacteria 1854
217 Ga0265339_10108068 3300031249 Bacteria 1442
218 Ga0265331_10000859 3300031250 Bacteria 24738
219 Ga0265331_10028900 3300031250 Bacteria 2771
220 Ga0265331_10106593 3300031250 Bacteria 1287
221 Ga0265331_10206667 3300031250 Unclassified 884
222 Ga0265327_10076609 3300031251 Unclassified 1662
223 Ga0265316_10000754 3300031344 Bacteria 35751
224 Ga0265316_10054714 3300031344 Bacteria 3124
225 Ga0265316_10165924 3300031344 Unclassified 1649
226 Ga0307408_100041915 3300031548 Bacteria 3248
227 Ga0307408_100276441 3300031548 Bacteria 1397
228 Ga0265313_10001196 3300031595 Bacteria 24859
229 Ga0265314_10000869 3300031711 Bacteria 35906
230 Ga0265314_10006611 3300031711 Bacteria 10202
231 Ga0265314_10101705 3300031711 Bacteria 1846
232 Ga0265342_10000615 3300031712 Bacteria 37452
233 Ga0265342_10004835 3300031712 Bacteria 10447
234 Ga0316578_10090475 3300031728 Unclassified 1827
235 Ga0307416_100411062 3300032002 Bacteria 1394
236 Ga0307411_10226965 3300032005 Bacteria 1453
237 Ga0373934_0004065 3300035086 Bacteria 5390
238 Ga0373934_0042892 3300035086 Archaea 1788
239 Ga0373945_0060542 3300035116 Unclassified 1412
240 Ga0373956_0120214 3300035119 Bacteria 1226
241 Ga0373935_0015117 3300035692 Bacteria 4661
242 Ga0373927_0039920 3300035695 Bacteria 3045
243 Ga0373933_0005912 3300035724 Bacteria 6657
244 Ga0373933_0453094 3300035724 Unclassified 839
245 Ga0373937_0002346 3300036401 Bacteria 15780
246 Ga0373937_0009798 3300036401 Bacteria 8354
247 Ga0373937_0056584 3300036401 Bacteria 3602
248 Ga0373937_0161487 3300036401 Bacteria 2101
249 Ga0373937_0462866 3300036401 Bacteria 1204
250 Ga0373925_0004979 3300037068 Bacteria 9975
251 Ga0373925_0051599 3300037068 Unclassified 3071
252 Ga0373925_0144580 3300037068 Bacteria 1863
253 Ga0451807_0450924 3300041486 Bacteria 1276
254 Ga0451853_2008512 3300041512 Bacteria 999
255 Ga0439450_071913 3300042008 Bacteria 850
256 Ga0451577_0248358 3300042876 Bacteria 1610
257 Ga0453683_0238024 3300044673 Bacteria 1159
258 Ga0453684_0191419 3300044712 Bacteria 2393
259 Ga0466967_0854689 3300045976 Bacteria 904
260 Ga0495580_0054541 3300046472 Unclassified 2819
261 Ga0495580_0226708 3300046472 Bacteria 1283
262 Ga0495580_0301405 3300046472 Unclassified 1091
263 Ga0495580_0378655 3300046472 Bacteria 956
264 Ga0495608_0057587 3300046511 Bacteria 2564
265 Ga0495618_0253193 3300046514 Bacteria 1104
266 Ga0495630_0147149 3300046517 Bacteria 1791
267 Ga0495586_0061160 3300046535 Bacteria 2049
268 Ga0495587_0000972 3300046536 Bacteria 18783
269 Ga0495621_0051252 3300046539 Bacteria 1477
270 Ga0495667_0115796 3300046559 Unclassified 1732
271 Ga0495599_0121745 3300046678 Bacteria 1622
272 Ga0495658_0330627 3300046683 Bacteria 967
273 Ga0495613_0030822 3300046689 Unclassified 3984
274 Ga0495624_0350960 3300046690 Unclassified 887
275 Ga0495674_0062238 3300047319 Bacteria 3250
276 Ga0495602_0006766 3300048088 Bacteria 12035
277 Ga0496102_0322931 3300048905 Bacteria 1454
278 Ga0496104_0038743 3300048907 Bacteria 4462
279 Ga0496104_0529210 3300048907 Bacteria 1090
280 Ga0496109_0075466 3300048912 Bacteria 3100
281 Ga0496109_0130535 3300048912 Bacteria 2345
282 Ga0496109_1131603 3300048912 Unclassified 720
