F396080

General Info

Members Datasets Scaffolds Average Seq Length
301 216 257 308

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0014159|Ga0495650_0014159_2047_3147
Length 366
Sequence MITPPLTTITHGSRHHGGDAAGEWAGRSTDMRHSGEDGRPIEGHAGSCFNRSIRRFACAQGMSLPLLKLASLDLVRGFVAVGRRMSITHAAEDLCLTQSAISRQIGALETRLGVRLFTRGYRAISFTPQGERLFRSADAAVQQLQDAMGELSAGGASAPVVLSASIGVTGLWLLPRLSRFQAAHPGIDLRVSASDRIVDLRHDDIDLAIRYAHDTAPSADAVRLFGETVVAVAHPSFGADALRTRQALARLTLLDMDPPRGHLRPAWLQWSTWLARRGWPAAKPRGMLRFNQYDQIIHAALAGQGVALGRLPLLQPLIDDGRLLVVDAARAETEYAYWLLRADAAPRTAVRHVAEWIAAEAAVARG

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221569 Achromobacter sp. Root565 Isolate Unclassified
13 2643221585 Pelomonas sp. Root662 Isolate Unclassified
14 2643221594 Achromobacter sp. Root170 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
21 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
22 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
23 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
24 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
27 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
28 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
29 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
30 2858950400 Achromobacter sp. K91 Isolate Unclassified
31 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
32 2884411467 Dyella sp. AD56 Isolate Rhizosphere
33 2899924645 Variovorax sp. 369 Isolate Unclassified
34 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
35 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
36 2928037797 Variovorax sp. 1126 Isolate Unclassified
37 2928044640 Variovorax sp. 1128 Isolate Unclassified
38 2928051484 Variovorax sp. 1133 Isolate Unclassified
39 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
40 2928070936 Variovorax gossypii 1167 Isolate Unclassified
41 2928536128 Burkholderia sola 565 Isolate Unclassified
42 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
43 2941479691
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
52 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
53 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
54 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
55 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
59 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
60 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
61 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
70 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
73 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
77 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
78 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
85 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
156 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
203 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
216 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.72
Metatranscriptomes 0.33
Isolates 14.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.91
Nodule 0
Rhizoplane 2.33
Rhizosphere 46.18
Stem 0
Stem Tuber 0
Unclassified 25.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003373 3300002773 Bacteria 5480
2 JGI25159J45721_1004945 3300002987 Bacteria 4273
3 JGI25159J45721_1005774 3300002987 Bacteria 3826
4 JGI25151J46595_10010026 3300003187 Bacteria 4438
5 JGI25153J46596_10009686 3300003215 Bacteria 4438
6 rootH1_10018376 3300003316 Bacteria 9650
7 rootH1_10021311 3300003316 Bacteria 3381
8 rootH1_10025008 3300003316 Bacteria 3791
9 rootH2_10019508 3300003320 Bacteria 4926
10 rootH2_10054551 3300003320 Bacteria 3499
11 rootL2_10008403 3300003322 Bacteria 3675
12 rootL2_10203225 3300003322 Bacteria 2406
13 rootH1_10022292 3300003316 Bacteria 17443
14 rootH1_10022292 3300003323 Bacteria 4741
15 JGI25160J50197_1007066 3300003354 Bacteria 4438
16 Ga0055538_1000019 3300003751 Bacteria 282365
17 Ga0055539_1000024 3300003752 Bacteria 282365
18 Ga0055539_1000459 3300003752 Bacteria 13689
19 Ga0055533_1000032 3300003756 Bacteria 282365
20 Ga0055533_1000080 3300003756 Bacteria 131291
21 Ga0055532_1002003 3300003758 Bacteria 4715
