F396186

General Info

Members Datasets Scaffolds Average Seq Length
301 198 602 255

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_356373_c1|nmdc:mga05p37_356373_c1_218_1165
Length 302
Sequence LGYARIEVHASNVRCARANPTYAAPTAPEHEERKPTIEQEIQVANLKGKIAWVTGAGSGIGEAAAIALAREGATVVLTGRRQAALEMVAERIEESGGKAIARPGDMAKAAAVQKLADAIRAEQGRLDILVNNAGSNIPKRTWQQLEAEGIDSVIQGNLTSAFYVARAALPIMRAQKDGLMIHTASWAGRHIGPVSGPAYTAAKHGMVAMSHTLNLEEGTNGIRSCVICPGEVATPILLDRPVPETPETMARMIQPQDMGALIAFIARQPAHVCINEVLITPTHNRGYIGAMKARAAQMAGER

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
118 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
193 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
198 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 0.33
Rhizoplane 6.98
Rhizosphere 78.41
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_356373_c1 3300050507 Bacteria 1721
2 JGI25406J46586_10057721 3300003203 Bacteria 1268
3 Ga0070658_10008801 3300005327 Bacteria 8113
4 Ga0070670_100251033 3300005331 Bacteria 1541
5 Ga0068869_100019492 3300005334 Bacteria 4636
6 Ga0068869_100266837 3300005334 Bacteria 1372
7 Ga0070680_100001952 3300005336 Bacteria 15173
8 Ga0068868_100023035 3300005338 Bacteria 4710
9 Ga0070660_100148681 3300005339 Bacteria 1883
10 Ga0070691_10042110 3300005341 Bacteria 2161
11 Ga0070675_100025342 3300005354 Bacteria 4755
12 Ga0070709_10031758 3300005434 Bacteria 3179
13 Ga0070714_100270257 3300005435 Bacteria 1576
14 Ga0070711_100483357 3300005439 Bacteria 1018
15 Ga0070694_100298775 3300005444 Bacteria 1233
16 Ga0070681_10026089 3300005458 Bacteria 5875
17 Ga0070706_100936114 3300005467 Bacteria 800
18 Ga0070679_100035910 3300005530 Bacteria 4918
19 Ga0070679_100052158 3300005530 Bacteria 4075
20 Ga0070697_100072121 3300005536 Bacteria 2834
21 Ga0068853_100003905 3300005539 Bacteria 11429
22 Ga0070672_100520235 3300005543 Bacteria 1031
23 Ga0070665_100083025 3300005548 Bacteria 3209
24 Ga0070704_100118312 3300005549 Bacteria 2030
25 Ga0068856_100291744 3300005614 Bacteria 1648
26 Ga0068859_100740602 3300005617 Bacteria 1072
27 Ga0068864_100560027 3300005618 Bacteria 1106
28 Ga0068861_100380437 3300005719 Bacteria 1247
29 Ga0068863_100017655 3300005841 Bacteria 6833
30 Ga0068863_100715574 3300005841 Bacteria 996
31 Ga0068858_100031619 3300005842 Bacteria 4917
32 Ga0068862_100073745 3300005844 Bacteria 2950
33 Ga0081455_10000170 3300005937 Bacteria 80847
34 Ga0081538_10097198 3300005981 Bacteria 1497
35 Ga0081539_10001213 3300005985 Bacteria 46215
36 Ga0081539_10064397 3300005985 Bacteria 1995
37 Ga0075365_10269515 3300006038 Bacteria 1197
38 Ga0070716_100062053 3300006173 Bacteria 2166
39 Ga0070716_100112975 3300006173 Bacteria 1687
40 Ga0075362_10012302 3300006177 Bacteria 3397
41 Ga0075362_10069642 3300006177 Bacteria 1604
42 Ga0075367_10129269 3300006178 Bacteria 1561
43 Ga0075369_10067684 3300006186 Bacteria 1568
44 Ga0075428_100100805 3300006844 Bacteria 3148
