F396367

General Info

Members Datasets Scaffolds Average Seq Length
302 224 604 282

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100004446|Ga0070698_1000044467
Length 302
Sequence LPEASAGEAWHADAVFDALDHVILAVRDLADATRRYATLFARRPSWRGEHPGQGTANTLFKLHNTYLELISVQGEGPTASLLSERLDAHGEGLVGLAFATRDVDAARAELAARGLDPAPVAPGLGRDADSGLIRRWRTVMLPAARTRGVLLFAIEHGSPDLLPEAAPVGPEDAVISGIDHAVVQTPDAEAAIALYRDGLGLRLALDRSFPDWGMRLVFLRVGGVTVELAQPLRDAPQNTEVDQLWGISWRVPDAEATRARLAEAGLDVSDVRPGRKPGTRVISVKDGTCGVPTLLIEPVASP

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
120 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
209 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
210 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
211 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
212 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
213 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
214 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
215 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
216 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
217 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
218 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
219 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
220 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
221 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
222 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
223 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
224 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.37
Metatranscriptomes 0
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.93
Nodule 4.64
Rhizoplane 7.28
Rhizosphere 73.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100004446 3300005471 Bacteria 15403
2 JGI25404J52841_10006607 3300003659 Bacteria 2434
3 Ga0070683_100005122 3300005329 Bacteria 10899
4 Ga0070680_100009353 3300005336 Bacteria 7529
5 Ga0070682_100224506 3300005337 Bacteria 1339
6 Ga0070682_100231977 3300005337 Bacteria 1320
7 Ga0068868_100088694 3300005338 Bacteria 2489
8 Ga0070660_100036163 3300005339 Bacteria 3740
9 Ga0070668_100241395 3300005347 Bacteria 1497
10 Ga0070668_100268039 3300005347 Bacteria 1422
11 Ga0070675_100446230 3300005354 Bacteria 1160
12 Ga0070671_100272896 3300005355 Bacteria 1437
13 Ga0070673_100406822 3300005364 Bacteria 1218
14 Ga0070659_100074068 3300005366 Bacteria 2712
15 Ga0070659_100226292 3300005366 Bacteria 1545
16 Ga0070667_100254518 3300005367 Bacteria 1570
17 Ga0070709_10336637 3300005434 Bacteria 1112
18 Ga0070700_100372291 3300005441 Bacteria 1066
19 Ga0070663_100072012 3300005455 Bacteria 2516
20 Ga0070663_100091664 3300005455 Bacteria 2252
21 Ga0070681_10075318 3300005458 Bacteria 3335
22 Ga0070707_100119579 3300005468 Bacteria 2557
23 Ga0070679_100010471 3300005530 Bacteria 8796
24 Ga0070684_100060125 3300005535 Bacteria 3323
25 Ga0070697_100028819 3300005536 Bacteria 4447
26 Ga0070697_100330049 3300005536 Bacteria 1315
27 Ga0068853_100013082 3300005539 Bacteria 6768
28 Ga0070672_100414911 3300005543 Bacteria 1155
29 Ga0070665_100085728 3300005548 Bacteria 3155
30 Ga0070665_100092596 3300005548 Bacteria 3027
31 Ga0070665_100216048 3300005548 Bacteria 1918
32 Ga0068855_100012869 3300005563 Bacteria 10096
33 Ga0068855_100102252 3300005563 Bacteria 3298
