F396844

General Info

Members Datasets Scaffolds Average Seq Length
303 212 301 127

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100055225|Ga0070682_1000552253
Length 150
Sequence MTAARRRKRTPVVPQESSAEVSRRLLLDTHAWLWWQADDPRLGVATRRMLQHASEVRFSAASAWEIGIKLTLGKLSLPRDADISAALADSGFLPLAVDIAHAQGVQRLPPLHRDPFDRMLVAQARIEGLTLVTADRQLGAYGIPVMDATL

Samples

Sample ID Description Type Environment
1 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
2 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
127 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
136 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
137 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.33
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.49
Nodule 0
Rhizoplane 0.99
Rhizosphere 70.96
Stem 0
Stem Tuber 0
Unclassified 10.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1001833 3300002739 Bacteria 3606
2 JGI25159J45721_1012550 3300002987 Bacteria 2015
3 JGI25406J46586_10000839 3300003203 Bacteria 14447
4 JGI25406J46586_10022309 3300003203 Bacteria 2525
5 rootH1_10099223 3300003316 Bacteria 1197
6 rootH2_10055142 3300003320 Bacteria 1932
7 rootL2_10048795 3300003322 Bacteria 5873
8 JGI25161J50226_1003149 3300003374 Bacteria 3902
9 Ga0055526_1049876 3300003771 Bacteria 963
10 Ga0055537_1008547 3300003773 Bacteria 2351
11 Ga0055530_10001339 3300003791 Bacteria 18424
12 Ga0055543_1002801 3300004625 Bacteria 5512
13 Ga0065165_1008561 3300005262 Bacteria 4758
14 Ga0065704_10196567 3300005289 Bacteria 1165
15 Ga0065707_10122862 3300005295 Bacteria 2079
16 Ga0065707_10197688 3300005295 Bacteria 1322
17 Ga0070658_10034650 3300005327 Bacteria 4062
18 Ga0070658_10181450 3300005327 Unclassified 1771
19 Ga0070676_10102010 3300005328 Bacteria 1774
20 Ga0070683_100832608 3300005329 Bacteria 885
21 Ga0070690_100234032 3300005330 Bacteria 1293
22 Ga0070670_100057258 3300005331 Bacteria 3346
23 Ga0070680_100099902 3300005336 Bacteria 2408
24 Ga0070682_100055225 3300005337 Bacteria 2494
25 Ga0070660_100058433 3300005339 Bacteria 2989
26 Ga0070689_100753777 3300005340 Bacteria 853
27 Ga0070692_10176298 3300005345 Bacteria 1236
28 Ga0070675_100000005 3300005354 Bacteria 295918
29 Ga0070688_100999396 3300005365 Bacteria 664
30 Ga0070688_101371166 3300005365 Unclassified 572
31 Ga0070709_10635371 3300005434 Bacteria 825
32 Ga0070714_101476214 3300005435 Bacteria 664
33 Ga0070713_100020000 3300005436 Bacteria 5125
34 Ga0070713_101858838 3300005436 Unclassified 584
35 Ga0070708_100164040 3300005445 Bacteria 2072
36 Ga0070663_100090914 3300005455 Unclassified 2261
37 Ga0070681_10469873 3300005458 Unclassified 1170
38 Ga0070681_10692441 3300005458 Bacteria 935
39 Ga0068867_100398747 3300005459 Bacteria 1160
40 Ga0070706_100375714 3300005467 Bacteria 1324
41 Ga0070698_100192834 3300005471 Bacteria 1974
42 Ga0070699_100567918 3300005518 Bacteria 1033
43 Ga0070679_100045310 3300005530 Bacteria 4383
44 Ga0070679_100055746 3300005530 Bacteria 3937
45 Ga0070697_100042052 3300005536 Bacteria 3699
46 Ga0070665_100481362 3300005548 Bacteria 1252
47 Ga0068855_100210293 3300005563 Bacteria 2186
48 Ga0068855_102195703 3300005563 Unclassified 554
49 Ga0068854_100044149 3300005578 Bacteria 3162
50 Ga0068852_100124819 3300005616 Bacteria 2362
51 Ga0068863_101420047 3300005841 Unclassified 702
52 Ga0068862_100472242 3300005844 Unclassified 1186
53 Ga0081539_10002975 3300005985 Bacteria 22227
54 Ga0081539_10004073 3300005985 Bacteria 16714
55 Ga0081539_10033099 3300005985 Bacteria 3154
56 Ga0081539_10295210 3300005985 Bacteria 699
57 Ga0070717_10004174 3300006028 Bacteria 10416
58 Ga0070717_11783111 3300006028 Bacteria 556
59 Ga0075365_10030030 3300006038 Bacteria 3478
60 Ga0075365_10253672 3300006038 Bacteria 1236
61 Ga0075365_10537886 3300006038 Bacteria 826
62 Ga0075363_100341473 3300006048 Bacteria 873
63 Ga0075363_100689493 3300006048 Unclassified 616
64 Ga0075364_10311940 3300006051 Bacteria 1071
65 Ga0075364_10332159 3300006051 Bacteria 1036
66 Ga0070712_100000003 3300006175 Bacteria 253696
67 Ga0070712_100050084 3300006175 Bacteria 2904
68 Ga0075362_10010165 3300006177 Bacteria 3666
69 Ga0075367_10199230 3300006178 Bacteria 1251
70 Ga0075369_10008126 3300006186 Bacteria 4026
71 Ga0075366_10068165 3300006195 Bacteria 2117
72 Ga0075370_10028840 3300006353 Bacteria 3088
73 Ga0075370_10044827 3300006353 Bacteria 2500
74 Ga0068871_101482296 3300006358 Unclassified 641