283 Ga0496126_0029188 3300048929 Bacteria 5242
284 Ga0501068_0314739 3300049584 Unclassified 1003
285 Ga0501045_0300982 3300049824 Unclassified 1194
286 nmdc:mga05p37_1133039_c1 3300050507 Unclassified 816
287 nmdc:mga05p37_233031_c1 3300050507 Bacteria 2217
288 nmdc:mga05p37_35072_c1 3300050507 Bacteria 6150
289 nmdc:mga05p37_376375_c1 3300050507 Bacteria 1665
290 nmdc:mga05p37_8493_c1 3300050507 Bacteria 12142
291 nmdc:mga08y16_27383_c1 3300050511 Bacteria 6006
292 nmdc:mga08y16_7_c1 3300050511 Bacteria 610289
293 nmdc:mga0rr50_235491_c1 3300050513 Unclassified 1516
294 nmdc:mga08x19_131157_c1 3300050514 Bacteria 1686
295 nmdc:mga08x19_432_c1 3300050514 Bacteria 28721
296 nmdc:mga0a205_110752_c1 3300050515 Bacteria 2644
297 Ga0501084_0406452 3300054114 Unclassified 1151
298 Ga0590071_000146 3300059421 Bacteria 20114
299 Ga0590074_000037 3300059423 Bacteria 12693
300 Ga0590075_000848 3300059424 Bacteria 8029
301 Ga0590077_000060 3300059426 Bacteria 26907
302 Ga0590077_002703 3300059426 Bacteria 3740
303 8015559261 8015556637 Bacteria 3582323
304 Ga0105240_10008612
305 JGI25406J46586_10023711
306 Ga0065707_10107469
307 Ga0065707_10109345
308 Ga0070683_100013577
309 Ga0070683_100085449
310 Ga0070670_100913260
311 Ga0068869_100603913
312 Ga0070666_10028718
313 Ga0070666_10201624
314 Ga0068868_100107581
315 Ga0070660_100133917
316 Ga0070668_100176862
317 Ga0070675_100268362
318 Ga0070675_100296873
319 Ga0070671_100172229
320 Ga0070671_100197030
321 Ga0070674_100021552
322 Ga0070674_100395908
323 Ga0070673_100037681
324 Ga0070659_100029431
325 Ga0070667_100069358
326 Ga0070709_10350869
327 Ga0070713_100019549
328 Ga0070713_100427962
329 Ga0070711_100142060
330 Ga0070705_100149150
331 Ga0070705_100254210
332 Ga0070700_100158556
333 Ga0070663_100358799
334 Ga0070678_100748315
335 Ga0070662_100321835
336 Ga0070662_100558355
337 Ga0070662_100672644
338 Ga0070707_100269941
339 Ga0070684_100019536
340 Ga0070684_100040136
341 Ga0070684_100173639
342 Ga0070684_100271604
343 Ga0070697_100029568
344 Ga0070697_100213350
345 Ga0068853_100040537
346 Ga0070695_100073081
347 Ga0070695_100342538
348 Ga0070693_100056187
349 Ga0070693_100204604
350 Ga0070704_100492984
351 Ga0068855_100003550
352 Ga0070664_100027178
353 Ga0068857_100200818
354 Ga0068856_100248767
355 Ga0068856_100325271
356 Ga0070702_100662088
357 Ga0068851_10163092
358 Ga0068863_100016095
359 Ga0068858_100060685
360 Ga0068858_100241886
361 Ga0068860_100038283
362 Ga0068862_100170900
363 Ga0068862_100272969
364 Ga0081538_10151464
365 Ga0081539_10000024
366 Ga0081539_10000228
367 Ga0097621_100088673
368 Ga0097621_100286192
369 Ga0097621_100346827
370 Ga0097621_100583599
371 Ga0068871_100024859
372 Ga0068871_100029003
373 Ga0068871_100080709
374 Ga0068871_100115571
375 Ga0075428_100238215
376 Ga0075433_10192261
377 Ga0075433_10206123
378 Ga0075434_100458296
379 Ga0068865_100255286
380 Ga0075436_100005486
381 Ga0075436_100020034
382 Ga0075436_100042125
383 Ga0099794_10000201
384 Ga0105240_10141311
385 Ga0111539_10000031
386 Ga0111539_10000586
387 Ga0111539_10004944
388 Ga0111539_10128092
389 Ga0111539_10341878
390 Ga0105245_10357782
391 Ga0105245_10928898