34 Ga0068857_100006913 3300005577 Bacteria 9770
35 Ga0068854_100234643 3300005578 Bacteria 1458
36 Ga0068859_100229905 3300005617 Bacteria 1942
37 Ga0068859_100370988 3300005617 Bacteria 1527
38 Ga0068864_100122015 3300005618 Bacteria 2331
39 Ga0068864_100214084 3300005618 Bacteria 1775
40 Ga0068861_100190635 3300005719 Bacteria 1713
41 Ga0068851_10007853 3300005834 Bacteria 4913
42 Ga0068863_100169045 3300005841 Bacteria 2096
43 Ga0068863_100617713 3300005841 Bacteria 1073
44 Ga0068858_100053926 3300005842 Bacteria 3718
45 Ga0068860_100096432 3300005843 Bacteria 2819
46 Ga0068860_100511796 3300005843 Bacteria 1199
47 Ga0068862_100017447 3300005844 Bacteria 5979
48 Ga0068862_100364639 3300005844 Bacteria 1343
49 Ga0081455_10002800 3300005937 Bacteria 20533
50 Ga0081455_10008855 3300005937 Bacteria 10411
51 Ga0081455_10017467 3300005937 Bacteria 6875
52 Ga0081540_1000178 3300005983 Bacteria 66386
53 Ga0081540_1006448 3300005983 Bacteria 8541
54 Ga0081540_1013224 3300005983 Bacteria 5379
55 Ga0081540_1014238 3300005983 Bacteria 5109
56 Ga0081540_1022515 3300005983 Bacteria 3721
57 Ga0081540_1025541 3300005983 Bacteria 3396
58 Ga0081540_1030000 3300005983 Bacteria 3019
59 Ga0081540_1073124 3300005983 Bacteria 1576
60 Ga0081540_1085705 3300005983 Bacteria 1402
61 Ga0081539_10000542 3300005985 Bacteria 78012
62 Ga0075365_10023438 3300006038 Bacteria 3882
63 Ga0075365_10050262 3300006038 Bacteria 2749
64 Ga0075365_10166401 3300006038 Bacteria 1538
65 Ga0075368_10027977 3300006042 Bacteria 2177
66 Ga0075363_100001174 3300006048 Bacteria 9626
67 Ga0075363_100188132 3300006048 Bacteria 1177
68 Ga0075364_10054718 3300006051 Bacteria 2610
69 Ga0070712_100361973 3300006175 Bacteria 1190
70 Ga0075367_10065316 3300006178 Bacteria 2178
71 Ga0075367_10100117 3300006178 Bacteria 1771
72 Ga0075369_10018170 3300006186 Bacteria 2860
73 Ga0075366_10081155 3300006195 Bacteria 1937
74 Ga0075366_10083207 3300006195 Bacteria 1913
75 Ga0075370_10037732 3300006353 Bacteria 2717
76 Ga0075428_100253575 3300006844 Bacteria 1895
77 Ga0075429_100257593 3300006880 Bacteria 1528
78 Ga0068865_100241764 3300006881 Bacteria 1421
79 Ga0097620_100229904 3300006931 Bacteria 1942
80 Ga0097620_100370987 3300006931 Bacteria 1527
81 Ga0099795_10045775 3300007788 Bacteria 1574
82 Ga0099795_10141385 3300007788 Bacteria 979
83 Ga0105240_10021576 3300009093 Bacteria 8565
84 Ga0105240_10443022 3300009093 Bacteria 1455
85 Ga0105245_10051851 3300009098 Bacteria 3678
86 Ga0105245_10583247 3300009098 Bacteria 1143
87 Ga0105247_10129209 3300009101 Bacteria 1645
88 Ga0114129_10132231 3300009147 Bacteria 3426
89 Ga0105248_10101895 3300009177 Bacteria 3236
90 Ga0105248_10115102 3300009177 Bacteria 3033
91 Ga0105237_10027337 3300009545 Bacteria 5825
92 Ga0105237_10362630 3300009545 Bacteria 1453
93 Ga0105238_10009836 3300009551 Bacteria 9579
94 Ga0157370_10100885 3300013104 Bacteria 2704
95 Ga0157369_10033947 3300013105 Bacteria 5603
96 Ga0157374_10167798 3300013296 Bacteria 2140
97 Ga0163162_10266195 3300013306 Bacteria 1845
98 Ga0157375_10691841 3300013308 Bacteria 1174
99 Ga0157375_10754652 3300013308 Bacteria 1124
100 Ga0163163_10313195 3300014325 Bacteria 1623
101 Ga0157379_10443293 3300014968 Bacteria 1198
102 Ga0157376_10155318 3300014969 Bacteria 2068
