F396185

General Info

Members Datasets Scaffolds Average Seq Length
301 221 602 170

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_578840_c1|nmdc:mga03n38_578840_c1_93_599
Length 168
Sequence MSEERAVLAGGCFWGMQDLIRKQPGVLSTRVGYTGGRVANATYRNHDGHAEAIEIIFDPAKTSFRKQLEFFFQIHDPSMNRQGNDRGTSYRSAIFYTSDEQRRIAEDTIADVDASGLWPGKVVTEVAPAGDFWEAEPEHQDYLERIPNGYTCHFVRPDWKLPVRTKAA

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
53 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
100 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
106 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
107 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
202 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
203 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
204 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
211 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
212 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
213 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
214 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
215 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
216 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
217 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
218 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
219 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
220 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
221 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.02
Metatranscriptomes 1.99
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 0
Rhizoplane 5.32
Rhizosphere 68.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_578840_c1 3300050490 Bacteria 637
2 JGI25155J39150_1000006 3300002704 Bacteria 244109
3 JGI25156J39149_1000105 3300002705 Bacteria 61721
4 JGI25154J39366_1000055 3300002738 Bacteria 115597
5 JGI25154J39366_1000085 3300002738 Bacteria 87994
6 JGI25157J39369_1000785 3300002741 Bacteria 16255
7 Ga0065707_10158951 3300005295 Bacteria 1582
8 Ga0070658_10005168 3300005327 Bacteria 10623
9 Ga0070658_10005319 3300005327 Bacteria 10451
10 Ga0070658_10197655 3300005327 Bacteria 1696
11 Ga0070683_100079494 3300005329 Bacteria 3069
12 Ga0070680_100303253 3300005336 Bacteria 1355
13 Ga0068868_100306915 3300005338 Bacteria 1349
14 Ga0070660_100007583 3300005339 Bacteria 7562
15 Ga0070660_100011577 3300005339 Bacteria 6276
16 Ga0070674_100305573 3300005356 Bacteria 1270
17 Ga0070678_100005895 3300005456 Bacteria 7126
18 Ga0070678_100965304 3300005456 Bacteria 782
19 Ga0070681_10027178 3300005458 Bacteria 5754
20 Ga0070681_10411481 3300005458 Bacteria 1264
21 Ga0070679_100077878 3300005530 Bacteria 3304
22 Ga0070679_100283668 3300005530 Bacteria 1608
23 Ga0070696_100084723 3300005546 Bacteria 2249
24 Ga0070696_100846362 3300005546 Bacteria 756
25 Ga0070665_100027287 3300005548 Bacteria 5751
26 Ga0068855_100037158 3300005563 Bacteria 5793
27 Ga0068855_100233541 3300005563 Bacteria 2058
28 Ga0068855_100802788 3300005563 Bacteria 1000