75 Ga0075430_100051678 3300006846 Bacteria 3463
76 Ga0075431_100089713 3300006847 Bacteria 3173
77 Ga0075434_100649306 3300006871 Bacteria 1073
78 Ga0068865_100554733 3300006881 Bacteria 965
79 Ga0099794_10062963 3300007265 Bacteria 1805
80 Ga0105240_10101502 3300009093 Bacteria 3499
81 Ga0105240_10398682 3300009093 Bacteria 1550
82 Ga0105243_11926851 3300009148 Bacteria 624
83 Ga0105242_10360810 3300009176 Bacteria 1345
84 Ga0105238_10019964 3300009551 Bacteria 6822
85 Ga0105249_10662608 3300009553 Bacteria 1102
86 Ga0105249_13383932 3300009553 Unclassified 513
87 Ga0157373_10083738 3300013100 Bacteria 2248
88 Ga0157373_10705517 3300013100 Bacteria 739
89 Ga0157371_10043195 3300013102 Bacteria 3211
90 Ga0157370_10335774 3300013104 Bacteria 1393
91 Ga0157370_11361240 3300013104 Unclassified 639
92 Ga0157369_10124733 3300013105 Bacteria 2731
93 Ga0157374_10948366 3300013296 Unclassified 879
94 Ga0157378_10021395 3300013297 Bacteria 5688
95 Ga0157372_10006941 3300013307 Bacteria 12053
96 Ga0157375_10695325 3300013308 Bacteria 1171
97 Ga0163163_11160940 3300014325 Bacteria 835
98 Ga0157376_12141400 3300014969 Unclassified 598
99 Ga0213873_10083929 3300021358 Bacteria 895
100 Ga0213876_10000080 3300021384 Bacteria 109125
101 Ga0213876_10118413 3300021384 Bacteria 1406
102 Ga0213871_10028289 3300021441 Unclassified 1445
103 Ga0213871_10144475 3300021441 Bacteria 721
104 Ga0209436_102634 3300025208 Bacteria 5239
105 Ga0209565_1009006 3300025263 Bacteria 2570
106 Ga0209130_1004895 3300025284 Bacteria 4865
107 Ga0209676_1007593 3300025292 Bacteria 5040
108 Ga0209564_1055564 3300025295 Bacteria 926
109 Ga0209050_1000123 3300025298 Bacteria 195061
110 Ga0209257_1108585 3300025304 Bacteria 665
111 Ga0207645_10035807 3300025907 Bacteria 3187
112 Ga0207705_10003030 3300025909 Bacteria 12811
113 Ga0207705_10003031 3300025909 Bacteria 12811
114 Ga0207684_10115306 3300025910 Bacteria 2301
115 Ga0207707_10195832 3300025912 Bacteria 1763
116 Ga0207707_10430241 3300025912 Unclassified 1131
117 Ga0207707_11428331 3300025912 Bacteria 551
118 Ga0207695_10010200 3300025913 Bacteria 11523
119 Ga0207693_10000009 3300025915 Bacteria 168990
120 Ga0207693_10099460 3300025915 Bacteria 2281
121 Ga0207663_10476491 3300025916 Bacteria 966
122 Ga0207657_10007602 3300025919 Bacteria 11095
123 Ga0207652_10321082 3300025921 Bacteria 1398
124 Ga0207646_10763727 3300025922 Unclassified 862
125 Ga0207694_10013774 3300025924 Bacteria 6095
126 Ga0207700_10018109 3300025928 Bacteria 4724
127 Ga0207686_10044480 3300025934 Bacteria 2727
128 Ga0207670_10557417 3300025936 Bacteria 937
129 Ga0207667_10006542 3300025949 Bacteria 14094
130 Ga0207712_10734371 3300025961 Bacteria 864
131 Ga0207640_10001328 3300025981 Bacteria 13412
132 Ga0207678_10010359 3300026067 Bacteria 8184
133 Ga0207698_10070470 3300026142 Bacteria 2770
134 Ga0209813_10104414 3300027866 Bacteria 968
135 Ga0265338_10649433 3300028800 Unclassified 731
136 Ga0265331_10032153 3300031250 Bacteria 2602
137 Ga0265327_10027710 3300031251 Bacteria 3255
138 Ga0265327_10034090 3300031251 Bacteria 2829
139 Ga0307508_10679394 3300031616 Unclassified 637
140 Ga0307510_10267601 3300033180 Bacteria 1187
141 Ga0373929_0000030 3300035085 Bacteria 50118
142 Ga0373952_0219818 3300035092 Bacteria 564
143 Ga0373961_0000177 3300035241 Bacteria 30594
144 Ga0373935_0091624 3300035692 Bacteria 1991
145 Ga0373933_0998267 3300035724 Unclassified 551
146 Ga0316582_0403479 3300036647 Unclassified 942
147 Ga0373925_0007813 3300037068 Bacteria 7788
148 Ga0395899_0019663 3300037312 Bacteria 5127
149 Ga0395899_0109419 3300037312 Bacteria 1988
150 Ga0395900_0042515 3300037418 Bacteria 4683
151 Ga0395898_0645648 3300037466 Bacteria 1001
152 Ga0436364_0769721 3300037853 Bacteria 1750
153 Ga0436364_1435810 3300037853 Unclassified 804
154 Ga0395901_0967090 3300038443 Bacteria 829
155 Ga0400484_26135 3300038725 Bacteria 1017
156 Ga0400483_041108 3300039062 Unclassified 1628
157 Ga0400483_131477 3300039062 Bacteria 9528
158 Ga0400483_136309 3300039062 Unclassified 1943
159 Ga0400483_225215 3300039062 Bacteria 3190
160 Ga0400483_252387 3300039062 Bacteria 2387
161 Ga0400483_278301 3300039062 Bacteria 5278
162 Ga0436365_0236145 3300039437 Bacteria 1404
163 Ga0436365_0625858 3300039437 Bacteria 2567
164 Ga0436365_0654088 3300039437 Bacteria 5098
165 Ga0436365_1645708 3300039437 Bacteria 58473
166 Ga0436360_0052463 3300039438 Bacteria 726
167 Ga0436360_0418580 3300039438 Bacteria 6584