45 Ga0075428_100102719 3300006844 Bacteria 3117
46 Ga0075428_100140656 3300006844 Bacteria 2624
47 Ga0075428_100208604 3300006844 Bacteria 2111
48 Ga0075428_100220136 3300006844 Bacteria 2050
49 Ga0075428_100487513 3300006844 Bacteria 1319
50 Ga0075430_100035800 3300006846 Bacteria 4210
51 Ga0075430_100094083 3300006846 Bacteria 2505
52 Ga0075430_100131459 3300006846 Bacteria 2086
53 Ga0075431_100049916 3300006847 Bacteria 4314
54 Ga0075431_100054863 3300006847 Bacteria 4110
55 Ga0075431_100208451 3300006847 Bacteria 1997
56 Ga0075431_100316682 3300006847 Bacteria 1574
57 Ga0075433_10006505 3300006852 Bacteria 9240
58 Ga0075434_100000653 3300006871 Bacteria 26879
59 Ga0075429_100183535 3300006880 Bacteria 1833
60 Ga0075429_100308888 3300006880 Bacteria 1384
61 Ga0075429_100490013 3300006880 Bacteria 1077
62 Ga0075436_100149249 3300006914 Bacteria 1644
63 Ga0097620_100740644 3300006931 Bacteria 1072
64 Ga0099795_10065104 3300007788 Bacteria 1362
65 Ga0105240_10037862 3300009093 Bacteria 6194
66 Ga0111539_10076511 3300009094 Bacteria 3940
67 Ga0111539_10417795 3300009094 Bacteria 1562
68 Ga0111539_10490359 3300009094 Bacteria 1431
69 Ga0111539_10707887 3300009094 Bacteria 1172
70 Ga0105245_10015254 3300009098 Bacteria 6694
71 Ga0105245_10092895 3300009098 Bacteria 2779
72 Ga0105247_10055919 3300009101 Bacteria 2436
73 Ga0114129_10159134 3300009147 Bacteria 3087
74 Ga0114129_10221355 3300009147 Bacteria 2553
75 Ga0114129_10641610 3300009147 Bacteria 1371
76 Ga0105243_10341730 3300009148 Bacteria 1371
77 Ga0105237_10052902 3300009545 Bacteria 4074
78 Ga0099796_10078608 3300010159 Bacteria 1205
79 Ga0099796_10080135 3300010159 Bacteria 1196
80 Ga0105239_10048554 3300010375 Bacteria 4655
81 Ga0105239_10230742 3300010375 Bacteria 2076
82 Ga0105246_10100974 3300011119 Bacteria 2100
83 Ga0157370_10110733 3300013104 Bacteria 2567
84 Ga0157369_10237688 3300013105 Bacteria 1903
85 Ga0163162_10206152 3300013306 Bacteria 2095
86 Ga0157375_10038662 3300013308 Bacteria 4582
87 Ga0163163_10343563 3300014325 Bacteria 1548
88 Ga0157380_10125966 3300014326 Bacteria 2177
89 Ga0157379_10232893 3300014968 Bacteria 1670
90 Ga0157376_10077588 3300014969 Bacteria 2842
91 Ga0213872_10013425 3300021361 Bacteria 3838
92 Ga0213872_10040218 3300021361 Bacteria 2135
93 Ga0213872_10048784 3300021361 Bacteria 1924
94 Ga0213874_10003863 3300021377 Bacteria 3367
95 Ga0213874_10006271 3300021377 Bacteria 2811
96 Ga0213876_10000575 3300021384 Bacteria 27311
97 Ga0213876_10031148 3300021384 Bacteria 2815
98 Ga0213875_10001534 3300021388 Bacteria 14828
99 Ga0213875_10003117 3300021388 Bacteria 9544
100 Ga0213875_10006710 3300021388 Bacteria 6013
101 Ga0213871_10007985 3300021441 Bacteria 2313
102 Ga0207426_1017859 3300025302 Bacteria 2512
103 Ga0207642_10133306 3300025899 Bacteria 1300
104 Ga0207699_10041373 3300025906 Bacteria 2661
105 Ga0207643_10105385 3300025908 Bacteria 1657
106 Ga0207705_10021626 3300025909 Bacteria 4590