392 Ga0105245_11338289
393 Ga0114129_10010213
394 Ga0114129_10027409
395 Ga0114129_10068464
396 Ga0114129_10312982
397 Ga0114129_10385422
398 Ga0114129_11119371
399 Ga0105241_10001616
400 Ga0105241_10141506
401 Ga0105241_10406849
402 Ga0105242_10091982
403 Ga0105248_10115609
404 Ga0105248_10221719
405 Ga0105237_10388529
406 Ga0105238_10015625
407 Ga0105238_10036344
408 Ga0105238_10044490
409 Ga0105239_10062088
410 Ga0105246_10210226
411 Ga0157373_10013305
412 Ga0157371_10050545
413 Ga0157369_10002459
414 Ga0157369_10064361
415 Ga0157374_10015324
416 Ga0157374_10705528
417 Ga0157378_10008201
418 Ga0163162_10406802
419 Ga0157372_10005068
420 Ga0157372_10021507
421 Ga0157372_10114128
422 Ga0157375_10113170
423 Ga0163163_10082629
424 Ga0157380_10027602
425 Ga0157376_10046731
426 Ga0157376_10092105
427 Ga0157376_10096450
428 Ga0157376_10129480
429 Ga0157376_10310672
430 Ga0207680_10176244
431 Ga0207654_10015014
432 Ga0207660_10019295
433 Ga0207657_10019821
434 Ga0207649_10097849
435 Ga0207649_10124152
436 Ga0207646_10326014
437 Ga0207650_10712851
438 Ga0207659_10088885
439 Ga0207659_10107997
440 Ga0207659_10321355
441 Ga0207687_10876724
442 Ga0207700_10006950
443 Ga0207644_10081309
444 Ga0207690_10072387
445 Ga0207706_10009963
446 Ga0207706_10029885
447 Ga0207706_10453275
448 Ga0207669_10016645
449 Ga0207704_10393204
450 Ga0207704_10530811
451 Ga0207665_10154059
452 Ga0207711_10091679
453 Ga0207661_10035062
454 Ga0207661_10375402
455 Ga0207661_10529441
456 Ga0207679_10048206
457 Ga0207667_10020536
458 Ga0207651_10015158
459 Ga0207668_10212167
460 Ga0207658_10108907
461 Ga0207703_10214782
462 Ga0207703_10540893
463 Ga0207639_10113885
464 Ga0207639_10955870
465 Ga0207708_10455164
466 Ga0207702_10092850
467 Ga0207702_10258000
468 Ga0207641_10049488
469 Ga0207648_10050656
470 Ga0207648_10155178
471 Ga0207676_10178937
472 Ga0207674_10000990
473 Ga0207675_100102865
474 Ga0207698_10400630
475 Ga0209999_1003714
476 Ga0209970_1001013
477 Ga0209983_1000123
478 Ga0209588_1000007
479 Ga0209971_1002345
480 Ga0209971_1009817
481 Ga0209966_1001833
482 Ga0209998_10000531
483 Ga0209974_10000401
484 Ga0207428_10000012
485 Ga0207428_10016303
486 Ga0268265_10817656
487 Ga0268264_10226522
488 Ga0265326_10005246
489 Ga0265326_10037924
490 Ga0265319_1000036
491 Ga0265319_1000170
492 Ga0265334_10004460
493 Ga0265318_10001297
494 Ga0265318_10065482
495 Ga0265322_10000056
496 Ga0265336_10000066
497 Ga0265338_10000610
498 Ga0265338_10000639
499 Ga0265338_10003610
500 Ga0265338_10028382
501 Ga0265324_10000176
502 Ga0265324_10000640
503 Ga0265324_10003877
504 Ga0265330_10000067
505 Ga0265332_10000308
506 Ga0265332_10032343
507 Ga0265328_10000159
508 Ga0265320_10000386
509 Ga0265320_10205869
510 Ga0265325_10047516
511 Ga0265325_10050323
512 Ga0265325_10052987
513 Ga0265329_10000023
514 Ga0265340_10000929
515 Ga0265340_10005368
516 Ga0265340_10098921
517 Ga0265340_10175899
518 Ga0265339_10036239
519 Ga0265339_10071115
520 Ga0265339_10108068
521 Ga0265331_10000859
522 Ga0265331_10028900
523 Ga0265331_10106593
524 Ga0265331_10206667
525 Ga0265327_10076609
526 Ga0265316_10000754
527 Ga0265316_10054714
528 Ga0265316_10165924
529 Ga0307408_100041915
530 Ga0307408_100276441