29 Ga0068856_100106604 3300005614 Bacteria 2797
30 Ga0068858_100660679 3300005842 Bacteria 1016
31 Ga0081455_10072172 3300005937 Bacteria 2859
32 Ga0081540_1082808 3300005983 Bacteria 1438
33 Ga0070717_10205427 3300006028 Bacteria 1727
34 Ga0075365_10130642 3300006038 Bacteria 1738
35 Ga0075368_10000619 3300006042 Bacteria 10742
36 Ga0075363_100015893 3300006048 Bacteria 3708
37 Ga0075364_10075310 3300006051 Bacteria 2227
38 Ga0075366_10010424 3300006195 Bacteria 5219
39 Ga0075370_10018785 3300006353 Bacteria 3754
40 Ga0075430_100004203 3300006846 Bacteria 12147
41 Ga0075431_100010184 3300006847 Bacteria 9452
42 Ga0075429_100279325 3300006880 Bacteria 1462
43 Ga0105240_10377384 3300009093 Bacteria 1602
44 Ga0105247_10026692 3300009101 Bacteria 3489
45 Ga0105248_10035481 3300009177 Bacteria 5579
46 Ga0105248_10049962 3300009177 Bacteria 4689
47 Ga0105237_10070175 3300009545 Bacteria 3499
48 Ga0105238_10328489 3300009551 Bacteria 1516
49 Ga0105239_10022409 3300010375 Bacteria 6964
50 Ga0105246_10045681 3300011119 Bacteria 2984
51 Ga0157373_10624435 3300013100 Bacteria 786
52 Ga0157370_10202896 3300013104 Bacteria 1839
53 Ga0157374_10031762 3300013296 Bacteria 4803
54 Ga0157374_10095463 3300013296 Bacteria 2843
55 Ga0157374_11426419 3300013296 Bacteria 715
56 Ga0163162_10176824 3300013306 Bacteria 2260
57 Ga0163163_10290574 3300014325 Bacteria 1687
58 Ga0157379_10084819 3300014968 Bacteria 2838
59 Ga0157379_10497685 3300014968 Bacteria 1129
60 Ga0157376_10353938 3300014969 Bacteria 1406
61 Ga0206356_10602467 3300020070 Bacteria 801
62 Ga0206355_1244762 3300020076 Bacteria 560
63 Ga0206352_11126513 3300020078 Bacteria 935
64 Ga0206350_10708695 3300020080 Bacteria 1121
65 Ga0213876_10019727 3300021384 Bacteria 3561
66 Ga0209435_100011 3300025206 Bacteria 413027
67 Ga0209672_102792 3300025228 Bacteria 3997
68 Ga0209646_1000024 3300025246 Bacteria 413027
69 Ga0209026_1000009 3300025250 Bacteria 531812
70 Ga0209759_1000011 3300025256 Bacteria 413027
71 Ga0209256_1065671 3300025299 Bacteria 830
72 Ga0209257_1022991 3300025304 Bacteria 2206
73 Ga0207697_10023364 3300025315 Bacteria 2531
74 Ga0207710_10112701 3300025900 Bacteria 1292
75 Ga0207680_10203734 3300025903 Bacteria 1350
76 Ga0207705_10004499 3300025909 Bacteria 10538
77 Ga0207705_10076994 3300025909 Bacteria 2426
78 Ga0207707_10327678 3300025912 Bacteria 1321
79 Ga0207707_10460795 3300025912 Bacteria 1087
80 Ga0207695_10126195 3300025913 Bacteria 2520
81 Ga0207660_10345679 3300025917 Bacteria 1191
82 Ga0207657_10019116 3300025919 Bacteria 6516
83 Ga0207657_10040946 3300025919 Bacteria 4101
84 Ga0207657_10150861 3300025919 Bacteria 1893
85 Ga0207652_10026966 3300025921 Bacteria 4788
86 Ga0207694_10785443 3300025924 Bacteria 804
87 Ga0207650_10036517 3300025925 Bacteria 3576
88 Ga0207664_10032963 3300025929 Bacteria 3976
89 Ga0207690_10481494 3300025932 Bacteria 1002
90 Ga0207669_10129532 3300025937 Bacteria 1731
91 Ga0207665_10193081 3300025939 Bacteria 1480
92 Ga0207711_10653220 3300025941 Bacteria 981