107 Ga0207684_10135354 3300025910 Bacteria 2116
108 Ga0207684_10358797 3300025910 Bacteria 1254
109 Ga0207707_10031136 3300025912 Bacteria 4667
110 Ga0207671_10135844 3300025914 Bacteria 1891
111 Ga0207663_10483571 3300025916 Bacteria 960
112 Ga0207660_10021050 3300025917 Bacteria 4382
113 Ga0207657_10029397 3300025919 Bacteria 5003
114 Ga0207652_10009701 3300025921 Bacteria 7744
115 Ga0207652_10040062 3300025921 Bacteria 3978
116 Ga0207650_10358040 3300025925 Bacteria 1202
117 Ga0207659_10013677 3300025926 Bacteria 5208
118 Ga0207659_10299197 3300025926 Bacteria 1321
119 Ga0207687_10055408 3300025927 Bacteria 2778
120 Ga0207687_10063456 3300025927 Bacteria 2615
121 Ga0207700_10321457 3300025928 Bacteria 1341
122 Ga0207664_10355411 3300025929 Bacteria 1297
123 Ga0207664_10389642 3300025929 Bacteria 1238
124 Ga0207690_10337247 3300025932 Bacteria 1189
125 Ga0207665_10155961 3300025939 Bacteria 1639
126 Ga0207665_10338932 3300025939 Bacteria 1132
127 Ga0207691_10342764 3300025940 Bacteria 1279
128 Ga0207711_10437347 3300025941 Bacteria 1217
129 Ga0207711_10437740 3300025941 Bacteria 1217
130 Ga0207689_10008628 3300025942 Bacteria 8876
131 Ga0207689_10256743 3300025942 Bacteria 1446
132 Ga0207689_10281868 3300025942 Bacteria 1376
133 Ga0207667_10053884 3300025949 Bacteria 4231
134 Ga0207712_10261287 3300025961 Unclassified 1404
135 Ga0207668_10151895 3300025972 Bacteria 1794
136 Ga0207677_10004021 3300026023 Bacteria 7846
137 Ga0207677_10207489 3300026023 Bacteria 1562
138 Ga0207639_10003694 3300026041 Bacteria 10289
139 Ga0207702_10081834 3300026078 Bacteria 2805
140 Ga0207702_10735087 3300026078 Bacteria 974
141 Ga0207674_10317584 3300026116 Bacteria 1507
142 Ga0207675_100100704 3300026118 Bacteria 2722
143 Ga0209179_1013778 3300027512 Bacteria 1474
144 Ga0207428_10181877 3300027907 Bacteria 1588
145 Ga0268266_10342403 3300028379 Bacteria 1404
146 Ga0268264_10165939 3300028381 Bacteria 1993
147 Ga0268264_10199096 3300028381 Bacteria 1831
148 Ga0265334_10042415 3300028573 Bacteria 1773
149 Ga0265338_10023232 3300028800 Bacteria 6382
150 Ga0307408_100029796 3300031548 Bacteria 3785
151 Ga0265342_10065375 3300031712 Bacteria 2132
152 Ga0307405_10340638 3300031731 Bacteria 1153
153 Ga0307406_10156569 3300031901 Bacteria 1632
154 Ga0307406_10201752 3300031901 Bacteria 1464
155 Ga0307406_10308899 3300031901 Bacteria 1218
156 Ga0307407_10270495 3300031903 Bacteria 1172
157 Ga0307409_100172890 3300031995 Bacteria 1903
158 Ga0307409_100237234 3300031995 Bacteria 1657
159 Ga0307409_100325225 3300031995 Bacteria 1441
160 Ga0307416_100014609 3300032002 Bacteria 5390
161 Ga0307414_10321682 3300032004 Bacteria 1317
162 Ga0307411_10135845 3300032005 Bacteria 1805
163 Ga0307411_10315495 3300032005 Bacteria 1260
164 Ga0307411_10356274 3300032005 Bacteria 1195
165 Ga0307415_100009905 3300032126 Bacteria 5372
166 Ga0307415_100065588 3300032126 Bacteria 2530
167 Ga0307415_100504445 3300032126 Bacteria 1058