103 Ga0157376_10387051 3300014969 Bacteria 1349
104 Ga0207656_10006363 3300025321 Bacteria 4238
105 Ga0207692_10039135 3300025898 Bacteria 2331
106 Ga0207710_10016162 3300025900 Bacteria 3157
107 Ga0207688_10097599 3300025901 Bacteria 1693
108 Ga0207645_10146633 3300025907 Bacteria 1539
109 Ga0207707_10007520 3300025912 Bacteria 9493
110 Ga0207695_10030077 3300025913 Bacteria 5985
111 Ga0207693_10020044 3300025915 Bacteria 5319
112 Ga0207693_10216852 3300025915 Bacteria 1503
113 Ga0207663_10014436 3300025916 Bacteria 4323
114 Ga0207660_10008731 3300025917 Bacteria 6554
115 Ga0207657_10003303 3300025919 Bacteria 17242
116 Ga0207652_10016235 3300025921 Bacteria 6075
117 Ga0207646_10274053 3300025922 Bacteria 1525
118 Ga0207646_10503069 3300025922 Bacteria 1092
119 Ga0207681_10291903 3300025923 Bacteria 1287
120 Ga0207690_10462133 3300025932 Bacteria 1022
121 Ga0207706_10578289 3300025933 Bacteria 966
122 Ga0207704_10162159 3300025938 Bacteria 1592
123 Ga0207704_10484796 3300025938 Bacteria 993
124 Ga0207711_10238676 3300025941 Bacteria 1666
125 Ga0207711_10309518 3300025941 Bacteria 1458
126 Ga0207689_10136036 3300025942 Bacteria 2023
127 Ga0207689_10146293 3300025942 Bacteria 1947
128 Ga0207661_10020103 3300025944 Bacteria 4986
129 Ga0207667_10034556 3300025949 Bacteria 5428
130 Ga0207668_10310786 3300025972 Bacteria 1304
131 Ga0207658_10431409 3300025986 Bacteria 1164
132 Ga0207703_10082344 3300026035 Bacteria 2685
133 Ga0207639_10002832 3300026041 Bacteria 11633
134 Ga0207678_10045961 3300026067 Bacteria 3776
135 Ga0207678_10092341 3300026067 Bacteria 2587
136 Ga0207708_10152573 3300026075 Bacteria 1820
137 Ga0207641_10678098 3300026088 Bacteria 1014
138 Ga0207648_10569770 3300026089 Bacteria 1042
139 Ga0207676_10390215 3300026095 Bacteria 1298
140 Ga0207674_10006543 3300026116 Bacteria 13703
141 Ga0207675_100068496 3300026118 Bacteria 3316
142 Ga0207683_10234103 3300026121 Bacteria 1675
143 Ga0268266_10001272 3300028379 Bacteria 30802
144 Ga0268266_10231716 3300028379 Bacteria 1701
145 Ga0268265_10033123 3300028380 Bacteria 3753
146 Ga0268265_10215712 3300028380 Bacteria 1675
147 Ga0268265_10267633 3300028380 Bacteria 1523
148 Ga0307513_10451229 3300031456 Bacteria 1010
149 Ga0307508_10114383 3300031616 Bacteria 2299
150 Ga0265314_10064670 3300031711 Bacteria 2475
151 Ga0307516_10098117 3300031730 Bacteria 2749
152 Ga0307413_10150957 3300031824 Bacteria 1619
153 Ga0307410_10110900 3300031852 Bacteria 1985
154 Ga0307410_10526421 3300031852 Bacteria 976
155 Ga0307406_10079893 3300031901 Bacteria 2170
156 Ga0307407_10132066 3300031903 Bacteria 1599
157 Ga0307411_10283812 3300032005 Bacteria 1319
158 Ga0307510_10098110 3300033180 Bacteria 2735
159 Ga0373930_0036700 3300034816 Bacteria 1029
160 Ga0373931_0020786 3300035691 Bacteria 3286
161 Ga0373935_0098536 3300035692 Bacteria 1924
162 Ga0373927_0026518 3300035695 Bacteria 3787
163 Ga0373927_0108785 3300035695 Bacteria 1806
164 Ga0395898_0247179 3300037466 Bacteria 1701
165 Ga0395905_0048057 3300037471 Bacteria 3999
166 Ga0451791_0185792 3300041451 Bacteria 1314
167 Ga0451798_1126084 3300041458 Bacteria 1619
168 Ga0439432_071022 3300042006 Bacteria 1062
169 Ga0466963_0310626 3300044694 Bacteria 1109
170 Ga0466967_0164679 3300045976 Bacteria 2083