22 Ga0055525_1000041 3300003759 Bacteria 282365
23 Ga0055525_1001686 3300003759 Bacteria 3330
24 Ga0055527_1002803 3300003760 Bacteria 2792
25 Ga0055535_1000198 3300003761 Bacteria 63889
26 Ga0055535_1000239 3300003761 Bacteria 58147
27 Ga0055535_1000821 3300003761 Bacteria 22303
28 Ga0055542_1000004 3300003762 Bacteria 553532
29 Ga0055542_1000867 3300003762 Bacteria 21193
30 Ga0055529_1000449 3300003763 Bacteria 40616
31 Ga0055529_1000555 3300003763 Bacteria 31338
32 Ga0055526_1010091 3300003771 Bacteria 4438
33 Ga0055537_1003901 3300003773 Bacteria 4438
34 Ga0055524_1007990 3300003775 Bacteria 4438
35 Ga0055534_1003986 3300003784 Bacteria 4438
36 Ga0055528_1008377 3300003790 Bacteria 4438
37 Ga0055530_10035298 3300003791 Bacteria 1269
38 Ga0055531_10009025 3300003794 Bacteria 5154
39 Ga0055541_1000018 3300003841 Bacteria 282365
40 Ga0055543_1003610 3300004625 Bacteria 4476
41 Ga0065165_1009181 3300005262 Bacteria 4476
42 Ga0070658_10079164 3300005327 Bacteria 2698
43 Ga0070658_10140036 3300005327 Bacteria 2021
44 Ga0070658_10253530 3300005327 Bacteria 1493
45 Ga0070676_10016160 3300005328 Bacteria 4124
46 Ga0070666_10009810 3300005335 Bacteria 5982
47 Ga0068868_100047478 3300005338 Bacteria 3365
48 Ga0070674_100163299 3300005356 Bacteria 1692
49 Ga0070673_100006362 3300005364 Bacteria 7673
50 Ga0070659_100111923 3300005366 Bacteria 2204
51 Ga0070667_100019846 3300005367 Bacteria 5577
52 Ga0070709_10071142 3300005434 Unclassified 2245
53 Ga0070714_100200590 3300005435 Bacteria 1825
54 Ga0070713_100003884 3300005436 Bacteria 9905
55 Ga0070678_100000638 3300005456 Bacteria 17152
56 Ga0070706_100024688 3300005467 Bacteria 5534
57 Ga0070684_100004028 3300005535 Bacteria 11119
58 Ga0070672_100012840 3300005543 Bacteria 5901
59 Ga0070665_100036427 3300005548 Bacteria 4948
60 Ga0068855_100009834 3300005563 Bacteria 11535
61 Ga0068855_100015367 3300005563 Bacteria 9216
62 Ga0070664_100009327 3300005564 Bacteria 7960
63 Ga0070664_100040722 3300005564 Bacteria 3918
64 Ga0068851_10015314 3300005834 Bacteria 3652
65 Ga0070717_10018008 3300006028 Bacteria 5510
66 Ga0070716_100045529 3300006173 Bacteria 2464
67 Ga0075366_10026176 3300006195 Bacteria 3416
68 Ga0105240_10009697 3300009093 Bacteria 13600
69 Ga0105240_10297277 3300009093 Bacteria 1848
70 Ga0105237_10043173 3300009545 Bacteria 4543
71 Ga0105238_10269775 3300009551 Bacteria 1682
72 Ga0105239_10036976 3300010375 Bacteria 5356
73 Ga0157371_10167097 3300013102 Bacteria 1571
74 Ga0157370_10102357 3300013104 Bacteria 2682
75 Ga0157369_10001025 3300013105 Bacteria 35250
76 Ga0157369_10032621 3300013105 Bacteria 5726
77 Ga0157374_10163498 3300013296 Bacteria 2169
78 Ga0163162_10220012 3300013306 Bacteria 2029
79 Ga0157372_10099809 3300013307 Bacteria 3312
80 Ga0157372_10307783 3300013307 Bacteria 1844
81 Ga0157376_10023080 3300014969 Bacteria 4863
82 Ga0182005_1018916 3300015265 Bacteria 1902
83 Ga0213872_10002393 3300021361 Bacteria 11079
84 Ga0213872_10025442 3300021361 Bacteria 2721
85 Ga0224712_10018010 3300022467 Unclassified 2353
86 Ga0209784_100009 3300025224 Bacteria 688031
87 Ga0209566_100007 3300025225 Bacteria 688031
88 Ga0209674_100003 3300025226 Bacteria 2196646
89 Ga0209674_100018 3300025226 Bacteria 688031
90 Ga0209672_100014 3300025228 Bacteria 546252
91 Ga0209672_104498 3300025228 Bacteria 2578
92 Ga0209147_100257 3300025229 Bacteria 49599
93 Ga0209147_101715 3300025229 Bacteria 7107
94 Ga0209563_100020 3300025230 Bacteria 688031
95 Ga0209563_100049 3300025230 Bacteria 358472
96 Ga0209258_100022 3300025242 Bacteria 553584
97 Ga0209258_100183 3300025242 Bacteria 136466
98 Ga0209258_100189 3300025242 Bacteria 128268
99 Ga0207425_1000164 3300025245 Bacteria 55767
100 Ga0209677_100010 3300025253 Bacteria 688031
101 Ga0209677_100228 3300025253 Bacteria 39841
102 Ga0209148_1000034 3300025254 Bacteria 553584
103 Ga0209148_1000035 3300025254 Bacteria 548413
104 Ga0209148_1010429 3300025254 Bacteria 1764
105 Ga0209759_1001304 3300025256 Bacteria 14727
106 Ga0209759_1001336 3300025256 Bacteria 14450