168 Ga0373958_0010801 3300034819 Bacteria 1530
169 Ga0373959_0017859 3300034820 Bacteria 1329
170 Ga0373926_0024153 3300035083 Bacteria 2115
171 Ga0373940_0004725 3300035088 Bacteria 2900
172 Ga0373949_0004649 3300035090 Bacteria 3123
173 Ga0373949_0049303 3300035090 Bacteria 1057
174 Ga0373951_0054014 3300035091 Bacteria 993
175 Ga0373923_0090190 3300035111 Bacteria 1340
176 Ga0373932_0061951 3300035112 Bacteria 1139
177 Ga0373943_0141499 3300035170 Bacteria 1296
178 Ga0373942_0116361 3300035207 Bacteria 831
179 Ga0373924_0042950 3300035410 Bacteria 1856
180 Ga0373931_0003271 3300035691 Bacteria 7251
181 Ga0373931_0070788 3300035691 Bacteria 1904
182 Ga0373931_0332748 3300035691 Bacteria 946
183 Ga0373935_0082522 3300035692 Bacteria 2091
184 Ga0373927_0059347 3300035695 Bacteria 2474
185 Ga0373925_0124056 3300037068 Bacteria 2008
186 Ga0373925_0232531 3300037068 Bacteria 1474
187 Ga0436364_0488739 3300037853 Bacteria 3344
188 Ga0436364_0538371 3300037853 Bacteria 30118
189 Ga0436364_0597850 3300037853 Bacteria 5607
190 Ga0436364_0844179 3300037853 Bacteria 1569
191 Ga0436364_1331333 3300037853 Bacteria 94585
192 Ga0436364_1463938 3300037853 Bacteria 925
193 Ga0436365_0377967 3300039437 Bacteria 8961
194 Ga0436365_0956965 3300039437 Bacteria 31998
195 Ga0436365_1262642 3300039437 Bacteria 1704
196 Ga0436365_1894746 3300039437 Bacteria 9037
197 Ga0436360_0602827 3300039438 Bacteria 1546
198 Ga0436360_0731047 3300039438 Bacteria 1699
199 Ga0436360_0970003 3300039438 Bacteria 1423
200 Ga0436360_1269791 3300039438 Bacteria 1050
201 Ga0436360_1351612 3300039438 Bacteria 8970
202 Ga0436361_0024235 3300039447 Bacteria 2676
203 Ga0436361_0587805 3300039447 Bacteria 4049
204 Ga0436361_0626689 3300039447 Bacteria 3281
205 Ga0436361_1027325 3300039447 Bacteria 7094
206 Ga0436361_1106925 3300039447 Bacteria 4176
207 Ga0436361_1114665 3300039447 Bacteria 1179
208 Ga0436363_0174191 3300039450 Bacteria 14573
209 Ga0436363_0840771 3300039450 Bacteria 3633
210 Ga0436363_1132083 3300039450 Bacteria 1704
211 Ga0436363_1199239 3300039450 Bacteria 3536
212 Ga0436362_0366624 3300039453 Unclassified 1113
213 Ga0436362_0719187 3300039453 Bacteria 1475
214 Ga0436362_0783301 3300039453 Bacteria 1433
215 Ga0451576_0819110 3300045051 Bacteria 977
216 Ga0466967_0145110 3300045976 Bacteria 2214
217 Ga0466967_0534741 3300045976 Bacteria 1153
218 Ga0495582_0154636 3300046473 Bacteria 1303
219 Ga0495639_0101103 3300046475 Bacteria 1361
220 Ga0495581_0095140 3300047315 Bacteria 1729
221 Ga0495672_0007300 3300047320 Bacteria 8336
222 Ga0495676_0192248 3300047321 Bacteria 1423
223 Ga0495680_0125616 3300047322 Bacteria 1890
224 Ga0495684_0091197 3300047471 Bacteria 2308
225 Ga0495686_0117150 3300047472 Bacteria 1592
226 Ga0496100_0200518 3300048903 Bacteria 1454
227 Ga0496102_0166466 3300048905 Bacteria 2074
228 Ga0496103_0266621 3300048906 Bacteria 1102
229 Ga0496104_0002638 3300048907 Bacteria 15427