171 Ga0495603_0006514 3300046455 Bacteria 7001
172 Ga0495603_0013492 3300046455 Bacteria 4943
173 Ga0495603_0018099 3300046455 Bacteria 4262
174 Ga0495603_0201352 3300046455 Bacteria 1150
175 Ga0495638_0163427 3300046460 Bacteria 1283
176 Ga0495638_0210304 3300046460 Bacteria 1093
177 Ga0495651_0064203 3300046462 Bacteria 2806
178 Ga0495639_0090932 3300046475 Bacteria 1432
179 Ga0495584_0044466 3300046491 Bacteria 2241
180 Ga0495585_0082652 3300046492 Bacteria 1738
181 Ga0495594_0061134 3300046499 Bacteria 2084
182 Ga0495594_0067075 3300046499 Bacteria 1991
183 Ga0495607_0082689 3300046501 Bacteria 1761
184 Ga0495583_0060462 3300046506 Bacteria 1694
185 Ga0495610_0037366 3300046512 Bacteria 2472
186 Ga0495616_0062123 3300046513 Bacteria 1830
187 Ga0495620_0043361 3300046515 Bacteria 1960
188 Ga0495620_0051954 3300046515 Bacteria 1742
189 Ga0495628_0010553 3300046516 Bacteria 7841
190 Ga0495632_0098226 3300046519 Bacteria 1381
191 Ga0495648_0001270 3300046524 Bacteria 25160
192 Ga0495598_0102870 3300046537 Bacteria 947
193 Ga0495621_0062267 3300046539 Bacteria 1357
194 Ga0495621_0075569 3300046539 Bacteria 1248
195 Ga0495597_0045917 3300046542 Bacteria 1937
196 Ga0495622_0039173 3300046557 Bacteria 2207
197 Ga0495622_0172247 3300046557 Bacteria 973
198 Ga0495633_0117801 3300046558 Bacteria 1230
199 Ga0495633_0194000 3300046558 Bacteria 933
200 Ga0495656_0061228 3300046615 Bacteria 1643
201 Ga0495668_0074378 3300046616 Bacteria 1866
202 Ga0495611_0033281 3300046648 Bacteria 2274
203 Ga0495659_0007554 3300046664 Bacteria 3448
204 Ga0495659_0121025 3300046664 Bacteria 1030
205 Ga0495588_0019398 3300046674 Bacteria 3329
206 Ga0495670_0075947 3300046691 Bacteria 1706
207 Ga0495649_0205914 3300046694 Bacteria 1020
208 Ga0495636_0098706 3300047318 Bacteria 1275
209 Ga0495672_0183332 3300047320 Bacteria 1058
210 Ga0495676_0091346 3300047321 Bacteria 2276
211 Ga0495676_0098722 3300047321 Bacteria 2166
212 Ga0495683_0119896 3300047323 Bacteria 1249
213 Ga0495686_0101092 3300047472 Bacteria 1739
214 Ga0495686_0169612 3300047472 Bacteria 1270
215 Ga0495686_0244683 3300047472 Bacteria 1010
216 Ga0495602_0164883 3300048088 Bacteria 1726
217 Ga0495615_0076927 3300048090 Bacteria 909
218 Ga0496100_0008929 3300048903 Bacteria 5606
219 Ga0496102_0075092 3300048905 Bacteria 3107
220 Ga0496102_0127174 3300048905 Bacteria 2383
221 Ga0496103_0158852 3300048906 Bacteria 1450
222 Ga0496104_0041782 3300048907 Bacteria 4300
223 Ga0496106_0044448 3300048909 Bacteria 3334
224 Ga0496106_0107669 3300048909 Bacteria 2168
225 Ga0496106_0509063 3300048909 Bacteria 967
226 Ga0496107_0199633 3300048910 Bacteria 1487
227 Ga0496107_0240528 3300048910 Bacteria 1347
228 Ga0496108_0272243 3300048911 Bacteria 1474
229 Ga0496108_0285487 3300048911 Bacteria 1437
230 Ga0496108_0357878 3300048911 Bacteria 1274
231 Ga0496108_0444364 3300048911 Bacteria 1133
232 Ga0496109_0332243 3300048912 Bacteria 1435
233 Ga0496110_0141650 3300048913 Bacteria 2174
234 Ga0496110_0162736 3300048913 Bacteria 2023
235 Ga0496111_0278465 3300048914 Bacteria 1241
236 Ga0496113_0252308 3300048916 Bacteria 1409
237 Ga0496115_0158804 3300048918 Bacteria 1868
238 Ga0496121_0009890 3300048924 Bacteria 10868
239 Ga0496124_0185286 3300048927 Bacteria 1598