107 Ga0209129_1000264 3300025258 Bacteria 52582
108 Ga0209565_1000110 3300025263 Bacteria 119879
109 Ga0209455_1000092 3300025272 Bacteria 220516
110 Ga0209455_1000232 3300025272 Bacteria 70532
111 Ga0209673_1000426 3300025273 Bacteria 73424
112 Ga0209673_1000917 3300025273 Bacteria 37453
113 Ga0209130_1000205 3300025284 Bacteria 79260
114 Ga0209675_1000192 3300025291 Bacteria 66905
115 Ga0209676_1004185 3300025292 Bacteria 8191
116 Ga0209676_1010250 3300025292 Bacteria 3935
117 Ga0209025_1000096 3300025294 Bacteria 239153
118 Ga0209025_1000116 3300025294 Bacteria 218293
119 Ga0209564_1000649 3300025295 Bacteria 52528
120 Ga0209758_1000107 3300025297 Bacteria 218293
121 Ga0209050_1003711 3300025298 Bacteria 10989
122 Ga0209256_1000087 3300025299 Bacteria 218290
123 Ga0207426_1000123 3300025302 Bacteria 218290
124 Ga0209051_1002429 3300025303 Bacteria 13385
125 Ga0209051_1033158 3300025303 Bacteria 1957
126 Ga0209051_1060144 3300025303 Bacteria 1200
127 Ga0209257_1009301 3300025304 Bacteria 5307
128 Ga0207656_10003464 3300025321 Bacteria 5427
129 Ga0207645_10023206 3300025907 Bacteria 4032
130 Ga0207705_10069199 3300025909 Bacteria 2556
131 Ga0207705_10129995 3300025909 Bacteria 1873
132 Ga0207705_10239613 3300025909 Bacteria 1381
133 Ga0207695_10063790 3300025913 Bacteria 3796
134 Ga0207671_10050056 3300025914 Bacteria 3093
135 Ga0207664_10190230 3300025929 Bacteria 1766
136 Ga0207665_10095729 3300025939 Bacteria 2064
137 Ga0207691_10016237 3300025940 Bacteria 7069
138 Ga0207679_10034482 3300025945 Bacteria 3571
139 Ga0207667_10003340 3300025949 Bacteria 19799
140 Ga0207667_10073761 3300025949 Bacteria 3546
141 Ga0207651_10009225 3300025960 Bacteria 5384
142 Ga0207668_10270620 3300025972 Bacteria 1389
143 Ga0207677_10233815 3300026023 Bacteria 1482
144 Ga0207677_10344247 3300026023 Bacteria 1247
145 Ga0207639_10056316 3300026041 Bacteria 3013
146 Ga0207648_10052897 3300026089 Bacteria 3550
147 Ga0207683_10010862 3300026121 Bacteria 7765
148 Ga0209371_1017498 3300027312 Bacteria 1855
149 Ga0268266_10182089 3300028379 Bacteria 1913
150 Ga0265336_10000032 3300028666 Bacteria 167925
151 Ga0307515_10011478 3300028794 Bacteria 16813
152 Ga0265324_10002836 3300029957 Bacteria 8534
153 Ga0268256_1019504 3300030500 Bacteria 1855
154 Ga0307509_10107703 3300031507 Bacteria 2802
155 Ga0307508_10000212 3300031616 Bacteria 70345
156 Ga0307514_10014898 3300031649 Bacteria 6422
157 Ga0265314_10013737 3300031711 Bacteria 6526
158 Ga0265342_10010827 3300031712 Bacteria 6279
159 Ga0307516_10001445 3300031730 Bacteria 32809
160 Ga0307412_10000663 3300031911 Bacteria 19973
161 Ga0373934_0005907 3300035086 Bacteria 4530
162 Ga0395899_0048903 3300037312 Bacteria 3145
163 Ga0395900_0000077 3300037418 Bacteria 179525
164 Ga0395900_0002772 3300037418 Bacteria 19155
165 Ga0395898_0000359 3300037466 Bacteria 100304
166 Ga0395898_0003463 3300037466 Bacteria 17637
167 Ga0395898_0024803 3300037466 Bacteria 6046
168 Ga0395898_0468439 3300037466 Bacteria 1199
169 Ga0395905_0000090 3300037471 Bacteria 152117
170 Ga0395905_0010041 3300037471 Bacteria 9228
171 Ga0395905_0022533 3300037471 Bacteria 5957
172 Ga0395905_0032187 3300037471 Bacteria 4933
173 Ga0395905_0074827 3300037471 Bacteria 3174
174 Ga0436364_0951777 3300037853 Bacteria 3050
175 Ga0395901_0000085 3300038443 Bacteria 126093
176 Ga0395901_0002059 3300038443 Bacteria 20616
177 Ga0395901_0010698 3300038443 Bacteria 9302
178 Ga0395901_0069975 3300038443 Bacteria 3655
179 Ga0395901_0560535 3300038443 Bacteria 1157
180 Ga0436365_0603157 3300039437 Bacteria 1882
181 Ga0436365_1634642 3300039437 Bacteria 1835
182 Ga0436360_1178603 3300039438 Bacteria 995
183 Ga0436360_1183604 3300039438 Bacteria 1721
184 Ga0436361_0005112 3300039447 Bacteria 8729
185 Ga0436361_0544047 3300039447 Bacteria 22237
186 Ga0436362_0601157 3300039453 Bacteria 1185
187 Ga0451577_0082021 3300042876 Bacteria 2876
188 Ga0466969_0061941 3300044656 Bacteria 1816
189 Ga0466965_0002296 3300044683 Bacteria 8066
190 Ga0466966_0001919 3300044684 Bacteria 13477
191 Ga0466966_0034955 3300044684 Bacteria 3248