168 Ga0436360_0509298 3300039438 Bacteria 629
169 Ga0436360_1107536 3300039438 Bacteria 2227
170 Ga0436361_0117944 3300039447 Bacteria 3545
171 Ga0436361_0204858 3300039447 Bacteria 3017
172 Ga0436363_0019151 3300039450 Bacteria 1613
173 Ga0436363_0902946 3300039450 Bacteria 764
174 Ga0436363_1715526 3300039450 Bacteria 515
175 Ga0436362_0441251 3300039453 Bacteria 4538
176 Ga0436362_0502288 3300039453 Bacteria 1857
177 Ga0451787_585425 3300041441 Bacteria 1781
178 Ga0451802_0745220 3300041460 Bacteria 3425
179 Ga0451833_0241633 3300041491 Bacteria 983
180 Ga0451835_1016033 3300041492 Bacteria 675
181 Ga0451849_0076184 3300041505 Bacteria 866
182 Ga0451853_0789301 3300041512 Unclassified 668
183 Ga0453683_0524792 3300044673 Bacteria 769
184 Ga0466966_0771110 3300044684 Unclassified 580
185 Ga0451576_0001178 3300045051 Bacteria 46877
186 Ga0451576_0096862 3300045051 Bacteria 3068
187 Ga0451576_0196783 3300045051 Bacteria 2105
188 Ga0495638_0005763 3300046460 Bacteria 9123
189 Ga0495605_0000015 3300046474 Bacteria 300227
190 Ga0495630_0001059 3300046517 Bacteria 18970
191 Ga0495630_1210217 3300046517 Bacteria 571
192 Ga0495637_0001266 3300046520 Bacteria 15248
193 Ga0495654_0000004 3300046530 Bacteria 515304
194 Ga0495645_0000023 3300046543 Bacteria 130982
195 Ga0495657_0000011 3300046675 Bacteria 207360
196 Ga0495599_0560263 3300046678 Unclassified 668
197 Ga0495660_0076380 3300046810 Bacteria 1765
198 Ga0495636_0029146 3300047318 Bacteria 2252
199 Ga0495686_0003076 3300047472 Bacteria 14765
200 Ga0495686_0003680 3300047472 Bacteria 13103
201 Ga0495686_0009147 3300047472 Bacteria 7173
202 Ga0495686_0106607 3300047472 Bacteria 1684
203 Ga0496106_0666157 3300048909 Unclassified 831
204 Ga0496117_0035888 3300048920 Bacteria 3716
205 Ga0496120_0114178 3300048923 Bacteria 1406
206 Ga0496123_0001861 3300048926 Bacteria 27666
207 Ga0496124_0450527 3300048927 Bacteria 878
208 Ga0501031_0065187 3300049568 Bacteria 2373
209 Ga0501031_0261929 3300049568 Bacteria 1123
210 Ga0501031_1090256 3300049568 Unclassified 510
211 Ga0501032_0113071 3300049569 Bacteria 1796
212 Ga0501033_0184131 3300049570 Bacteria 1496
213 Ga0501034_0069275 3300049571 Bacteria 3539
214 Ga0501034_1204768 3300049571 Bacteria 636
215 Ga0501036_0065133 3300049572 Bacteria 3084
216 Ga0501037_0044424 3300049573 Bacteria 3263
217 Ga0501038_0169811 3300049574 Bacteria 1766
218 Ga0501039_0018665 3300049575 Bacteria 5325
219 Ga0501040_0024199 3300049576 Bacteria 4074
220 Ga0501040_0368478 3300049576 Bacteria 1030
221 Ga0501041_0186907 3300049577 Bacteria 1297
222 Ga0501041_0199240 3300049577 Bacteria 1255
223 Ga0501041_0379546 3300049577 Bacteria 894
224 Ga0501042_0051237 3300049578 Bacteria 2944
225 Ga0501043_0143119 3300049579 Bacteria 1872
226 Ga0501046_0352947 3300049580 Bacteria 1067
227 Ga0501048_0114923 3300049582 Bacteria 1901
228 Ga0501067_0251651 3300049583 Bacteria 983
229 Ga0501068_0075162 3300049584 Bacteria 2066
230 Ga0501069_0646048 3300049585 Bacteria 636
231 Ga0501070_0007590 3300049586 Bacteria 9214
232 Ga0501070_0053535 3300049586 Bacteria 3347
233 Ga0501070_0192445 3300049586 Bacteria 1676
234 Ga0501070_1415805 3300049586 Bacteria 528
235 Ga0501071_0112741 3300049587 Unclassified 2011
236 Ga0501071_0157619 3300049587 Bacteria 1695
237 Ga0501072_0006621 3300049588 Bacteria 8819
238 Ga0501072_0006969 3300049588 Bacteria 8577
239 Ga0501073_0034372 3300049589 Bacteria 3608
240 Ga0501074_0011000 3300049590 Bacteria 6569
241 Ga0501074_0215009 3300049590 Bacteria 1369
242 Ga0501075_0102520 3300049591 Bacteria 2173
243 Ga0501076_0041880 3300049592 Bacteria 3605
244 Ga0501076_0320522 3300049592 Bacteria 1271
245 Ga0501076_0360625 3300049592 Bacteria 1194
246 Ga0501077_0070660 3300049593 Bacteria 2212
247 Ga0501079_0012930 3300049741 Bacteria 6369
248 Ga0501079_0171901 3300049741 Unclassified 1690
249 Ga0501080_0036534 3300049742 Bacteria 4585
250 Ga0501080_0042917 3300049742 Bacteria 4210
251 Ga0501080_0313880 3300049742 Bacteria 1420
252 Ga0501080_0337792 3300049742 Bacteria 1361
253 Ga0501081_0185865 3300049743 Bacteria 1504
254 Ga0501081_0334436 3300049743 Bacteria 1114
255 Ga0501083_0007473 3300049744 Bacteria 7741
256 Ga0501083_0104673 3300049744 Bacteria 1864
257 Ga0501035_0048894 3300049822 Bacteria 3791
258 Ga0501044_0297944 3300049823 Bacteria 1542
259 Ga0501044_0975983 3300049823 Unclassified 720
260 Ga0501045_0157541 3300049824 Bacteria 1689