240 Ga0496125_0070314 3300048928 Bacteria 2741
241 Ga0496126_0002321 3300048929 Bacteria 26096
242 Ga0496126_0016736 3300048929 Bacteria 7323
243 Ga0496126_0114937 3300048929 Bacteria 2341
244 Ga0496126_0124180 3300048929 Bacteria 2235
245 Ga0496126_0542590 3300048929 Bacteria 924
246 Ga0501032_0140516 3300049569 Bacteria 1590
247 Ga0501043_0088535 3300049579 Bacteria 2433
248 Ga0501043_0127979 3300049579 Bacteria 1991
249 Ga0501047_0001951 3300049581 Bacteria 19824
250 Ga0501067_0077860 3300049583 Bacteria 1837
251 Ga0501068_0000053 3300049584 Bacteria 45390
252 Ga0501069_0015327 3300049585 Bacteria 4107
253 Ga0501072_0000008 3300049588 Bacteria 216818
254 Ga0501073_0336767 3300049589 Bacteria 1041
255 Ga0501074_0001488 3300049590 Bacteria 15769
256 Ga0501076_0109992 3300049592 Bacteria 2227
257 Ga0501077_0009299 3300049593 Bacteria 6101
258 Ga0501079_0002964 3300049741 Bacteria 12411
259 Ga0501080_0012846 3300049742 Bacteria 7682
260 Ga0501080_0023693 3300049742 Bacteria 5688
261 Ga0501044_0556599 3300049823 Bacteria 1043
262 nmdc:mga03683_97320_c1 3300050489 Bacteria 1290
263 nmdc:mga03n38_421_c1 3300050490 Bacteria 10501
264 nmdc:mga0yw44_113786_c1 3300050492 Bacteria 1310
265 nmdc:mga0yw44_19114_c2 3300050492 Bacteria 2344
266 nmdc:mga0yw44_29290_c1 3300050492 Bacteria 3177
267 nmdc:mga0k408_31961_c1 3300050493 Bacteria 3007
268 nmdc:mga0k408_73403_c1 3300050493 Bacteria 1998
269 nmdc:mga06z11_13642_c1 3300050494 Bacteria 3576
270 nmdc:mga04h51_35176_c1 3300050495 Bacteria 1604
271 nmdc:mga07m45_136402_c1 3300050496 Bacteria 1420
272 nmdc:mga05p37_290068_c1 3300050507 Bacteria 1948
273 nmdc:mga09592_201113_c1 3300050508 Bacteria 1725
274 nmdc:mga0sz30_90382_c1 3300050516 Bacteria 1332
275 Ga0495612_0092815 3300053078 Bacteria 1280
276 Ga0495619_0231245 3300053085 Bacteria 1281
277 Ga0500583_0111653 3300053092 Bacteria 1347
278 Ga0500566_0162390 3300053094 Bacteria 1163
279 Ga0500592_020656 3300053116 Bacteria 1060
280 Ga0500595_006438 3300053119 Bacteria 4981
281 Ga0500595_009237 3300053119 Bacteria 3988
282 Ga0500637_0059294 3300053178 Bacteria 2191
283 Ga0501084_0000005 3300054114 Bacteria 237244
284 Ga0501082_0065403 3300060353 Bacteria 3131
285 Ga0530510_0367406 3300061734 Bacteria 1082
286 2513674871 2513237098 Bacteria 9902361
287 2513697134 2513237101 Bacteria 7952346
288 2513856947 2513237137 Bacteria 9558895
289 2524468249 2524023210 Bacteria 9029266
290 2885391951 2885383462 Bacteria 9473874
291 2903753327 2903748898 Bacteria 9972761
292 2903774858 2903768456 Bacteria 9749579
293 2922361847 2922361189 Bacteria 7436256
294 2935636120 2935630451 Bacteria 8169952
295 2941512751 2941507105 Bacteria 8166816
296 2941520682 2941515067 Bacteria 8166720
297 2941528696 2941523033 Bacteria 8169134
298 8006968859 8006964411 Bacteria 8966052
299 8006984538 8006984368 Bacteria 9651211
300 8006997165 8006994254 Bacteria 8309700
301 8056684824 8056681323 Bacteria 8472857
302 8056690689 8056689827 Bacteria 6712655
303 Ga0070698_100004446
304 JGI25404J52841_10006607
305 Ga0070683_100005122
306 Ga0070680_100009353
307 Ga0070682_100224506
308 Ga0070682_100231977
309 Ga0068868_100088694
310 Ga0070660_100036163
311 Ga0070668_100241395
312 Ga0070668_100268039
313 Ga0070675_100446230
314 Ga0070671_100272896
315 Ga0070673_100406822