192 Ga0466966_0110259 3300044684 Bacteria 1697
193 Ga0466961_0035158 3300044693 Bacteria 3217
194 Ga0466963_0020566 3300044694 Bacteria 4150
195 Ga0466964_0002021 3300044706 Bacteria 7134
196 Ga0466971_0001064 3300044719 Bacteria 11391
197 Ga0466971_0028644 3300044719 Bacteria 2492
198 Ga0466970_0076244 3300044765 Bacteria 1806
199 Ga0466957_0006574 3300044842 Bacteria 6571
200 Ga0466957_0012061 3300044842 Bacteria 4996
201 Ga0466959_0023957 3300045049 Bacteria 4519
202 Ga0466959_0071011 3300045049 Unclassified 2522
203 Ga0451576_0208866 3300045051 Bacteria 2039
204 Ga0466967_0010201 3300045976 Bacteria 7029
205 Ga0466967_0412193 3300045976 Bacteria 1316
206 Ga0466967_0565104 3300045976 Bacteria 1120
207 Ga0495627_007522 3300046453 Bacteria 4164
208 Ga0495592_0050731 3300046454 Bacteria 3083
209 Ga0495650_0014159 3300046471 Bacteria 4169
210 Ga0495585_0007482 3300046492 Bacteria 6681
211 Ga0495628_0006814 3300046516 Bacteria 9932
212 Ga0495628_0150712 3300046516 Bacteria 1772
213 Ga0495652_0070612 3300046529 Bacteria 2918
214 Ga0495645_0027235 3300046543 Bacteria 4151
215 Ga0495675_0128418 3300047444 Bacteria 1576
216 Ga0495686_0000048 3300047472 Bacteria 278044
217 Ga0495686_0039214 3300047472 Bacteria 3026
218 Ga0496100_0295747 3300048903 Bacteria 1211
219 Ga0496105_0084060 3300048908 Bacteria 2629
220 Ga0496115_0374187 3300048918 Bacteria 1159
221 Ga0496116_0004134 3300048919 Bacteria 13981
222 Ga0496116_0038236 3300048919 Bacteria 3335
223 Ga0496116_0158508 3300048919 Bacteria 1245
224 Ga0496117_0006874 3300048920 Bacteria 11301
225 Ga0496118_0007141 3300048921 Bacteria 11966
226 Ga0496118_0052210 3300048921 Bacteria 3121
227 Ga0496119_0006716 3300048922 Bacteria 10572
228 Ga0496119_0099241 3300048922 Bacteria 1638
229 Ga0496120_0000350 3300048923 Bacteria 75997
230 Ga0496120_0004341 3300048923 Bacteria 11979
231 Ga0496121_0001614 3300048924 Bacteria 37428
232 Ga0496121_0002843 3300048924 Bacteria 25547
233 Ga0496121_0038822 3300048924 Bacteria 4208
234 Ga0496122_0000410 3300048925 Bacteria 91128
235 Ga0496122_0044220 3300048925 Bacteria 3479
236 Ga0496122_0065301 3300048925 Bacteria 2640
237 Ga0496123_0000818 3300048926 Bacteria 50079
238 Ga0496123_0014527 3300048926 Bacteria 6520
239 Ga0496123_0075542 3300048926 Bacteria 2079
240 Ga0496124_0043899 3300048927 Bacteria 3839
241 Ga0496124_0044875 3300048927 Bacteria 3791
242 Ga0496124_0119184 3300048927 Bacteria 2111
243 Ga0496125_0000166 3300048928 Bacteria 147432
244 Ga0496125_0004561 3300048928 Bacteria 15887
245 Ga0496125_0007014 3300048928 Bacteria 12054
246 Ga0496125_0033013 3300048928 Bacteria 4587
247 Ga0496125_0044094 3300048928 Bacteria 3777
248 Ga0496125_0067304 3300048928 Bacteria 2823
249 Ga0496126_0018213 3300048929 Bacteria 6969
250 Ga0496126_0068592 3300048929 Bacteria 3166
251 nmdc:mga0k408_81301_c1 3300050493 Bacteria 1897
252 nmdc:mga07m45_1696_c1 3300050496 Bacteria 10134
253 Ga0500635_0000105 3300053080 Bacteria 50250
254 Ga0500644_0019901 3300053088 Bacteria 1988
255 Ga0466962_0000326 3300061719 Bacteria 20394
256 Ga0466962_0001619 3300061719 Bacteria 10551
257 Ga0466962_0186810 3300061719 Bacteria 1011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0468439 Ga0395898_0468439_309_1181 269
2 3300047444 Ga0495675_0128418 Ga0495675_0128418_18_896 270
3 iso_pu_bacteria 2857537821 2857541715 275
4 iso_pu_bacteria 2501025504 2501407256 276
5 3300005328 Ga0070676_10016160 Ga0070676_100161606 280
6 3300005338 Ga0068868_100047478 Ga0068868_1000474783 280
7 3300005535 Ga0070684_100004028 Ga0070684_1000040286 280
8 3300005564 Ga0070664_100040722 Ga0070664_1000407224 280
9 3300039438 Ga0436360_1178603 Ga0436360_1178603_129_971 280
10 3300006028 Ga0070717_10018008 Ga0070717_100180084 281
11 3300025972 Ga0207668_10270620 Ga0207668_102706202 283
12 3300003316 rootH1_10021311 rootH1_100213112 289
13 3300025303 Ga0209051_1002429 Ga0209051_10024296 290
14 3300044683 Ga0466965_0002296 Ga0466965_0002296_2659_3573 290
15 3300044684 Ga0466966_0001919 Ga0466966_0001919_12182_13096 290