531 Ga0265313_10001196
532 Ga0265314_10000869
533 Ga0265314_10006611
534 Ga0265314_10101705
535 Ga0265342_10000615
536 Ga0265342_10004835
537 Ga0316578_10090475
538 Ga0307416_100411062
539 Ga0307411_10226965
540 Ga0373934_0004065
541 Ga0373934_0042892
542 Ga0373945_0060542
543 Ga0373956_0120214
544 Ga0373935_0015117
545 Ga0373927_0039920
546 Ga0373933_0005912
547 Ga0373933_0453094
548 Ga0373937_0002346
549 Ga0373937_0009798
550 Ga0373937_0056584
551 Ga0373937_0161487
552 Ga0373937_0462866
553 Ga0373925_0004979
554 Ga0373925_0051599
555 Ga0373925_0144580
556 Ga0451807_0450924
557 Ga0451853_2008512
558 Ga0439450_071913
559 Ga0451577_0248358
560 Ga0453683_0238024
561 Ga0453684_0191419
562 Ga0466967_0854689
563 Ga0495580_0054541
564 Ga0495580_0226708
565 Ga0495580_0301405
566 Ga0495580_0378655
567 Ga0495608_0057587
568 Ga0495618_0253193
569 Ga0495630_0147149
570 Ga0495586_0061160
571 Ga0495587_0000972
572 Ga0495621_0051252
573 Ga0495667_0115796
574 Ga0495599_0121745
575 Ga0495658_0330627
576 Ga0495613_0030822
577 Ga0495624_0350960
578 Ga0495674_0062238
579 Ga0495602_0006766
580 Ga0496102_0322931
581 Ga0496104_0038743
582 Ga0496104_0529210
583 Ga0496109_0075466
584 Ga0496109_0130535
585 Ga0496109_1131603
586 Ga0496126_0029188
587 Ga0501068_0314739
588 Ga0501045_0300982
589 nmdc:mga05p37_1133039_c1
590 nmdc:mga05p37_233031_c1
591 nmdc:mga05p37_35072_c1
592 nmdc:mga05p37_376375_c1
593 nmdc:mga05p37_8493_c1
594 nmdc:mga08y16_27383_c1
595 nmdc:mga08y16_7_c1
596 nmdc:mga0rr50_235491_c1
597 nmdc:mga08x19_131157_c1
598 nmdc:mga08x19_432_c1
599 nmdc:mga0a205_110752_c1
600 Ga0501084_0406452
601 Ga0590071_000146
602 Ga0590074_000037
603 Ga0590075_000848
604 Ga0590077_000060
605 Ga0590077_002703
606 8015559261

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly3.cif.gz_C crystal structure of protein 0.2636 2 218
7sp8-assembly1.cif.gz_A chlorella virus hyaluronan synthase bound to udp-glcnac 0.2603 69 216
5z3c-assembly1.cif.gz_A glycosidase e178a 0.2533 3 150
1dof-assembly1.cif.gz_A the crystal structure of adenylosuccinate lyase from pyrobaculum aerophilum: insights into thermal stability and human pathology 0.2532 20 220
8ibu-assembly1.cif.gz_R cryo-em structure of the erythromycin-bound motilin receptor-gq protein complex 0.2497 3 216
ID Description Score Start End Superfamily
af_P0C646_7_298_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3492 2 215 1.20.1070.10
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.345 69 213 1.10.10.1740
af_P0C646_7_298_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3312 2 215 1.20.1070.10
4k0dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3174 24 215 1.20.120.1730
af_Q5RHM5_243_504_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3137 23 216 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2V8L2P9-F1-model_v4 Metal-dependent hydrolase 0.969 1 219 GO:0016020
AF-A0A350BM70-F1-model_v4 Metal-dependent hydrolase 0.968 1 218 GO:0016020
AF-A0A522DNA0-F1-model_v4 Metal-dependent hydrolase 0.9659 1 220 GO:0016020
AF-A0A7V8BPQ9-F1-model_v4 Metal-dependent hydrolase 0.9646 1 223 GO:0016020
AF-A0A2V9RTX5-F1-model_v4 Metal-dependent hydrolase 0.9645 1 219 GO:0016020

Map