93 Ga0207667_10193539 3300025949 Bacteria 2086
94 Ga0207667_10682719 3300025949 Bacteria 1030
95 Ga0207668_10083042 3300025972 Bacteria 2330
96 Ga0207640_10231043 3300025981 Bacteria 1423
97 Ga0207703_10539125 3300026035 Bacteria 1099
98 Ga0207639_11800492 3300026041 Bacteria 573
99 Ga0207702_10021618 3300026078 Bacteria 5328
100 Ga0207676_10197952 3300026095 Bacteria 1773
101 Ga0207674_10114045 3300026116 Bacteria 2675
102 Ga0207683_10090354 3300026121 Bacteria 2727
103 Ga0268266_10033589 3300028379 Bacteria 4361
104 Ga0307511_10046328 3300030521 Bacteria 3578
105 Ga0307513_10021954 3300031456 Bacteria 7521
106 Ga0307408_100744359 3300031548 Bacteria 885
107 Ga0307408_101274216 3300031548 Bacteria 688
108 Ga0307508_10000005 3300031616 Bacteria 286511
109 Ga0265342_10232154 3300031712 Bacteria 991
110 Ga0307410_10918841 3300031852 Bacteria 751
111 Ga0307406_10491322 3300031901 Bacteria 993
112 Ga0307406_11579106 3300031901 Bacteria 579
113 Ga0307416_100299854 3300032002 Bacteria 1597
114 Ga0307415_100693550 3300032126 Bacteria 918
115 Ga0307510_10000001 3300033180 Bacteria 1172244
116 Ga0436365_0130145 3300039437 Bacteria 7537
117 Ga0436365_0596332 3300039437 Bacteria 1848
118 Ga0436365_1934787 3300039437 Bacteria 4856
119 Ga0439439_0052709 3300041406 Bacteria 1069
120 Ga0439461_0175646 3300041410 Bacteria 565
121 Ga0439448_0093139 3300042005 Bacteria 1019
122 Ga0439448_0314492 3300042005 Bacteria 557
123 Ga0439450_000294 3300042008 Bacteria 6197
124 Ga0439455_0141548 3300042012 Bacteria 682
125 Ga0439463_072565 3300042016 Bacteria 882
126 Ga0450913_011762 3300042117 Bacteria 716
127 Ga0439446_0008135 3300042156 Bacteria 2776
128 Ga0439434_0050858 3300042435 Bacteria 1284
129 Ga0439464_0008078 3300042439 Bacteria 2759
130 Ga0439460_0015296 3300042461 Bacteria 2029
131 Ga0439440_0030001 3300042993 Bacteria 1279
132 Ga0466969_0020033 3300044656 Bacteria 3467
133 Ga0466972_0353932 3300044658 Bacteria 687
134 Ga0466965_0005027 3300044683 Bacteria 5925
135 Ga0466965_0728218 3300044683 Bacteria 570
136 Ga0466966_0106065 3300044684 Bacteria 1734
137 Ga0466961_0057118 3300044693 Bacteria 2485
138 Ga0466961_0210555 3300044693 Bacteria 1200
139 Ga0466963_0008317 3300044694 Bacteria 6215
140 Ga0466963_0252996 3300044694 Bacteria 1236
141 Ga0466968_0013138 3300044735 Bacteria 3251
142 Ga0466970_0002304 3300044765 Bacteria 9231
143 Ga0466957_0007825 3300044842 Bacteria 6056
144 Ga0466957_0207985 3300044842 Bacteria 1288
145 Ga0466960_0000953 3300044901 Bacteria 10266
146 Ga0466960_0005791 3300044901 Bacteria 4922
147 Ga0466959_0016419 3300045049 Bacteria 5409
148 Ga0466958_0128450 3300045836 Bacteria 1590
149 Ga0466967_0008758 3300045976 Bacteria 7454
150 Ga0466967_0039863 3300045976 Bacteria 4041
151 Ga0495590_0139780 3300046457 Bacteria 874
152 Ga0495629_0060852 3300046459 Bacteria 2638
153 Ga0495638_0001924 3300046460 Bacteria 17875
154 Ga0495582_0032966 3300046473 Bacteria 2846
155 Ga0495585_0025701 3300046492 Bacteria 3369
156 Ga0495594_0066162 3300046499 Bacteria 2005