16 3300044706 Ga0466964_0002021 Ga0466964_0002021_3592_4506 290
17 3300044765 Ga0466970_0076244 Ga0466970_0076244_764_1678 290
18 3300044842 Ga0466957_0006574 Ga0466957_0006574_791_1705 290
19 3300045976 Ga0466967_0010201 Ga0466967_0010201_2848_3864 290
20 3300053088 Ga0500644_0019901 Ga0500644_0019901_959_1879 290
21 3300061719 Ga0466962_0001619 Ga0466962_0001619_7408_8322 290
22 3300015265 Ga0182005_1018916 Ga0182005_10189162 291
23 3300039437 Ga0436365_0603157 Ga0436365_0603157_146_1021 291
24 3300039447 Ga0436361_0005112 Ga0436361_0005112_15_890 291
25 3300045976 Ga0466967_0412193 Ga0466967_0412193_385_1299 291
26 3300048922 Ga0496119_0006716 Ga0496119_0006716_5940_6842 291
27 3300048923 Ga0496120_0000350 Ga0496120_0000350_3048_3950 291
28 3300048929 Ga0496126_0068592 Ga0496126_0068592_2070_2972 291
29 3300003758 Ga0055532_1002003 Ga0055532_10020032 292
30 3300003760 Ga0055527_1002803 Ga0055527_10028033 292
31 3300003761 Ga0055535_1000821 Ga0055535_10008219 292
32 3300003762 Ga0055542_1000867 Ga0055542_10008676 292
33 3300003763 Ga0055529_1000555 Ga0055529_100055514 292
34 3300005435 Ga0070714_100200590 Ga0070714_1002005901 292
35 3300006173 Ga0070716_100045529 Ga0070716_1000455293 292
36 3300025228 Ga0209672_100014 Ga0209672_10001413 292
37 3300025229 Ga0209147_100257 Ga0209147_10025715 292
38 3300025242 Ga0209258_100183 Ga0209258_10018315 292
39 3300025254 Ga0209148_1000035 Ga0209148_1000035492 292
40 3300025272 Ga0209455_1000232 Ga0209455_100023215 292
41 3300025273 Ga0209673_1000917 Ga0209673_100091717 292
42 3300025929 Ga0207664_10190230 Ga0207664_101902301 292
43 3300025939 Ga0207665_10095729 Ga0207665_100957291 292
44 3300005467 Ga0070706_100024688 Ga0070706_1000246882 293
45 3300046454 Ga0495592_0050731 Ga0495592_0050731_328_1275 293
46 3300046516 Ga0495628_0150712 Ga0495628_0150712_526_1473 293
47 3300046543 Ga0495645_0027235 Ga0495645_0027235_527_1474 293
48 3300047472 Ga0495686_0039214 Ga0495686_0039214_273_1202 293
49 iso_pu_bacteria 2599185214 2599626015 293
50 iso_pu_bacteria 2599185226 2599674903 293
51 iso_pu_bacteria 2599185227 2599683797 293
52 iso_pu_bacteria 2599185229 2599695600 293
53 iso_pu_bacteria 2738541307 2738881510 293
54 iso_pu_bacteria 2808606386 2808982243 293
55 iso_pu_bacteria 2808606415 2809129957 293
56 iso_pu_bacteria 2808606419 2809148988 293
57 iso_pu_bacteria 2852618963 2852619127 293
58 iso_pu_bacteria 2899924645 2899925510 293
59 iso_pu_bacteria 2928064002 2928067243 293
60 3300005564 Ga0070664_100009327 Ga0070664_1000093271 295
61 3300048919 Ga0496116_0158508 Ga0496116_0158508_172_1146 295
62 3300048924 Ga0496121_0038822 Ga0496121_0038822_3049_4023 295
63 3300048925 Ga0496122_0000410 Ga0496122_0000410_51522_52496 295
64 3300048926 Ga0496123_0000818 Ga0496123_0000818_13456_14430 295
65 3300048928 Ga0496125_0033013 Ga0496125_0033013_2059_3033 295
66 3300048929 Ga0496126_0018213 Ga0496126_0018213_1808_2782 295
67 iso_pu_bacteria 2501025501 2501076575 296
68 iso_pu_bacteria 2510917015 2511108354 296
69 iso_pu_bacteria 2818991440 2819562870 296
70 iso_pu_bacteria 2884411467 2884413266 296
71 iso_pu_bacteria 2904463128 2904463481 296
72 3300009545 Ga0105237_10043173 Ga0105237_100431732 297
73 3300010375 Ga0105239_10036976 Ga0105239_100369763 297
74 3300013102 Ga0157371_10167097 Ga0157371_101670972 297
75 3300013104 Ga0157370_10102357 Ga0157370_101023573 297
76 3300013105 Ga0157369_10032621 Ga0157369_100326216 297
77 3300013307 Ga0157372_10099809 Ga0157372_100998093 297
78 3300048927 Ga0496124_0119184 Ga0496124_0119184_218_1111 297
79 3300048928 Ga0496125_0067304 Ga0496125_0067304_268_1167 297
80 3300050496 nmdc:mga07m45_1696_c1 nmdc:mga07m45_1696_c1_163_1062 297
81 iso_pu_bacteria 2643221654 2644303110 297
82 3300003751 Ga0055538_1000019 Ga0055538_100001926 298
83 3300003752 Ga0055539_1000024 Ga0055539_1000024264 298
84 3300003756 Ga0055533_1000032 Ga0055533_100003226 298
85 3300003759 Ga0055525_1000041 Ga0055525_100004126 298
86 3300003841 Ga0055541_1000018 Ga0055541_1000018264 298
87 iso_pu_bacteria 2599185292 2599902598 298