316 Ga0070659_100074068
317 Ga0070659_100226292
318 Ga0070667_100254518
319 Ga0070709_10336637
320 Ga0070700_100372291
321 Ga0070663_100072012
322 Ga0070663_100091664
323 Ga0070681_10075318
324 Ga0070707_100119579
325 Ga0070679_100010471
326 Ga0070684_100060125
327 Ga0070697_100028819
328 Ga0070697_100330049
329 Ga0068853_100013082
330 Ga0070672_100414911
331 Ga0070665_100085728
332 Ga0070665_100092596
333 Ga0070665_100216048
334 Ga0068855_100012869
335 Ga0068855_100102252
336 Ga0068857_100006913
337 Ga0068854_100234643
338 Ga0068859_100229905
339 Ga0068859_100370988
340 Ga0068864_100122015
341 Ga0068864_100214084
342 Ga0068861_100190635
343 Ga0068851_10007853
344 Ga0068863_100169045
345 Ga0068863_100617713
346 Ga0068858_100053926
347 Ga0068860_100096432
348 Ga0068860_100511796
349 Ga0068862_100017447
350 Ga0068862_100364639
351 Ga0081455_10002800
352 Ga0081455_10008855
353 Ga0081455_10017467
354 Ga0081540_1000178
355 Ga0081540_1006448
356 Ga0081540_1013224
357 Ga0081540_1014238
358 Ga0081540_1022515
359 Ga0081540_1025541
360 Ga0081540_1030000
361 Ga0081540_1073124
362 Ga0081540_1085705
363 Ga0081539_10000542
364 Ga0075365_10023438
365 Ga0075365_10050262
366 Ga0075365_10166401
367 Ga0075368_10027977
368 Ga0075363_100001174
369 Ga0075363_100188132
370 Ga0075364_10054718
371 Ga0070712_100361973
372 Ga0075367_10065316
373 Ga0075367_10100117
374 Ga0075369_10018170
375 Ga0075366_10081155
376 Ga0075366_10083207
377 Ga0075370_10037732
378 Ga0075428_100253575
379 Ga0075429_100257593
380 Ga0068865_100241764
381 Ga0097620_100229904
382 Ga0097620_100370987
383 Ga0099795_10045775
384 Ga0099795_10141385
385 Ga0105240_10021576
386 Ga0105240_10443022
387 Ga0105245_10051851
388 Ga0105245_10583247
389 Ga0105247_10129209
390 Ga0114129_10132231
391 Ga0105248_10101895
392 Ga0105248_10115102
393 Ga0105237_10027337
394 Ga0105237_10362630
395 Ga0105238_10009836
396 Ga0157370_10100885
397 Ga0157369_10033947
398 Ga0157374_10167798
399 Ga0163162_10266195
400 Ga0157375_10691841
401 Ga0157375_10754652
402 Ga0163163_10313195
403 Ga0157379_10443293
404 Ga0157376_10155318
405 Ga0157376_10387051
406 Ga0207656_10006363
407 Ga0207692_10039135
408 Ga0207710_10016162
409 Ga0207688_10097599
410 Ga0207645_10146633
411 Ga0207707_10007520
412 Ga0207695_10030077
413 Ga0207693_10020044
414 Ga0207693_10216852
415 Ga0207663_10014436
416 Ga0207660_10008731
417 Ga0207657_10003303
418 Ga0207652_10016235
419 Ga0207646_10274053
420 Ga0207646_10503069
421 Ga0207681_10291903
422 Ga0207690_10462133
423 Ga0207706_10578289
424 Ga0207704_10162159
425 Ga0207704_10484796
426 Ga0207711_10238676
427 Ga0207711_10309518
428 Ga0207689_10136036
429 Ga0207689_10146293
430 Ga0207661_10020103
431 Ga0207667_10034556
432 Ga0207668_10310786
433 Ga0207658_10431409
434 Ga0207703_10082344
435 Ga0207639_10002832
436 Ga0207678_10045961
437 Ga0207678_10092341
438 Ga0207708_10152573
439 Ga0207641_10678098
440 Ga0207648_10569770
441 Ga0207676_10390215
442 Ga0207674_10006543
443 Ga0207675_100068496
444 Ga0207683_10234103
445 Ga0268266_10001272
446 Ga0268266_10231716
447 Ga0268265_10033123
448 Ga0268265_10215712
449 Ga0268265_10267633
450 Ga0307513_10451229
451 Ga0307508_10114383
452 Ga0265314_10064670
453 Ga0307516_10098117
454 Ga0307413_10150957
455 Ga0307410_10110900
456 Ga0307410_10526421