157 Ga0495594_0066783 3300046499 Bacteria 1995
158 Ga0495583_0199270 3300046506 Bacteria 814
159 Ga0495606_0000936 3300046507 Bacteria 43004
160 Ga0495606_0041973 3300046507 Bacteria 3064
161 Ga0495616_0074401 3300046513 Bacteria 1637
162 Ga0495643_0002684 3300046522 Bacteria 13749
163 Ga0495648_0187831 3300046524 Bacteria 1045
164 Ga0495663_0119462 3300046525 Bacteria 881
165 Ga0495654_0215692 3300046530 Bacteria 814
166 Ga0495609_0131745 3300046538 Bacteria 1070
167 Ga0495597_0080602 3300046542 Bacteria 1392
168 Ga0495622_0021939 3300046557 Bacteria 2974
169 Ga0495656_0207991 3300046615 Bacteria 974
170 Ga0495668_0033766 3300046616 Bacteria 2873
171 Ga0495668_0138638 3300046616 Bacteria 1331
172 Ga0495611_0199076 3300046648 Bacteria 934
173 Ga0495625_0007652 3300046660 Bacteria 9365
174 Ga0495625_0059952 3300046660 Bacteria 2698
175 Ga0495659_0101060 3300046664 Bacteria 1117
176 Ga0495661_0002353 3300046665 Bacteria 14589
177 Ga0495588_0045020 3300046674 Bacteria 2261
178 Ga0495613_0126908 3300046689 Bacteria 1829
179 Ga0495671_0261410 3300046692 Bacteria 835
180 Ga0495604_0442668 3300047317 Bacteria 850
181 Ga0495683_0311620 3300047323 Bacteria 673
182 Ga0495686_0003568 3300047472 Bacteria 13364
183 Ga0495686_0113716 3300047472 Bacteria 1620
184 Ga0495686_0355012 3300047472 Bacteria 796
185 Ga0495626_0266617 3300048091 Bacteria 683
186 Ga0496100_0504202 3300048903 Bacteria 933
187 Ga0496102_0001217 3300048905 Bacteria 23346
188 Ga0496102_0006521 3300048905 Bacteria 9957
189 Ga0496102_0036189 3300048905 Bacteria 4446
190 Ga0496103_0089705 3300048906 Bacteria 1939
191 Ga0496103_0166444 3300048906 Bacteria 1414
192 Ga0496105_0055292 3300048908 Bacteria 3277
193 Ga0496108_0044334 3300048911 Bacteria 3713
194 Ga0496109_1201232 3300048912 Bacteria 695
195 Ga0496111_0093877 3300048914 Bacteria 2200
196 Ga0496112_0135668 3300048915 Bacteria 2431
197 Ga0496113_0267710 3300048916 Bacteria 1365
198 Ga0496114_0312994 3300048917 Bacteria 1387
199 Ga0496115_0000876 3300048918 Bacteria 21871
200 Ga0496115_0684231 3300048918 Bacteria 808
201 Ga0496116_0007867 3300048919 Bacteria 9355
202 Ga0496117_0000035 3300048920 Bacteria 326449
203 Ga0496117_0087134 3300048920 Bacteria 2025
204 Ga0496118_0000038 3300048921 Bacteria 315464
205 Ga0496118_0038366 3300048921 Bacteria 3841
206 Ga0496118_0376807 3300048921 Bacteria 746
207 Ga0496119_0037379 3300048922 Bacteria 3154
208 Ga0496119_0079421 3300048922 Bacteria 1895
209 Ga0496119_0162772 3300048922 Bacteria 1184
210 Ga0496121_0030233 3300048924 Bacteria 4978
211 Ga0496121_0033249 3300048924 Bacteria 4671
212 Ga0496121_0079684 3300048924 Bacteria 2599
213 Ga0496121_0218553 3300048924 Bacteria 1344
214 Ga0496124_0115418 3300048927 Bacteria 2155
215 Ga0496125_0002239 3300048928 Bacteria 25711
216 Ga0496125_0053013 3300048928 Bacteria 3330
217 Ga0496126_0000340 3300048929 Bacteria 98226
218 Ga0496126_0001758 3300048929 Bacteria 32053
219 Ga0496126_0041413 3300048929 Bacteria 4263
220 Ga0496126_0324825 3300048929 Bacteria 1264