88 iso_pu_bacteria 2643221569 2643861393 298
89 iso_pu_bacteria 2643221594 2643979585 298
90 iso_pu_bacteria 2643221621 2644123752 298
91 iso_pu_bacteria 2808606395 2809032949 298
92 iso_pu_bacteria 2856287931 2856290751 298
93 iso_pu_bacteria 2857357740 2857364974 298
94 iso_pu_bacteria 2858950400 2858953949 298
95 iso_pu_bacteria 2941479691 2941482823 298
96 3300003761 Ga0055535_1000198 Ga0055535_100019842 299
97 3300003763 Ga0055529_1000449 Ga0055529_10004499 299
98 3300005364 Ga0070673_100006362 Ga0070673_1000063624 299
99 3300025242 Ga0209258_100189 Ga0209258_10018983 299
100 3300025254 Ga0209148_1010429 Ga0209148_10104292 299
101 3300025256 Ga0209759_1001304 Ga0209759_100130414 299
102 3300025256 Ga0209759_1001336 Ga0209759_10013364 299
103 3300025272 Ga0209455_1000092 Ga0209455_100009281 299
104 3300025960 Ga0207651_10009225 Ga0207651_100092252 299
105 3300038443 Ga0395901_0560535 Ga0395901_0560535_53_961 299
106 3300061719 Ga0466962_0186810 Ga0466962_0186810_17_925 299
107 iso_pu_bacteria 2510917014 2511098148 299
108 iso_pu_bacteria 2515154189 2516020123 299
109 iso_pu_bacteria 2883087390 2883092302 299
110 3300009093 Ga0105240_10297277 Ga0105240_102972772 300
111 3300021361 Ga0213872_10002393 Ga0213872_100023935 300
112 3300025224 Ga0209784_100009 Ga0209784_100009329 300
113 3300025225 Ga0209566_100007 Ga0209566_100007329 300
114 3300025226 Ga0209674_100018 Ga0209674_100018329 300
115 3300025230 Ga0209563_100020 Ga0209563_100020329 300
116 3300025253 Ga0209677_100010 Ga0209677_100010329 300
117 3300037471 Ga0395905_0032187 Ga0395905_0032187_3518_4420 300
118 3300039447 Ga0436361_0544047 Ga0436361_0544047_15846_16784 300
119 3300046492 Ga0495585_0007482 Ga0495585_0007482_4332_5237 300
120 iso_pu_bacteria 2643221544 2643742170 300
121 iso_pu_bacteria 2643221585 2643933729 300
122 iso_pu_bacteria 2643221656 2644315222 300
123 iso_pu_bacteria 2643221660 2644341189 300
124 iso_pu_bacteria 2928037797 2928038394 300
125 iso_pu_bacteria 2928051484 2928053700 300
126 iso_pu_bacteria 2928070936 2928076212 300
127 iso_pu_bacteria 2928536128 2928542514 300
128 iso_pu_bacteria 8018845410 8018846902 300
129 iso_pu_bacteria 8021120328 8021122042 300
130 3300005327 Ga0070658_10140036 Ga0070658_101400361 301
131 3300005366 Ga0070659_100111923 Ga0070659_1001119232 301
132 3300006195 Ga0075366_10026176 Ga0075366_100261762 301
133 3300025909 Ga0207705_10069199 Ga0207705_100691993 301
134 3300026023 Ga0207677_10344247 Ga0207677_103442472 301
135 3300031711 Ga0265314_10013737 Ga0265314_100137374 301
136 3300031730 Ga0307516_10001445 Ga0307516_1000144529 301
137 3300050493 nmdc:mga0k408_81301_c1 nmdc:mga0k408_81301_c1_158_1081 301
138 3300003320 rootH2_10019508 rootH2_100195084 302
139 3300003322 rootL2_10203225 rootL2_102032252 302
140 3300003323 rootH1_10022292 rootH1_100222922 302
141 3300003752 Ga0055539_1000459 Ga0055539_10004593 302
142 3300003756 Ga0055533_1000080 Ga0055533_100008096 302
143 3300003759 Ga0055525_1001686 Ga0055525_10016862 302
144 3300003791 Ga0055530_10035298 Ga0055530_100352981 302
145 3300005327 Ga0070658_10079164 Ga0070658_100791643 302
146 3300005327 Ga0070658_10253530 Ga0070658_102535302 302
147 3300005563 Ga0068855_100009834 Ga0068855_1000098348 302
148 3300009093 Ga0105240_10009697 Ga0105240_1000969713 302
149 3300025226 Ga0209674_100003 Ga0209674_1000031830 302
150 3300025230 Ga0209563_100049 Ga0209563_100049292 302
151 3300025253 Ga0209677_100228 Ga0209677_10022839 302
152 3300025292 Ga0209676_1004185 Ga0209676_10041859 302
153 3300025298 Ga0209050_1003711 Ga0209050_10037115 302
154 3300025303 Ga0209051_1033158 Ga0209051_10331582 302
155 3300025909 Ga0207705_10129995 Ga0207705_101299952 302
156 3300025909 Ga0207705_10239613 Ga0207705_102396132 302
157 3300025913 Ga0207695_10063790 Ga0207695_100637903 302
158 3300025949 Ga0207667_10003340 Ga0207667_1000334016 302
159 3300027312 Ga0209371_1017498 Ga0209371_10174983 302
160 3300030500 Ga0268256_1019504 Ga0268256_10195043 302
161 3300031712 Ga0265342_10010827 Ga0265342_100108276 302
162 3300031911 Ga0307412_10000663 Ga0307412_1000066316 302