261 Ga0501045_0263077 3300049824 Unclassified 1284
262 nmdc:mga03683_17223_c1 3300050489 Bacteria 2731
263 nmdc:mga03683_8420_c1 3300050489 Bacteria 3628
264 nmdc:mga03n38_552195_c1 3300050490 Bacteria 652
265 nmdc:mga00v17_397833_c1 3300050491 Bacteria 895
266 nmdc:mga00v17_61203_c1 3300050491 Bacteria 2313
267 nmdc:mga0yw44_146071_c1 3300050492 Bacteria 1540
268 nmdc:mga0yw44_395369_c1 3300050492 Bacteria 934
269 nmdc:mga0yw44_427756_c1 3300050492 Bacteria 897
270 nmdc:mga0k408_162063_c1 3300050493 Bacteria 1333
271 nmdc:mga0k408_651980_c1 3300050493 Bacteria 619
272 nmdc:mga0k408_923369_c1 3300050493 Bacteria 506
273 nmdc:mga06z11_15139_c1 3300050494 Bacteria 3435
274 nmdc:mga06z11_167991_c1 3300050494 Bacteria 1258
275 nmdc:mga06z11_581663_c1 3300050494 Bacteria 681
276 nmdc:mga04h51_123154_c1 3300050495 Bacteria 968
277 nmdc:mga07m45_104865_c1 3300050496 Bacteria 1625
278 nmdc:mga07m45_45697_c1 3300050496 Bacteria 2459
279 nmdc:mga09592_817008_c1 3300050508 Unclassified 788
280 nmdc:mga0qj67_5140_c1 3300050509 Bacteria 9534
281 nmdc:mga06r32_78689_c1 3300050510 Bacteria 3205
282 nmdc:mga0n895_1655119_c1 3300050512 Bacteria 603
283 nmdc:mga0sz30_7319_c1 3300050516 Bacteria 4135
284 Ga0500583_0022181 3300053092 Unclassified 2656
285 Ga0500566_0024508 3300053094 Bacteria 3541
286 Ga0500559_0142924 3300053136 Unclassified 1121
287 Ga0500568_0000704 3300053139 Bacteria 23996
288 Ga0500577_0003808 3300053142 Unclassified 3940
289 Ga0500636_0474858 3300053177 Unclassified 559
290 Ga0501084_0090993 3300054114 Bacteria 2561
291 Ga0501084_0314676 3300054114 Unclassified 1322
292 Ga0501084_0398215 3300054114 Bacteria 1163
293 Ga0501084_1263654 3300054114 Unclassified 619
294 Ga0587109_085996 3300059624 Unclassified 703
295 Ga0501082_0004240 3300060353 Bacteria 12530
296 Ga0501082_0303866 3300060353 Bacteria 1389
297 Ga0501082_1181151 3300060353 Bacteria 669
298 Ga0501082_1720739 3300060353 Bacteria 547
299 Ga0530510_0037734 3300061734 Bacteria 3486
300 Ga0530510_0148145 3300061734 Bacteria 1732
301 Ga0530510_0677775 3300061734 Unclassified 785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0509298 Ga0436360_0509298_40_360 106
2 3300050493 nmdc:mga0k408_923369_c1 nmdc:mga0k408_923369_c1_137_496 119
3 3300005985 Ga0081539_10295210 Ga0081539_102952102 123
4 3300006871 Ga0075434_100649306 Ga0075434_1006493063 123
5 3300009148 Ga0105243_11926851 Ga0105243_119268511 123
6 3300025912 Ga0207707_11428331 Ga0207707_114283312 123
7 3300025916 Ga0207663_10476491 Ga0207663_104764911 123
8 3300031251 Ga0265327_10027710 Ga0265327_100277102 123
9 3300031616 Ga0307508_10679394 Ga0307508_106793942 123
10 3300035241 Ga0373961_0000177 Ga0373961_0000177_24784_25155 123
11 3300041492 Ga0451835_1016033 Ga0451835_1016033_287_658 123
12 3300044684 Ga0466966_0771110 Ga0466966_0771110_89_460 123
13 3300049568 Ga0501031_0261929 Ga0501031_0261929_299_670 123
14 3300049569 Ga0501032_0113071 Ga0501032_0113071_369_740 123
15 3300049570 Ga0501033_0184131 Ga0501033_0184131_288_659 123
16 3300049572 Ga0501036_0065133 Ga0501036_0065133_1212_1583 123
17 3300049573 Ga0501037_0044424 Ga0501037_0044424_1072_1443 123
18 3300049574 Ga0501038_0169811 Ga0501038_0169811_244_615 123
19 3300049575 Ga0501039_0018665 Ga0501039_0018665_3376_3747 123
20 3300049576 Ga0501040_0024199 Ga0501040_0024199_1074_1445 123
21 3300049577 Ga0501041_0186907 Ga0501041_0186907_604_975 123
22 3300049578 Ga0501042_0051237 Ga0501042_0051237_1472_1843 123
23 3300049579 Ga0501043_0143119 Ga0501043_0143119_461_832 123
24 3300049580 Ga0501046_0352947 Ga0501046_0352947_438_809 123
25 3300049582 Ga0501048_0114923 Ga0501048_0114923_173_544 123
26 3300049584 Ga0501068_0075162 Ga0501068_0075162_118_489 123
27 3300049586 Ga0501070_0053535 Ga0501070_0053535_196_567 123
28 3300049587 Ga0501071_0157619 Ga0501071_0157619_373_744 123
29 3300049588 Ga0501072_0006621 Ga0501072_0006621_1196_1567 123
30 3300049589 Ga0501073_0034372 Ga0501073_0034372_2906_3277 123
31 3300049590 Ga0501074_0011000 Ga0501074_0011000_3031_3402 123
32 3300049591 Ga0501075_0102520 Ga0501075_0102520_298_669 123
33 3300049592 Ga0501076_0041880 Ga0501076_0041880_1224_1595 123
34 3300049593 Ga0501077_0070660 Ga0501077_0070660_1195_1566 123
35 3300049741 Ga0501079_0012930 Ga0501079_0012930_2810_3181 123
36 3300049742 Ga0501080_0337792 Ga0501080_0337792_342_713 123
37 3300049743 Ga0501081_0334436 Ga0501081_0334436_558_929 123
38 3300049744 Ga0501083_0104673 Ga0501083_0104673_1018_1389 123