221 Ga0496126_0990884 3300048929 Bacteria 631
222 Ga0501337_002578 3300049553 Bacteria 1117
223 Ga0501338_07878 3300049554 Bacteria 692
224 Ga0501031_0277097 3300049568 Bacteria 1088
225 Ga0501031_0705362 3300049568 Bacteria 648
226 Ga0501032_0028267 3300049569 Bacteria 3853
227 Ga0501032_0323674 3300049569 Bacteria 995
228 Ga0501033_0000874 3300049570 Bacteria 27543
229 Ga0501033_0006682 3300049570 Bacteria 9013
230 Ga0501033_0019224 3300049570 Bacteria 5164
231 Ga0501033_0057439 3300049570 Bacteria 2876
232 Ga0501033_0179879 3300049570 Bacteria 1516
233 Ga0501034_0009057 3300049571 Bacteria 10453
234 Ga0501034_0104695 3300049571 Bacteria 2823
235 Ga0501034_0107734 3300049571 Bacteria 2778
236 Ga0501034_0623139 3300049571 Bacteria 982
237 Ga0501034_1024536 3300049571 Bacteria 709
238 Ga0501036_0054624 3300049572 Bacteria 3384
239 Ga0501038_0010169 3300049574 Bacteria 8612
240 Ga0501039_0072642 3300049575 Bacteria 2673
241 Ga0501039_0091872 3300049575 Bacteria 2366
242 Ga0501043_0086757 3300049579 Bacteria 2459
243 Ga0501043_0370117 3300049579 Bacteria 1086
244 Ga0501043_0573080 3300049579 Bacteria 836
245 Ga0501046_0003936 3300049580 Bacteria 13578
246 Ga0501046_0291290 3300049580 Bacteria 1194
247 Ga0501047_0008748 3300049581 Bacteria 9554
248 Ga0501048_0007836 3300049582 Bacteria 8093
249 Ga0501070_0007498 3300049586 Bacteria 9269
250 Ga0501070_0132935 3300049586 Bacteria 2055
251 Ga0501070_0433179 3300049586 Bacteria 1061
252 Ga0501080_0564004 3300049742 Bacteria 1013
253 Ga0501262_004862 3300049759 Bacteria 1572
254 Ga0501035_0005725 3300049822 Bacteria 11720
255 Ga0501035_0029515 3300049822 Bacteria 5001
256 Ga0501035_0277926 3300049822 Bacteria 1416
257 Ga0501044_0007039 3300049823 Bacteria 12372
258 Ga0501044_0014065 3300049823 Bacteria 8642
259 Ga0501044_0034799 3300049823 Bacteria 5280
260 Ga0501044_0104554 3300049823 Bacteria 2845
261 Ga0501044_0520373 3300049823 Bacteria 1089
262 nmdc:mga03n38_1402_c1 3300050490 Bacteria 6863
263 nmdc:mga00v17_498378_c1 3300050491 Bacteria 789
264 nmdc:mga0yw44_258024_c1 3300050492 Bacteria 1161
265 nmdc:mga0yw44_299641_c1 3300050492 Bacteria 1077
266 nmdc:mga0yw44_37030_c1 3300050492 Bacteria 2879
267 nmdc:mga0k408_48887_c1 3300050493 Bacteria 2448
268 nmdc:mga06z11_2404_c1 3300050494 Bacteria 7131
269 nmdc:mga07m45_61110_c1 3300050496 Bacteria 2134
270 nmdc:mga09592_5653_c1 3300050508 Bacteria 10199
271 nmdc:mga0qj67_1312_c1 3300050509 Bacteria 17452
272 nmdc:mga06r32_5827_c1 3300050510 Bacteria 11096
273 nmdc:mga0sz30_48347_c1 3300050516 Bacteria 1799
274 Ga0500583_0034719 3300053092 Bacteria 2244
275 Ga0500583_0043041 3300053092 Bacteria 2060
276 Ga0500641_0088583 3300053096 Bacteria 1320
277 Ga0500650_0129474 3300053098 Bacteria 1174
278 Ga0500556_0026473 3300053104 Bacteria 1927
279 Ga0500572_000721 3300053111 Bacteria 10679
280 Ga0500572_290113 3300053111 Bacteria 528
281 Ga0500597_265268 3300053120 Bacteria 698
282 Ga0500642_0226883 3300053130 Bacteria 864