163 3300035086 Ga0373934_0005907 Ga0373934_0005907_1589_2518 302
164 3300037312 Ga0395899_0048903 Ga0395899_0048903_450_1403 302
165 3300037418 Ga0395900_0000077 Ga0395900_0000077_131659_132720 302
166 3300037418 Ga0395900_0002772 Ga0395900_0002772_87_1040 302
167 3300037466 Ga0395898_0003463 Ga0395898_0003463_120_1073 302
168 3300037466 Ga0395898_0024803 Ga0395898_0024803_3717_4778 302
169 3300037471 Ga0395905_0000090 Ga0395905_0000090_130117_131052 302
170 3300037471 Ga0395905_0010041 Ga0395905_0010041_7144_8097 302
171 3300037471 Ga0395905_0022533 Ga0395905_0022533_1615_2541 302
172 3300038443 Ga0395901_0000085 Ga0395901_0000085_35243_36304 302
173 3300038443 Ga0395901_0002059 Ga0395901_0002059_2809_3762 302
174 3300044656 Ga0466969_0061941 Ga0466969_0061941_196_1146 302
175 3300044684 Ga0466966_0034955 Ga0466966_0034955_1788_2738 302
176 3300044693 Ga0466961_0035158 Ga0466961_0035158_1153_2103 302
177 3300044694 Ga0466963_0020566 Ga0466963_0020566_2893_3930 302
178 3300044719 Ga0466971_0001064 Ga0466971_0001064_6666_7703 302
179 3300044719 Ga0466971_0028644 Ga0466971_0028644_1484_2434 302
180 3300044842 Ga0466957_0012061 Ga0466957_0012061_3896_4933 302
181 3300045049 Ga0466959_0023957 Ga0466959_0023957_1188_2138 302
182 3300045976 Ga0466967_0565104 Ga0466967_0565104_20_1057 302
183 3300046529 Ga0495652_0070612 Ga0495652_0070612_171_1082 302
184 3300048903 Ga0496100_0295747 Ga0496100_0295747_265_1197 302
185 3300048908 Ga0496105_0084060 Ga0496105_0084060_1481_2413 302
186 3300048918 Ga0496115_0374187 Ga0496115_0374187_147_1073 302
187 3300048919 Ga0496116_0004134 Ga0496116_0004134_10082_11056 302
188 3300048919 Ga0496116_0038236 Ga0496116_0038236_2389_3321 302
189 3300048920 Ga0496117_0006874 Ga0496117_0006874_1814_2734 302
190 3300048921 Ga0496118_0007141 Ga0496118_0007141_8990_9910 302
191 3300048921 Ga0496118_0052210 Ga0496118_0052210_1480_2412 302
192 3300048922 Ga0496119_0099241 Ga0496119_0099241_680_1600 302
193 3300048923 Ga0496120_0004341 Ga0496120_0004341_5778_6710 302
194 3300048924 Ga0496121_0002843 Ga0496121_0002843_4376_5308 302
195 3300048926 Ga0496123_0075542 Ga0496123_0075542_15_947 302
196 3300048927 Ga0496124_0043899 Ga0496124_0043899_196_1128 302
197 3300048927 Ga0496124_0044875 Ga0496124_0044875_427_1344 302
198 3300048928 Ga0496125_0000166 Ga0496125_0000166_127556_128488 302
199 3300048928 Ga0496125_0044094 Ga0496125_0044094_1507_2427 302
200 3300053080 Ga0500635_0000105 Ga0500635_0000105_12179_13150 302
201 3300061719 Ga0466962_0000326 Ga0466962_0000326_11615_12652 302
202 iso_pu_bacteria 2818991446 2819596137 302
203 iso_pu_bacteria 2904541872 2904546204 302
204 iso_pu_bacteria 2928044640 2928046000 302
205 iso_pu_bacteria 2929160207 2929164024 302
206 3300003316 rootH1_10018376 rootH1_100183763 303
207 3300009551 Ga0105238_10269775 Ga0105238_102697752 303
208 3300013105 Ga0157369_10001025 Ga0157369_1000102515 303
209 3300013296 Ga0157374_10163498 Ga0157374_101634982 303
210 3300013307 Ga0157372_10307783 Ga0157372_103077832 303
211 3300022467 Ga0224712_10018010 Ga0224712_100180102 303
212 3300025907 Ga0207645_10023206 Ga0207645_100232064 303
213 3300025945 Ga0207679_10034482 Ga0207679_100344822 303
214 3300026023 Ga0207677_10233815 Ga0207677_102338151 303
215 3300026089 Ga0207648_10052897 Ga0207648_100528973 303
216 3300037466 Ga0395898_0000359 Ga0395898_0000359_58601_59668 303
217 3300038443 Ga0395901_0010698 Ga0395901_0010698_4969_6036 303
218 3300038443 Ga0395901_0069975 Ga0395901_0069975_2143_3210 303
219 3300039438 Ga0436360_1183604 Ga0436360_1183604_293_1255 303
220 3300046471 Ga0495650_0014159 Ga0495650_0014159_2047_3147 303
221 3300047472 Ga0495686_0000048 Ga0495686_0000048_268041_268985 303
222 3300048924 Ga0496121_0001614 Ga0496121_0001614_4812_5735 303
223 3300048925 Ga0496122_0065301 Ga0496122_0065301_1302_2225 303
224 3300048928 Ga0496125_0004561 Ga0496125_0004561_7472_8395 303
225 3300048928 Ga0496125_0007014 Ga0496125_0007014_2593_3516 303
226 3300005335 Ga0070666_10009810 Ga0070666_100098102 304