39 3300049822 Ga0501035_0048894 Ga0501035_0048894_2155_2526 123
40 3300049823 Ga0501044_0297944 Ga0501044_0297944_928_1299 123
41 3300049824 Ga0501045_0157541 Ga0501045_0157541_769_1140 123
42 3300050512 nmdc:mga0n895_1655119_c1 nmdc:mga0n895_1655119_c1_24_395 123
43 3300053094 Ga0500566_0024508 Ga0500566_0024508_640_1011 123
44 3300053136 Ga0500559_0142924 Ga0500559_0142924_451_822 123
45 3300053177 Ga0500636_0474858 Ga0500636_0474858_166_537 123
46 3300054114 Ga0501084_0090993 Ga0501084_0090993_268_639 123
47 3300060353 Ga0501082_0303866 Ga0501082_0303866_375_746 123
48 3300061734 Ga0530510_0037734 Ga0530510_0037734_496_867 123
49 3300005329 Ga0070683_100832608 Ga0070683_1008326082 124
50 3300005345 Ga0070692_10176298 Ga0070692_101762983 124
51 3300005548 Ga0070665_100481362 Ga0070665_1004813622 124
52 3300009093 Ga0105240_10398682 Ga0105240_103986822 124
53 3300036647 Ga0316582_0403479 Ga0316582_0403479_545_928 124
54 3300037853 Ga0436364_1435810 Ga0436364_1435810_302_676 124
55 3300039062 Ga0400483_041108 Ga0400483_041108_620_1000 124
56 3300039062 Ga0400483_131477 Ga0400483_131477_1512_1892 124
57 3300039062 Ga0400483_252387 Ga0400483_252387_218_598 124
58 3300039062 Ga0400483_278301 Ga0400483_278301_701_1081 124
59 3300039437 Ga0436365_0654088 Ga0436365_0654088_1313_1687 124
60 3300041491 Ga0451833_0241633 Ga0451833_0241633_47_424 124
61 3300041512 Ga0451853_0789301 Ga0451853_0789301_247_624 124
62 3300046517 Ga0495630_1210217 Ga0495630_1210217_89_466 124
63 3300049571 Ga0501034_1204768 Ga0501034_1204768_73_453 124
64 3300049576 Ga0501040_0368478 Ga0501040_0368478_429_803 124
65 3300049586 Ga0501070_0192445 Ga0501070_0192445_878_1258 124
66 iso_pu_bacteria 2849573788 2849575085 124
67 iso_pu_bacteria 2884960567 2884960848 124
68 3300005434 Ga0070709_10635371 Ga0070709_106353712 125
69 3300005436 Ga0070713_100020000 Ga0070713_1000200004 125
70 3300005436 Ga0070713_101858838 Ga0070713_1018588381 125
71 3300005471 Ga0070698_100192834 Ga0070698_1001928342 125
72 3300006028 Ga0070717_10004174 Ga0070717_100041743 125
73 3300006048 Ga0075363_100689493 Ga0075363_1006894931 125
74 3300006051 Ga0075364_10332159 Ga0075364_103321592 125
75 3300006175 Ga0070712_100000003 Ga0070712_100000003250 125
76 3300006186 Ga0075369_10008126 Ga0075369_100081262 125
77 3300006353 Ga0075370_10028840 Ga0075370_100288402 125
78 3300021441 Ga0213871_10028289 Ga0213871_100282892 125
79 3300025915 Ga0207693_10000009 Ga0207693_10000009157 125
80 3300025922 Ga0207646_10763727 Ga0207646_107637272 125
81 3300025928 Ga0207700_10018109 Ga0207700_100181094 125
82 3300027866 Ga0209813_10104414 Ga0209813_101044141 125
83 3300039438 Ga0436360_0418580 Ga0436360_0418580_1764_2147 125
84 3300039447 Ga0436361_0117944 Ga0436361_0117944_2474_2857 125
85 3300047472 Ga0495686_0003680 Ga0495686_0003680_7850_8227 125
86 3300049568 Ga0501031_1090256 Ga0501031_1090256_101_478 125
87 3300049577 Ga0501041_0379546 Ga0501041_0379546_53_430 125
88 3300049587 Ga0501071_0112741 Ga0501071_0112741_1178_1555 125
89 3300049741 Ga0501079_0171901 Ga0501079_0171901_28_405 125
90 3300049824 Ga0501045_0263077 Ga0501045_0263077_289_666 125
91 3300050489 nmdc:mga03683_8420_c1 nmdc:mga03683_8420_c1_1303_1683 125
92 3300050490 nmdc:mga03n38_552195_c1 nmdc:mga03n38_552195_c1_74_454 125
93 3300050492 nmdc:mga0yw44_395369_c1 nmdc:mga0yw44_395369_c1_159_539 125
94 3300050493 nmdc:mga0k408_162063_c1 nmdc:mga0k408_162063_c1_589_969 125
95 3300050494 nmdc:mga06z11_15139_c1 nmdc:mga06z11_15139_c1_2367_2747 125
96 3300050495 nmdc:mga04h51_123154_c1 nmdc:mga04h51_123154_c1_523_903 125
97 3300050496 nmdc:mga07m45_45697_c1 nmdc:mga07m45_45697_c1_2032_2412 125
98 3300050516 nmdc:mga0sz30_7319_c1 nmdc:mga0sz30_7319_c1_1318_1698 125
99 3300054114 Ga0501084_0314676 Ga0501084_0314676_481_858 125
100 3300059624 Ga0587109_085996 Ga0587109_085996_237_614 125
101 3300060353 Ga0501082_1720739 Ga0501082_1720739_140_517 125
102 3300003203 JGI25406J46586_10000839 JGI25406J46586_100008393 126
103 3300005328 Ga0070676_10102010 Ga0070676_101020102 126
104 3300005337 Ga0070682_100055225 Ga0070682_1000552253 126
105 3300005458 Ga0070681_10692441 Ga0070681_106924412 126
106 3300005563 Ga0068855_102195703 Ga0068855_1021957032 126
107 3300005841 Ga0068863_101420047 Ga0068863_1014200472 126
108 3300005985 Ga0081539_10002975 Ga0081539_1000297525 126
109 3300006358 Ga0068871_101482296 Ga0068871_1014822962 126