283 Ga0500655_018353 3300053133 Bacteria 1299
284 Ga0500658_0000587 3300053134 Bacteria 15296
285 Ga0500568_0226602 3300053139 Bacteria 682
286 Ga0500588_0001714 3300053146 Bacteria 4256
287 Ga0500590_067491 3300053148 Bacteria 1785
288 Ga0500616_0228645 3300053153 Bacteria 806
289 Ga0466962_0056356 3300061719 Bacteria 1877
290 2538834497 2537561836 Bacteria 3910579
291 2643830306 2643221562 Bacteria 4048635
292 2765466736 2765235802 Bacteria 5618596
293 2829751097 2829745981 Bacteria 5406054
294 2839997758 2839993093 Bacteria 5512535
295 2840881895 2840878972 Bacteria 5483153
296 2857515514 2857509624 Bacteria 7472071
297 2888381815 2888378607 Bacteria 9652610
298 2904581737 2904578770 Bacteria 5302906
299 2917737989 2917736166 Bacteria 9690793
300 2919123404 2919119836 Bacteria 5208557
301 2937844089 2937843397 Bacteria 5256375
302 nmdc:mga03n38_578840_c1
303 JGI25155J39150_1000006
304 JGI25156J39149_1000105
305 JGI25154J39366_1000055
306 JGI25154J39366_1000085
307 JGI25157J39369_1000785
308 Ga0065707_10158951
309 Ga0070658_10005168
310 Ga0070658_10005319
311 Ga0070658_10197655
312 Ga0070683_100079494
313 Ga0070680_100303253
314 Ga0068868_100306915
315 Ga0070660_100007583
316 Ga0070660_100011577
317 Ga0070674_100305573
318 Ga0070678_100005895
319 Ga0070678_100965304
320 Ga0070681_10027178
321 Ga0070681_10411481
322 Ga0070679_100077878
323 Ga0070679_100283668
324 Ga0070696_100084723
325 Ga0070696_100846362
326 Ga0070665_100027287
327 Ga0068855_100037158
328 Ga0068855_100233541
329 Ga0068855_100802788
330 Ga0068856_100106604
331 Ga0068858_100660679
332 Ga0081455_10072172
333 Ga0081540_1082808
334 Ga0070717_10205427
335 Ga0075365_10130642
336 Ga0075368_10000619
337 Ga0075363_100015893
338 Ga0075364_10075310
339 Ga0075366_10010424
340 Ga0075370_10018785
341 Ga0075430_100004203
342 Ga0075431_100010184
343 Ga0075429_100279325
344 Ga0105240_10377384
345 Ga0105247_10026692
346 Ga0105248_10035481
347 Ga0105248_10049962
348 Ga0105237_10070175
349 Ga0105238_10328489
350 Ga0105239_10022409
351 Ga0105246_10045681
352 Ga0157373_10624435
353 Ga0157370_10202896
354 Ga0157374_10031762
355 Ga0157374_10095463
356 Ga0157374_11426419
357 Ga0163162_10176824
358 Ga0163163_10290574
359 Ga0157379_10084819
360 Ga0157379_10497685
361 Ga0157376_10353938
362 Ga0206356_10602467
363 Ga0206355_1244762
364 Ga0206352_11126513
365 Ga0206350_10708695
366 Ga0213876_10019727
367 Ga0209435_100011
368 Ga0209672_102792
369 Ga0209646_1000024
370 Ga0209026_1000009
371 Ga0209759_1000011
372 Ga0209256_1065671
373 Ga0209257_1022991
374 Ga0207697_10023364
375 Ga0207710_10112701
376 Ga0207680_10203734
377 Ga0207705_10004499
378 Ga0207705_10076994
379 Ga0207707_10327678
380 Ga0207707_10460795
381 Ga0207695_10126195
382 Ga0207660_10345679
383 Ga0207657_10019116
384 Ga0207657_10040946
385 Ga0207657_10150861
386 Ga0207652_10026966
387 Ga0207694_10785443
388 Ga0207650_10036517
389 Ga0207664_10032963
390 Ga0207690_10481494
391 Ga0207669_10129532
392 Ga0207665_10193081
393 Ga0207711_10653220
394 Ga0207667_10193539