230 Ga0496104_0009362 3300048907 Bacteria 8708
231 Ga0496105_0000361 3300048908 Bacteria 30070
232 Ga0496106_0063474 3300048909 Bacteria 2807
233 Ga0496106_0281585 3300048909 Bacteria 1332
234 Ga0496107_0275365 3300048910 Bacteria 1252
235 Ga0496108_0008051 3300048911 Bacteria 8552
236 Ga0496108_0064259 3300048911 Bacteria 3092
237 Ga0496109_0017332 3300048912 Bacteria 6312
238 Ga0496109_0036082 3300048912 Bacteria 4462
239 Ga0496110_0003996 3300048913 Bacteria 11357
240 Ga0496110_0323802 3300048913 Bacteria 1404
241 Ga0496111_0021585 3300048914 Bacteria 4499
242 Ga0496112_0010142 3300048915 Bacteria 8535
243 Ga0496113_0015357 3300048916 Bacteria 5260
244 Ga0496113_0061705 3300048916 Bacteria 2829
245 Ga0496113_0245012 3300048916 Bacteria 1430
246 Ga0496115_0000664 3300048918 Bacteria 25483
247 Ga0496119_0016338 3300048922 Bacteria 5654
248 Ga0496120_0059415 3300048923 Bacteria 2143
249 Ga0496126_0018336 3300048929 Bacteria 6939
250 Ga0501032_0259615 3300049569 Bacteria 1127
251 Ga0501034_0038377 3300049571 Bacteria 4850
252 Ga0501037_0175940 3300049573 Bacteria 1520
253 Ga0501043_0075751 3300049579 Bacteria 2643
254 Ga0501043_0204834 3300049579 Bacteria 1530
255 Ga0501047_0111609 3300049581 Bacteria 2617
256 Ga0501047_0473501 3300049581 Bacteria 1080
257 Ga0501074_0045000 3300049590 Bacteria 3194
258 Ga0501075_0005939 3300049591 Bacteria 8355
259 Ga0501076_0015278 3300049592 Bacteria 5800
260 Ga0501077_0066657 3300049593 Bacteria 2284
261 Ga0501079_0068461 3300049741 Bacteria 2740
262 Ga0501080_0064744 3300049742 Bacteria 3400
263 Ga0501080_0576641 3300049742 Bacteria 1000
264 Ga0501083_0006973 3300049744 Bacteria 8016
265 Ga0501035_0066968 3300049822 Bacteria 3187
266 Ga0501044_0283787 3300049823 Bacteria 1588
267 nmdc:mga0yw44_263008_c1 3300050492 Bacteria 1150
268 nmdc:mga06z11_139540_c1 3300050494 Bacteria 1369
269 nmdc:mga06z11_274127_c1 3300050494 Bacteria 998
270 nmdc:mga07m45_370522_c1 3300050496 Bacteria 832
271 nmdc:mga05p37_194265_c1 3300050507 Bacteria 2462
272 nmdc:mga09592_111177_c1 3300050508 Bacteria 2351
273 nmdc:mga09592_185262_c1 3300050508 Bacteria 1801
274 nmdc:mga09592_61781_c1 3300050508 Bacteria 3169
275 nmdc:mga0qj67_13558_c1 3300050509 Bacteria 6149
276 nmdc:mga0qj67_24345_c1 3300050509 Bacteria 4666
277 nmdc:mga0qj67_308370_c1 3300050509 Bacteria 1282
278 nmdc:mga06r32_49318_c1 3300050510 Bacteria 4026
279 nmdc:mga06r32_563708_c1 3300050510 Bacteria 1112
280 nmdc:mga06r32_95763_c1 3300050510 Bacteria 2906
281 nmdc:mga08y16_145837_c1 3300050511 Bacteria 2461
282 nmdc:mga08y16_198854_c1 3300050511 Bacteria 2077
283 nmdc:mga08y16_316289_c1 3300050511 Bacteria 1608
284 nmdc:mga0n895_491113_c1 3300050512 Bacteria 1237
285 nmdc:mga0n895_8117_c1 3300050512 Bacteria 9068
286 nmdc:mga0a205_2998_c1 3300050515 Bacteria 14963
287 nmdc:mga0sz30_2226_c1 3300050516 Bacteria 6937
288 Ga0500641_0013300 3300053096 Bacteria 3021
289 Ga0500642_0241591 3300053130 Bacteria 832