110 3300013104 Ga0157370_11361240 Ga0157370_113612402 126
111 3300014969 Ga0157376_12141400 Ga0157376_121414002 126
112 3300025907 Ga0207645_10035807 Ga0207645_100358073 126
113 3300025912 Ga0207707_10195832 Ga0207707_101958323 126
114 3300035085 Ga0373929_0000030 Ga0373929_0000030_5622_6002 126
115 3300035092 Ga0373952_0219818 Ga0373952_0219818_55_435 126
116 3300047318 Ga0495636_0029146 Ga0495636_0029146_1268_1651 126
117 3300049568 Ga0501031_0065187 Ga0501031_0065187_1463_1846 126
118 3300049823 Ga0501044_0975983 Ga0501044_0975983_323_706 126
119 3300005365 Ga0070688_100999396 Ga0070688_1009993961 127
120 3300005844 Ga0068862_100472242 Ga0068862_1004722422 127
121 3300006038 Ga0075365_10537886 Ga0075365_105378862 127
122 3300009553 Ga0105249_13383932 Ga0105249_133839321 127
123 3300014325 Ga0163163_11160940 Ga0163163_111609401 127
124 3300028800 Ga0265338_10649433 Ga0265338_106494332 127
125 3300035692 Ga0373935_0091624 Ga0373935_0091624_217_603 127
126 3300035724 Ga0373933_0998267 Ga0373933_0998267_61_462 127
127 3300037068 Ga0373925_0007813 Ga0373925_0007813_4828_5214 127
128 3300046517 Ga0495630_0001059 Ga0495630_0001059_16770_17159 127
129 3300046543 Ga0495645_0000023 Ga0495645_0000023_84446_84835 127
130 3300046675 Ga0495657_0000011 Ga0495657_0000011_188268_188657 127
131 3300046678 Ga0495599_0560263 Ga0495599_0560263_186_575 127
132 3300047472 Ga0495686_0003076 Ga0495686_0003076_13624_14010 127
133 3300049577 Ga0501041_0199240 Ga0501041_0199240_312_698 127
134 3300049583 Ga0501067_0251651 Ga0501067_0251651_399_785 127
135 3300049592 Ga0501076_0360625 Ga0501076_0360625_305_691 127
136 3300049743 Ga0501081_0185865 Ga0501081_0185865_1067_1453 127
137 3300053139 Ga0500568_0000704 Ga0500568_0000704_16114_16497 127
138 3300054114 Ga0501084_1263654 Ga0501084_1263654_176_562 127
139 3300061734 Ga0530510_0677775 Ga0530510_0677775_128_514 127
140 3300002739 JGI25158J39367_1001833 JGI25158J39367_10018337 128
141 3300002987 JGI25159J45721_1012550 JGI25159J45721_10125504 128
142 3300003203 JGI25406J46586_10022309 JGI25406J46586_100223094 128
143 3300003316 rootH1_10099223 rootH1_100992232 128
144 3300003320 rootH2_10055142 rootH2_100551422 128
145 3300003322 rootL2_10048795 rootL2_100487955 128
146 3300003374 JGI25161J50226_1003149 JGI25161J50226_10031493 128
147 3300003771 Ga0055526_1049876 Ga0055526_10498761 128
148 3300003773 Ga0055537_1008547 Ga0055537_10085474 128
149 3300003791 Ga0055530_10001339 Ga0055530_1000133925 128
150 3300004625 Ga0055543_1002801 Ga0055543_10028017 128
151 3300005262 Ga0065165_1008561 Ga0065165_10085617 128
152 3300005289 Ga0065704_10196567 Ga0065704_101965672 128
153 3300005295 Ga0065707_10122862 Ga0065707_101228623 128
154 3300005295 Ga0065707_10197688 Ga0065707_101976882 128
155 3300005327 Ga0070658_10034650 Ga0070658_100346502 128
156 3300005327 Ga0070658_10181450 Ga0070658_101814502 128
157 3300005330 Ga0070690_100234032 Ga0070690_1002340322 128
158 3300005331 Ga0070670_100057258 Ga0070670_1000572585 128
159 3300005336 Ga0070680_100099902 Ga0070680_1000999023 128
160 3300005339 Ga0070660_100058433 Ga0070660_1000584332 128
161 3300005340 Ga0070689_100753777 Ga0070689_1007537772 128
162 3300005354 Ga0070675_100000005 Ga0070675_100000005231 128
163 3300005365 Ga0070688_101371166 Ga0070688_1013711661 128
164 3300005435 Ga0070714_101476214 Ga0070714_1014762142 128
165 3300005445 Ga0070708_100164040 Ga0070708_1001640402 128
166 3300005455 Ga0070663_100090914 Ga0070663_1000909143 128
167 3300005458 Ga0070681_10469873 Ga0070681_104698732 128
168 3300005459 Ga0068867_100398747 Ga0068867_1003987472 128
169 3300005467 Ga0070706_100375714 Ga0070706_1003757142 128
170 3300005518 Ga0070699_100567918 Ga0070699_1005679182 128
171 3300005530 Ga0070679_100045310 Ga0070679_1000453104 128
172 3300005530 Ga0070679_100055746 Ga0070679_1000557464 128
173 3300005536 Ga0070697_100042052 Ga0070697_1000420524 128
174 3300005563 Ga0068855_100210293 Ga0068855_1002102933 128
175 3300005578 Ga0068854_100044149 Ga0068854_1000441494 128
176 3300005616 Ga0068852_100124819 Ga0068852_1001248195 128
177 3300005985 Ga0081539_10004073 Ga0081539_1000407318 128
178 3300005985 Ga0081539_10033099 Ga0081539_100330993 128
179 3300006028 Ga0070717_11783111 Ga0070717_117831112 128
180 3300006038 Ga0075365_10030030 Ga0075365_100300305 128
181 3300006038 Ga0075365_10253672 Ga0075365_102536722 128
182 3300006048 Ga0075363_100341473 Ga0075363_1003414732 128