395 Ga0207667_10682719
396 Ga0207668_10083042
397 Ga0207640_10231043
398 Ga0207703_10539125
399 Ga0207639_11800492
400 Ga0207702_10021618
401 Ga0207676_10197952
402 Ga0207674_10114045
403 Ga0207683_10090354
404 Ga0268266_10033589
405 Ga0307511_10046328
406 Ga0307513_10021954
407 Ga0307408_100744359
408 Ga0307408_101274216
409 Ga0307508_10000005
410 Ga0265342_10232154
411 Ga0307410_10918841
412 Ga0307406_10491322
413 Ga0307406_11579106
414 Ga0307416_100299854
415 Ga0307415_100693550
416 Ga0307510_10000001
417 Ga0436365_0130145
418 Ga0436365_0596332
419 Ga0436365_1934787
420 Ga0439439_0052709
421 Ga0439461_0175646
422 Ga0439448_0093139
423 Ga0439448_0314492
424 Ga0439450_000294
425 Ga0439455_0141548
426 Ga0439463_072565
427 Ga0450913_011762
428 Ga0439446_0008135
429 Ga0439434_0050858
430 Ga0439464_0008078
431 Ga0439460_0015296
432 Ga0439440_0030001
433 Ga0466969_0020033
434 Ga0466972_0353932
435 Ga0466965_0005027
436 Ga0466965_0728218
437 Ga0466966_0106065
438 Ga0466961_0057118
439 Ga0466961_0210555
440 Ga0466963_0008317
441 Ga0466963_0252996
442 Ga0466968_0013138
443 Ga0466970_0002304
444 Ga0466957_0007825
445 Ga0466957_0207985
446 Ga0466960_0000953
447 Ga0466960_0005791
448 Ga0466959_0016419
449 Ga0466958_0128450
450 Ga0466967_0008758
451 Ga0466967_0039863
452 Ga0495590_0139780
453 Ga0495629_0060852
454 Ga0495638_0001924
455 Ga0495582_0032966
456 Ga0495585_0025701
457 Ga0495594_0066162
458 Ga0495594_0066783
459 Ga0495583_0199270
460 Ga0495606_0000936
461 Ga0495606_0041973
462 Ga0495616_0074401
463 Ga0495643_0002684
464 Ga0495648_0187831
465 Ga0495663_0119462
466 Ga0495654_0215692
467 Ga0495609_0131745
468 Ga0495597_0080602
469 Ga0495622_0021939
470 Ga0495656_0207991
471 Ga0495668_0033766
472 Ga0495668_0138638
473 Ga0495611_0199076
474 Ga0495625_0007652
475 Ga0495625_0059952
476 Ga0495659_0101060
477 Ga0495661_0002353
478 Ga0495588_0045020
479 Ga0495613_0126908
480 Ga0495671_0261410
481 Ga0495604_0442668
482 Ga0495683_0311620
483 Ga0495686_0003568
484 Ga0495686_0113716
485 Ga0495686_0355012
486 Ga0495626_0266617
487 Ga0496100_0504202
488 Ga0496102_0001217
489 Ga0496102_0006521
490 Ga0496102_0036189
491 Ga0496103_0089705
492 Ga0496103_0166444
493 Ga0496105_0055292
494 Ga0496108_0044334
495 Ga0496109_1201232
496 Ga0496111_0093877
497 Ga0496112_0135668
498 Ga0496113_0267710
499 Ga0496114_0312994
500 Ga0496115_0000876
501 Ga0496115_0684231
502 Ga0496116_0007867
503 Ga0496117_0000035
504 Ga0496117_0087134
505 Ga0496118_0000038
506 Ga0496118_0038366
507 Ga0496118_0376807
508 Ga0496119_0037379
509 Ga0496119_0079421
510 Ga0496119_0162772
511 Ga0496121_0030233
512 Ga0496121_0033249
513 Ga0496121_0079684
514 Ga0496121_0218553
515 Ga0496124_0115418
516 Ga0496125_0002239
517 Ga0496125_0053013
518 Ga0496126_0000340
519 Ga0496126_0001758
520 Ga0496126_0041413
521 Ga0496126_0324825
522 Ga0496126_0990884
523 Ga0501337_002578
524 Ga0501338_07878
525 Ga0501031_0277097
526 Ga0501031_0705362
527 Ga0501032_0028267
528 Ga0501032_0323674
529 Ga0501033_0000874