290 Ga0500658_0127880 3300053134 Bacteria 1131
291 Ga0500568_0001571 3300053139 Bacteria 14447
292 Ga0500568_0020487 3300053139 Bacteria 2859
293 Ga0500609_014197 3300053731 Bacteria 1079
294 Ga0500552_000185 3300053733 Bacteria 5435
295 Ga0501084_0006560 3300054114 Bacteria 9561
296 Ga0501084_0193951 3300054114 Bacteria 1714
297 Ga0501084_0637910 3300054114 Bacteria 899
298 Ga0501082_0140650 3300060353 Bacteria 2095
299 Ga0530510_0106555 3300061734 Bacteria 2051
300 2842777581 2842775625 Bacteria 5587290
301 641645749 641522639 Bacteria 7737025
302 nmdc:mga05p37_356373_c1
303 JGI25406J46586_10057721
304 Ga0070658_10008801
305 Ga0070670_100251033
306 Ga0068869_100019492
307 Ga0068869_100266837
308 Ga0070680_100001952
309 Ga0068868_100023035
310 Ga0070660_100148681
311 Ga0070691_10042110
312 Ga0070675_100025342
313 Ga0070709_10031758
314 Ga0070714_100270257
315 Ga0070711_100483357
316 Ga0070694_100298775
317 Ga0070681_10026089
318 Ga0070706_100936114
319 Ga0070679_100035910
320 Ga0070679_100052158
321 Ga0070697_100072121
322 Ga0068853_100003905
323 Ga0070672_100520235
324 Ga0070665_100083025
325 Ga0070704_100118312
326 Ga0068856_100291744
327 Ga0068859_100740602
328 Ga0068864_100560027
329 Ga0068861_100380437
330 Ga0068863_100017655
331 Ga0068863_100715574
332 Ga0068858_100031619
333 Ga0068862_100073745
334 Ga0081455_10000170
335 Ga0081538_10097198
336 Ga0081539_10001213
337 Ga0081539_10064397
338 Ga0075365_10269515
339 Ga0070716_100062053
340 Ga0070716_100112975
341 Ga0075362_10012302
342 Ga0075362_10069642
343 Ga0075367_10129269
344 Ga0075369_10067684
345 Ga0075428_100100805
346 Ga0075428_100102719
347 Ga0075428_100140656
348 Ga0075428_100208604
349 Ga0075428_100220136
350 Ga0075428_100487513
351 Ga0075430_100035800
352 Ga0075430_100094083
353 Ga0075430_100131459
354 Ga0075431_100049916
355 Ga0075431_100054863
356 Ga0075431_100208451
357 Ga0075431_100316682
358 Ga0075433_10006505
359 Ga0075434_100000653
360 Ga0075429_100183535
361 Ga0075429_100308888
362 Ga0075429_100490013
363 Ga0075436_100149249
364 Ga0097620_100740644
365 Ga0099795_10065104
366 Ga0105240_10037862
367 Ga0111539_10076511
368 Ga0111539_10417795
369 Ga0111539_10490359
370 Ga0111539_10707887
371 Ga0105245_10015254
372 Ga0105245_10092895
373 Ga0105247_10055919
374 Ga0114129_10159134
375 Ga0114129_10221355
376 Ga0114129_10641610
377 Ga0105243_10341730
378 Ga0105237_10052902
379 Ga0099796_10078608
380 Ga0099796_10080135
381 Ga0105239_10048554
382 Ga0105239_10230742
383 Ga0105246_10100974
384 Ga0157370_10110733
385 Ga0157369_10237688
386 Ga0163162_10206152
387 Ga0157375_10038662
388 Ga0163163_10343563
389 Ga0157380_10125966
390 Ga0157379_10232893
391 Ga0157376_10077588
392 Ga0213872_10013425
393 Ga0213872_10040218
394 Ga0213872_10048784
395 Ga0213874_10003863
396 Ga0213874_10006271
397 Ga0213876_10000575
398 Ga0213876_10031148
399 Ga0213875_10001534
400 Ga0213875_10003117
401 Ga0213875_10006710
402 Ga0213871_10007985