183 3300006051 Ga0075364_10311940 Ga0075364_103119401 128
184 3300006175 Ga0070712_100050084 Ga0070712_1000500844 128
185 3300006177 Ga0075362_10010165 Ga0075362_100101651 128
186 3300006178 Ga0075367_10199230 Ga0075367_101992303 128
187 3300006195 Ga0075366_10068165 Ga0075366_100681652 128
188 3300006353 Ga0075370_10044827 Ga0075370_100448272 128
189 3300006846 Ga0075430_100051678 Ga0075430_1000516784 128
190 3300006847 Ga0075431_100089713 Ga0075431_1000897131 128
191 3300006881 Ga0068865_100554733 Ga0068865_1005547332 128
192 3300007265 Ga0099794_10062963 Ga0099794_100629631 128
193 3300009093 Ga0105240_10101502 Ga0105240_101015024 128
194 3300009176 Ga0105242_10360810 Ga0105242_103608102 128
195 3300009551 Ga0105238_10019964 Ga0105238_100199644 128
196 3300009553 Ga0105249_10662608 Ga0105249_106626083 128
197 3300013100 Ga0157373_10083738 Ga0157373_100837383 128
198 3300013100 Ga0157373_10705517 Ga0157373_107055172 128
199 3300013102 Ga0157371_10043195 Ga0157371_100431953 128
200 3300013104 Ga0157370_10335774 Ga0157370_103357741 128
201 3300013105 Ga0157369_10124733 Ga0157369_101247334 128
202 3300013296 Ga0157374_10948366 Ga0157374_109483661 128
203 3300013297 Ga0157378_10021395 Ga0157378_100213959 128
204 3300013307 Ga0157372_10006941 Ga0157372_100069419 128
205 3300013308 Ga0157375_10695325 Ga0157375_106953252 128
206 3300021358 Ga0213873_10083929 Ga0213873_100839292 128
207 3300021384 Ga0213876_10000080 Ga0213876_1000008037 128
208 3300021384 Ga0213876_10118413 Ga0213876_101184132 128
209 3300021441 Ga0213871_10144475 Ga0213871_101444752 128
210 3300025208 Ga0209436_102634 Ga0209436_1026346 128
211 3300025263 Ga0209565_1009006 Ga0209565_10090064 128
212 3300025284 Ga0209130_1004895 Ga0209130_10048954 128
213 3300025292 Ga0209676_1007593 Ga0209676_10075932 128
214 3300025295 Ga0209564_1055564 Ga0209564_10555642 128
215 3300025298 Ga0209050_1000123 Ga0209050_1000123155 128
216 3300025304 Ga0209257_1108585 Ga0209257_11085852 128
217 3300025909 Ga0207705_10003030 Ga0207705_100030305 128
218 3300025909 Ga0207705_10003031 Ga0207705_100030319 128
219 3300025910 Ga0207684_10115306 Ga0207684_101153063 128
220 3300025912 Ga0207707_10430241 Ga0207707_104302413 128
221 3300025913 Ga0207695_10010200 Ga0207695_100102004 128
222 3300025915 Ga0207693_10099460 Ga0207693_100994603 128
223 3300025919 Ga0207657_10007602 Ga0207657_100076024 128
224 3300025921 Ga0207652_10321082 Ga0207652_103210823 128
225 3300025924 Ga0207694_10013774 Ga0207694_100137742 128
226 3300025934 Ga0207686_10044480 Ga0207686_100444801 128
227 3300025936 Ga0207670_10557417 Ga0207670_105574172 128
228 3300025949 Ga0207667_10006542 Ga0207667_100065425 128
229 3300025961 Ga0207712_10734371 Ga0207712_107343713 128
230 3300025981 Ga0207640_10001328 Ga0207640_100013285 128
231 3300026067 Ga0207678_10010359 Ga0207678_100103593 128
232 3300026142 Ga0207698_10070470 Ga0207698_100704703 128
233 3300031250 Ga0265331_10032153 Ga0265331_100321533 128
234 3300031251 Ga0265327_10034090 Ga0265327_100340903 128
235 3300033180 Ga0307510_10267601 Ga0307510_102676012 128
236 3300037312 Ga0395899_0019663 Ga0395899_0019663_3572_3958 128
237 3300037312 Ga0395899_0109419 Ga0395899_0109419_1220_1606 128
238 3300037418 Ga0395900_0042515 Ga0395900_0042515_2244_2630 128
239 3300037466 Ga0395898_0645648 Ga0395898_0645648_260_646 128
240 3300037853 Ga0436364_0769721 Ga0436364_0769721_199_585 128
241 3300038443 Ga0395901_0967090 Ga0395901_0967090_83_469 128
242 3300038725 Ga0400484_26135 Ga0400484_26135_395_781 128
243 3300039062 Ga0400483_136309 Ga0400483_136309_642_1028 128
244 3300039062 Ga0400483_225215 Ga0400483_225215_1889_2275 128
245 3300039437 Ga0436365_0236145 Ga0436365_0236145_171_557 128
246 3300039437 Ga0436365_0625858 Ga0436365_0625858_2109_2495 128
247 3300039437 Ga0436365_1645708 Ga0436365_1645708_50157_50543 128
248 3300039438 Ga0436360_0052463 Ga0436360_0052463_28_414 128
249 3300039438 Ga0436360_1107536 Ga0436360_1107536_45_431 128
250 3300039447 Ga0436361_0204858 Ga0436361_0204858_1835_2221 128
251 3300039450 Ga0436363_0019151 Ga0436363_0019151_10_399 128
252 3300039450 Ga0436363_0902946 Ga0436363_0902946_259_645 128
253 3300039450 Ga0436363_1715526 Ga0436363_1715526_115_501 128
254 3300039453 Ga0436362_0441251 Ga0436362_0441251_1314_1700 128
255 3300039453 Ga0436362_0502288 Ga0436362_0502288_1419_1805 128
256 3300041441 Ga0451787_585425 Ga0451787_585425_1282_1668 128