530 Ga0501033_0006682
531 Ga0501033_0019224
532 Ga0501033_0057439
533 Ga0501033_0179879
534 Ga0501034_0009057
535 Ga0501034_0104695
536 Ga0501034_0107734
537 Ga0501034_0623139
538 Ga0501034_1024536
539 Ga0501036_0054624
540 Ga0501038_0010169
541 Ga0501039_0072642
542 Ga0501039_0091872
543 Ga0501043_0086757
544 Ga0501043_0370117
545 Ga0501043_0573080
546 Ga0501046_0003936
547 Ga0501046_0291290
548 Ga0501047_0008748
549 Ga0501048_0007836
550 Ga0501070_0007498
551 Ga0501070_0132935
552 Ga0501070_0433179
553 Ga0501080_0564004
554 Ga0501262_004862
555 Ga0501035_0005725
556 Ga0501035_0029515
557 Ga0501035_0277926
558 Ga0501044_0007039
559 Ga0501044_0014065
560 Ga0501044_0034799
561 Ga0501044_0104554
562 Ga0501044_0520373
563 nmdc:mga03n38_1402_c1
564 nmdc:mga00v17_498378_c1
565 nmdc:mga0yw44_258024_c1
566 nmdc:mga0yw44_299641_c1
567 nmdc:mga0yw44_37030_c1
568 nmdc:mga0k408_48887_c1
569 nmdc:mga06z11_2404_c1
570 nmdc:mga07m45_61110_c1
571 nmdc:mga09592_5653_c1
572 nmdc:mga0qj67_1312_c1
573 nmdc:mga06r32_5827_c1
574 nmdc:mga0sz30_48347_c1
575 Ga0500583_0034719
576 Ga0500583_0043041
577 Ga0500641_0088583
578 Ga0500650_0129474
579 Ga0500556_0026473
580 Ga0500572_000721
581 Ga0500572_290113
582 Ga0500597_265268
583 Ga0500642_0226883
584 Ga0500655_018353
585 Ga0500658_0000587
586 Ga0500568_0226602
587 Ga0500588_0001714
588 Ga0500590_067491
589 Ga0500616_0228645
590 Ga0466962_0056356
591 2538834497
592 2643830306
593 2765466736
594 2829751097
595 2839997758
596 2840881895
597 2857515514
598 2888381815
599 2904581737
600 2917737989
601 2919123404
602 2937844089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

5

153

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lwl-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55a from clostridium oremlandii 0.9355 2 149
4lwm-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide 0.9347 2 149
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9343 2 164
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9303 4 165
4lwk-assembly2.cif.gz_B crystal structure of methionine sulfoxide reductase u16s from clostridium oremlandii 0.9148 2 149
ID Description Score Start End Superfamily
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9335 1 164 3.30.1060.10
af_O02089_1_199_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9243 2 148 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9174 1 164 3.30.1060.10
4lwkB00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9148 2 149 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9128 1 149 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A4Q3HS60-F1-model_v4 deleted 0.9413 1 155
AF-A0A143QAK3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.939 2 164 GO:0008113
GO:0033744
GO:0036211
AF-A0A2G2R3Z6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9385 2 162 GO:0008113
GO:0033744
GO:0036211
AF-A0A2A4U721-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9384 2 162 GO:0008113
GO:0033744
GO:0036211
AF-A0A6N4EKN0-F1-model_v4 deleted 0.9381 1 162

Map