403 Ga0207426_1017859
404 Ga0207642_10133306
405 Ga0207699_10041373
406 Ga0207643_10105385
407 Ga0207705_10021626
408 Ga0207684_10135354
409 Ga0207684_10358797
410 Ga0207707_10031136
411 Ga0207671_10135844
412 Ga0207663_10483571
413 Ga0207660_10021050
414 Ga0207657_10029397
415 Ga0207652_10009701
416 Ga0207652_10040062
417 Ga0207650_10358040
418 Ga0207659_10013677
419 Ga0207659_10299197
420 Ga0207687_10055408
421 Ga0207687_10063456
422 Ga0207700_10321457
423 Ga0207664_10355411
424 Ga0207664_10389642
425 Ga0207690_10337247
426 Ga0207665_10155961
427 Ga0207665_10338932
428 Ga0207691_10342764
429 Ga0207711_10437347
430 Ga0207711_10437740
431 Ga0207689_10008628
432 Ga0207689_10256743
433 Ga0207689_10281868
434 Ga0207667_10053884
435 Ga0207712_10261287
436 Ga0207668_10151895
437 Ga0207677_10004021
438 Ga0207677_10207489
439 Ga0207639_10003694
440 Ga0207702_10081834
441 Ga0207702_10735087
442 Ga0207674_10317584
443 Ga0207675_100100704
444 Ga0209179_1013778
445 Ga0207428_10181877
446 Ga0268266_10342403
447 Ga0268264_10165939
448 Ga0268264_10199096
449 Ga0265334_10042415
450 Ga0265338_10023232
451 Ga0307408_100029796
452 Ga0265342_10065375
453 Ga0307405_10340638
454 Ga0307406_10156569
455 Ga0307406_10201752
456 Ga0307406_10308899
457 Ga0307407_10270495
458 Ga0307409_100172890
459 Ga0307409_100237234
460 Ga0307409_100325225
461 Ga0307416_100014609
462 Ga0307414_10321682
463 Ga0307411_10135845
464 Ga0307411_10315495
465 Ga0307411_10356274
466 Ga0307415_100009905
467 Ga0307415_100065588
468 Ga0307415_100504445
469 Ga0373958_0010801
470 Ga0373959_0017859
471 Ga0373926_0024153
472 Ga0373940_0004725
473 Ga0373949_0004649
474 Ga0373949_0049303
475 Ga0373951_0054014
476 Ga0373923_0090190
477 Ga0373932_0061951
478 Ga0373943_0141499
479 Ga0373942_0116361
480 Ga0373924_0042950
481 Ga0373931_0003271
482 Ga0373931_0070788
483 Ga0373931_0332748
484 Ga0373935_0082522
485 Ga0373927_0059347
486 Ga0373925_0124056
487 Ga0373925_0232531
488 Ga0436364_0488739
489 Ga0436364_0538371
490 Ga0436364_0597850
491 Ga0436364_0844179
492 Ga0436364_1331333
493 Ga0436364_1463938
494 Ga0436365_0377967
495 Ga0436365_0956965
496 Ga0436365_1262642
497 Ga0436365_1894746
498 Ga0436360_0602827
499 Ga0436360_0731047
500 Ga0436360_0970003
501 Ga0436360_1269791
502 Ga0436360_1351612
503 Ga0436361_0024235
504 Ga0436361_0587805
505 Ga0436361_0626689
506 Ga0436361_1027325
507 Ga0436361_1106925
508 Ga0436361_1114665
509 Ga0436363_0174191
510 Ga0436363_0840771
511 Ga0436363_1132083
512 Ga0436363_1199239
513 Ga0436362_0366624
514 Ga0436362_0719187
515 Ga0436362_0783301
516 Ga0451576_0819110
517 Ga0466967_0145110
518 Ga0466967_0534741
519 Ga0495582_0154636
520 Ga0495639_0101103
521 Ga0495581_0095140
522 Ga0495672_0007300
523 Ga0495676_0192248
524 Ga0495680_0125616
525 Ga0495684_0091197
526 Ga0495686_0117150
527 Ga0496100_0200518
528 Ga0496102_0166466
529 Ga0496103_0266621
530 Ga0496104_0002638
531 Ga0496104_0009362