457 Ga0307406_10079893
458 Ga0307407_10132066
459 Ga0307411_10283812
460 Ga0307510_10098110
461 Ga0373930_0036700
462 Ga0373931_0020786
463 Ga0373935_0098536
464 Ga0373927_0026518
465 Ga0373927_0108785
466 Ga0395898_0247179
467 Ga0395905_0048057
468 Ga0451791_0185792
469 Ga0451798_1126084
470 Ga0439432_071022
471 Ga0466963_0310626
472 Ga0466967_0164679
473 Ga0495603_0006514
474 Ga0495603_0013492
475 Ga0495603_0018099
476 Ga0495603_0201352
477 Ga0495638_0163427
478 Ga0495638_0210304
479 Ga0495651_0064203
480 Ga0495639_0090932
481 Ga0495584_0044466
482 Ga0495585_0082652
483 Ga0495594_0061134
484 Ga0495594_0067075
485 Ga0495607_0082689
486 Ga0495583_0060462
487 Ga0495610_0037366
488 Ga0495616_0062123
489 Ga0495620_0043361
490 Ga0495620_0051954
491 Ga0495628_0010553
492 Ga0495632_0098226
493 Ga0495648_0001270
494 Ga0495598_0102870
495 Ga0495621_0062267
496 Ga0495621_0075569
497 Ga0495597_0045917
498 Ga0495622_0039173
499 Ga0495622_0172247
500 Ga0495633_0117801
501 Ga0495633_0194000
502 Ga0495656_0061228
503 Ga0495668_0074378
504 Ga0495611_0033281
505 Ga0495659_0007554
506 Ga0495659_0121025
507 Ga0495588_0019398
508 Ga0495670_0075947
509 Ga0495649_0205914
510 Ga0495636_0098706
511 Ga0495672_0183332
512 Ga0495676_0091346
513 Ga0495676_0098722
514 Ga0495683_0119896
515 Ga0495686_0101092
516 Ga0495686_0169612
517 Ga0495686_0244683
518 Ga0495602_0164883
519 Ga0495615_0076927
520 Ga0496100_0008929
521 Ga0496102_0075092
522 Ga0496102_0127174
523 Ga0496103_0158852
524 Ga0496104_0041782
525 Ga0496106_0044448
526 Ga0496106_0107669
527 Ga0496106_0509063
528 Ga0496107_0199633
529 Ga0496107_0240528
530 Ga0496108_0272243
531 Ga0496108_0285487
532 Ga0496108_0357878
533 Ga0496108_0444364
534 Ga0496109_0332243
535 Ga0496110_0141650
536 Ga0496110_0162736
537 Ga0496111_0278465
538 Ga0496113_0252308
539 Ga0496115_0158804
540 Ga0496121_0009890
541 Ga0496124_0185286
542 Ga0496125_0070314
543 Ga0496126_0002321
544 Ga0496126_0016736
545 Ga0496126_0114937
546 Ga0496126_0124180
547 Ga0496126_0542590
548 Ga0501032_0140516
549 Ga0501043_0088535
550 Ga0501043_0127979
551 Ga0501047_0001951
552 Ga0501067_0077860
553 Ga0501068_0000053
554 Ga0501069_0015327
555 Ga0501072_0000008
556 Ga0501073_0336767
557 Ga0501074_0001488
558 Ga0501076_0109992
559 Ga0501077_0009299
560 Ga0501079_0002964
561 Ga0501080_0012846
562 Ga0501080_0023693
563 Ga0501044_0556599
564 nmdc:mga03683_97320_c1
565 nmdc:mga03n38_421_c1
566 nmdc:mga0yw44_113786_c1
567 nmdc:mga0yw44_19114_c2
568 nmdc:mga0yw44_29290_c1
569 nmdc:mga0k408_31961_c1
570 nmdc:mga0k408_73403_c1
571 nmdc:mga06z11_13642_c1
572 nmdc:mga04h51_35176_c1
573 nmdc:mga07m45_136402_c1
574 nmdc:mga05p37_290068_c1
575 nmdc:mga09592_201113_c1
576 nmdc:mga0sz30_90382_c1
577 Ga0495612_0092815
578 Ga0495619_0231245
579 Ga0500583_0111653
580 Ga0500566_0162390
581 Ga0500592_020656
582 Ga0500595_006438
583 Ga0500595_009237
584 Ga0500637_0059294
585 Ga0501084_0000005
586 Ga0501082_0065403
587 Ga0530510_0367406
588 2513674871
589 2513697134
590 2513856947
591 2524468249
592 2885391951
593 2903753327
594 2903774858
595 2922361847
596 2935636120
597 2941512751
598 2941520682
599 2941528696
600 8006968859
601 8006984538
602 8006997165
603 8056684824
604 8056690689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