257 3300041460 Ga0451802_0745220 Ga0451802_0745220_159_545 128
258 3300041505 Ga0451849_0076184 Ga0451849_0076184_188_574 128
259 3300044673 Ga0453683_0524792 Ga0453683_0524792_147_557 128
260 3300045051 Ga0451576_0001178 Ga0451576_0001178_19621_20031 128
261 3300045051 Ga0451576_0096862 Ga0451576_0096862_971_1381 128
262 3300045051 Ga0451576_0196783 Ga0451576_0196783_789_1199 128
263 3300046460 Ga0495638_0005763 Ga0495638_0005763_511_897 128
264 3300046474 Ga0495605_0000015 Ga0495605_0000015_16672_17058 128
265 3300046520 Ga0495637_0001266 Ga0495637_0001266_12704_13090 128
266 3300046530 Ga0495654_0000004 Ga0495654_0000004_410356_410742 128
267 3300046810 Ga0495660_0076380 Ga0495660_0076380_1217_1603 128
268 3300047472 Ga0495686_0009147 Ga0495686_0009147_4964_5350 128
269 3300047472 Ga0495686_0106607 Ga0495686_0106607_140_526 128
270 3300048909 Ga0496106_0666157 Ga0496106_0666157_231_626 128
271 3300048920 Ga0496117_0035888 Ga0496117_0035888_2612_2998 128
272 3300048923 Ga0496120_0114178 Ga0496120_0114178_1010_1396 128
273 3300048926 Ga0496123_0001861 Ga0496123_0001861_16098_16484 128
274 3300048927 Ga0496124_0450527 Ga0496124_0450527_106_492 128
275 3300049571 Ga0501034_0069275 Ga0501034_0069275_1666_2052 128
276 3300049585 Ga0501069_0646048 Ga0501069_0646048_67_453 128
277 3300049586 Ga0501070_0007590 Ga0501070_0007590_6089_6475 128
278 3300049586 Ga0501070_1415805 Ga0501070_1415805_44_430 128
279 3300049588 Ga0501072_0006969 Ga0501072_0006969_1617_2003 128
280 3300049590 Ga0501074_0215009 Ga0501074_0215009_219_605 128
281 3300049592 Ga0501076_0320522 Ga0501076_0320522_360_746 128
282 3300049742 Ga0501080_0036534 Ga0501080_0036534_1089_1475 128
283 3300049742 Ga0501080_0042917 Ga0501080_0042917_422_808 128
284 3300049742 Ga0501080_0313880 Ga0501080_0313880_496_882 128
285 3300049744 Ga0501083_0007473 Ga0501083_0007473_2579_2965 128
286 3300050489 nmdc:mga03683_17223_c1 nmdc:mga03683_17223_c1_2167_2553 128
287 3300050491 nmdc:mga00v17_397833_c1 nmdc:mga00v17_397833_c1_417_803 128
288 3300050491 nmdc:mga00v17_61203_c1 nmdc:mga00v17_61203_c1_74_460 128
289 3300050492 nmdc:mga0yw44_146071_c1 nmdc:mga0yw44_146071_c1_436_822 128
290 3300050492 nmdc:mga0yw44_427756_c1 nmdc:mga0yw44_427756_c1_447_833 128
291 3300050493 nmdc:mga0k408_651980_c1 nmdc:mga0k408_651980_c1_80_466 128
292 3300050494 nmdc:mga06z11_167991_c1 nmdc:mga06z11_167991_c1_33_419 128
293 3300050494 nmdc:mga06z11_581663_c1 nmdc:mga06z11_581663_c1_182_568 128
294 3300050496 nmdc:mga07m45_104865_c1 nmdc:mga07m45_104865_c1_834_1220 128
295 3300050508 nmdc:mga09592_817008_c1 nmdc:mga09592_817008_c1_34_420 128
296 3300050509 nmdc:mga0qj67_5140_c1 nmdc:mga0qj67_5140_c1_7520_7906 128
297 3300050510 nmdc:mga06r32_78689_c1 nmdc:mga06r32_78689_c1_27_413 128
298 3300053092 Ga0500583_0022181 Ga0500583_0022181_2061_2447 128
299 3300053142 Ga0500577_0003808 Ga0500577_0003808_3280_3687 128
300 3300054114 Ga0501084_0398215 Ga0501084_0398215_442_828 128
301 3300060353 Ga0501082_0004240 Ga0501082_0004240_5362_5748 128
302 3300060353 Ga0501082_1181151 Ga0501082_1181151_249_635 128
303 3300061734 Ga0530510_0148145 Ga0530510_0148145_598_984 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

25

143

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7533 1 127
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.743 1 127
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7413 1 128
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7362 1 128
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.7355 1 127
ID Description Score Start End Superfamily
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7886 4 124 3.40.50.1010
af_P71623_4_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7665 4 124 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7413 1 128 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7362 1 128 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7355 1 127 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1H3RBS5-F1-model_v4 PIN domain-containing protein 0.9789 75 128
AF-A0A1S1TH44-F1-model_v4 Twitching motility protein PilT 0.977 1 128
AF-A0A1B8Q2C4-F1-model_v4 PIN domain-containing protein 0.9708 3 125
AF-A0A1S1TH44-F1-model_v4 Twitching motility protein PilT 0.9696 1 128
AF-A0A6H0IXD5-F1-model_v4 Type II toxin-antitoxin system VapC family toxin 0.9684 1 128

Feature Viewer

pLDDT pTM Quality
95.27 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map