532 Ga0496105_0000361
533 Ga0496106_0063474
534 Ga0496106_0281585
535 Ga0496107_0275365
536 Ga0496108_0008051
537 Ga0496108_0064259
538 Ga0496109_0017332
539 Ga0496109_0036082
540 Ga0496110_0003996
541 Ga0496110_0323802
542 Ga0496111_0021585
543 Ga0496112_0010142
544 Ga0496113_0015357
545 Ga0496113_0061705
546 Ga0496113_0245012
547 Ga0496115_0000664
548 Ga0496119_0016338
549 Ga0496120_0059415
550 Ga0496126_0018336
551 Ga0501032_0259615
552 Ga0501034_0038377
553 Ga0501037_0175940
554 Ga0501043_0075751
555 Ga0501043_0204834
556 Ga0501047_0111609
557 Ga0501047_0473501
558 Ga0501074_0045000
559 Ga0501075_0005939
560 Ga0501076_0015278
561 Ga0501077_0066657
562 Ga0501079_0068461
563 Ga0501080_0064744
564 Ga0501080_0576641
565 Ga0501083_0006973
566 Ga0501035_0066968
567 Ga0501044_0283787
568 nmdc:mga0yw44_263008_c1
569 nmdc:mga06z11_139540_c1
570 nmdc:mga06z11_274127_c1
571 nmdc:mga07m45_370522_c1
572 nmdc:mga05p37_194265_c1
573 nmdc:mga09592_111177_c1
574 nmdc:mga09592_185262_c1
575 nmdc:mga09592_61781_c1
576 nmdc:mga0qj67_13558_c1
577 nmdc:mga0qj67_24345_c1
578 nmdc:mga0qj67_308370_c1
579 nmdc:mga06r32_49318_c1
580 nmdc:mga06r32_563708_c1
581 nmdc:mga06r32_95763_c1
582 nmdc:mga08y16_145837_c1
583 nmdc:mga08y16_198854_c1
584 nmdc:mga08y16_316289_c1
585 nmdc:mga0n895_491113_c1
586 nmdc:mga0n895_8117_c1
587 nmdc:mga0a205_2998_c1
588 nmdc:mga0sz30_2226_c1
589 Ga0500641_0013300
590 Ga0500642_0241591
591 Ga0500658_0127880
592 Ga0500568_0001571
593 Ga0500568_0020487
594 Ga0500609_014197
595 Ga0500552_000185
596 Ga0501084_0006560
597 Ga0501084_0193951
598 Ga0501084_0637910
599 Ga0501082_0140650
600 Ga0530510_0106555
601 2842777581
602 641645749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

49

242

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

280

0.91

PF08659

KR

KR domain

50

226

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9683 7 242
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9586 7 240
2ewm-assembly1.cif.gz_B-2 crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9561 3 199
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9553 7 242
3rkr-assembly2.cif.gz_B-3 crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with nadp 0.9528 3 240
ID Description Score Start End Superfamily
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 7 240 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9564 4 82 3.40.50.720
2ewmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9561 3 199 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9543 4 188 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9514 7 53 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E9Y2A6-F1-model_v4 Oxidoreductase 0.9818 1 242 GO:0016020
AF-F2A5T3-F1-model_v4 deleted 0.9815 1 241
AF-A0A2D7SL76-F1-model_v4 Oxidoreductase 0.9809 3 250
AF-A0A246S8K7-F1-model_v4 3-oxoacyl-ACP reductase 0.9802 1 241 GO:0016491
AF-A0A521L0D1-F1-model_v4 SDR family oxidoreductase 0.9793 1 216

Map