179

282

0.93

PF13468

Glyoxalase_3

Glyoxalase-like domain

178

285

0.9

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

135

0.89

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

131

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

177

291

0.88

PF13468

Glyoxalase_3

Glyoxalase-like domain

19

173

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.8212 155 275
1jc4-assembly1.cif.gz_B crystal structure of se-met methylmalonyl-coa epimerase 0.8176 151 276
6qh4-assembly2.cif.gz_D-2 crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.8135 158 275
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.8112 151 279
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.8109 158 281
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8973 158 209 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8276 2 142 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8235 158 277 3.10.180.10
af_Q18347_1_154_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8188 153 275 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8069 158 275 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A537M8H0-F1-model_v4 VOC family protein 0.9949 1 192 GO:0004493
GO:0046491
GO:0046872
AF-A0A537M8H0-F1-model_v4 VOC family protein 0.9898 1 192 GO:0004493
GO:0046491
GO:0046872
AF-A0A533J9H0-F1-model_v4 deleted 0.9896 1 281
AF-A0A840MSC7-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9819 1 281 GO:0004493
GO:0016829
GO:0046491
GO:0046872
GO:0051213
AF-A0A840MSC7-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9784 1 281 GO:0004493
GO:0016829
GO:0046491
GO:0046872
GO:0051213

Map