227 3300005356 Ga0070674_100163299 Ga0070674_1001632992 304
228 3300005367 Ga0070667_100019846 Ga0070667_1000198461 304
229 3300005456 Ga0070678_100000638 Ga0070678_10000063811 304
230 3300005543 Ga0070672_100012840 Ga0070672_1000128404 304
231 3300005548 Ga0070665_100036427 Ga0070665_1000364275 304
232 3300013306 Ga0163162_10220012 Ga0163162_102200122 304
233 3300014969 Ga0157376_10023080 Ga0157376_100230803 304
234 3300025940 Ga0207691_10016237 Ga0207691_100162376 304
235 3300026121 Ga0207683_10010862 Ga0207683_100108622 304
236 3300028379 Ga0268266_10182089 Ga0268266_101820892 304
237 3300028666 Ga0265336_10000032 Ga0265336_10000032136 304
238 3300028794 Ga0307515_10011478 Ga0307515_1001147823 304
239 3300029957 Ga0265324_10002836 Ga0265324_100028367 304
240 3300031507 Ga0307509_10107703 Ga0307509_101077032 304
241 3300031616 Ga0307508_10000212 Ga0307508_1000021244 304
242 3300031649 Ga0307514_10014898 Ga0307514_100148984 304
243 3300037471 Ga0395905_0074827 Ga0395905_0074827_893_1909 304
244 3300039437 Ga0436365_1634642 Ga0436365_1634642_351_1358 304
245 3300039453 Ga0436362_0601157 Ga0436362_0601157_49_1023 304
246 3300042876 Ga0451577_0082021 Ga0451577_0082021_879_1802 304
247 3300044684 Ga0466966_0110259 Ga0466966_0110259_301_1350 304
248 3300045049 Ga0466959_0071011 Ga0466959_0071011_986_2035 304
249 3300045051 Ga0451576_0208866 Ga0451576_0208866_110_1024 304
250 3300046453 Ga0495627_007522 Ga0495627_007522_1822_2772 304
251 3300046516 Ga0495628_0006814 Ga0495628_0006814_6430_7377 304
252 3300048925 Ga0496122_0044220 Ga0496122_0044220_1417_2367 304
253 3300048926 Ga0496123_0014527 Ga0496123_0014527_1872_2822 304
254 3300005434 Ga0070709_10071142 Ga0070709_100711421 305
255 3300021361 Ga0213872_10025442 Ga0213872_100254421 305
256 3300037853 Ga0436364_0951777 Ga0436364_0951777_1668_2597 305
257 3300002773 JGI25152J39213_1003373 JGI25152J39213_10033735 306
258 3300002987 JGI25159J45721_1004945 JGI25159J45721_10049454 306
259 3300002987 JGI25159J45721_1005774 JGI25159J45721_10057742 306
260 3300003187 JGI25151J46595_10010026 JGI25151J46595_100100264 306
261 3300003215 JGI25153J46596_10009686 JGI25153J46596_100096864 306
262 3300003316 rootH1_10025008 rootH1_100250084 306
263 3300003320 rootH2_10054551 rootH2_100545513 306
264 3300003322 rootL2_10008403 rootL2_100084032 306
265 3300003354 JGI25160J50197_1007066 JGI25160J50197_10070664 306
266 3300003761 Ga0055535_1000239 Ga0055535_100023940 306
267 3300003762 Ga0055542_1000004 Ga0055542_1000004345 306
268 3300003771 Ga0055526_1010091 Ga0055526_10100914 306
269 3300003773 Ga0055537_1003901 Ga0055537_10039014 306
270 3300003775 Ga0055524_1007990 Ga0055524_10079904 306
271 3300003784 Ga0055534_1003986 Ga0055534_10039864 306
272 3300003790 Ga0055528_1008377 Ga0055528_10083774 306
273 3300003794 Ga0055531_10009025 Ga0055531_100090253 306
274 3300004625 Ga0055543_1003610 Ga0055543_10036104 306
275 3300005262 Ga0065165_1009181 Ga0065165_10091814 306
276 3300005436 Ga0070713_100003884 Ga0070713_1000038845 306
277 3300005563 Ga0068855_100015367 Ga0068855_1000153672 306
278 3300005834 Ga0068851_10015314 Ga0068851_100153144 306
279 3300025228 Ga0209672_104498 Ga0209672_1044983 306
280 3300025229 Ga0209147_101715 Ga0209147_1017154 306
281 3300025242 Ga0209258_100022 Ga0209258_100022344 306
282 3300025245 Ga0207425_1000164 Ga0207425_100016434 306
283 3300025254 Ga0209148_1000034 Ga0209148_1000034344 306
284 3300025258 Ga0209129_1000264 Ga0209129_10002649 306
285 3300025263 Ga0209565_1000110 Ga0209565_100011079 306
286 3300025273 Ga0209673_1000426 Ga0209673_100042629 306
287 3300025284 Ga0209130_1000205 Ga0209130_100020579 306
288 3300025291 Ga0209675_1000192 Ga0209675_100019265 306
289 3300025292 Ga0209676_1010250 Ga0209676_10102503 306
290 3300025294 Ga0209025_1000096 Ga0209025_100009675 306
291 3300025294 Ga0209025_1000116 Ga0209025_1000116175 306
292 3300025295 Ga0209564_1000649 Ga0209564_10006499 306
293 3300025297 Ga0209758_1000107 Ga0209758_1000107175 306
294 3300025299 Ga0209256_1000087 Ga0209256_1000087175 306
295 3300025302 Ga0207426_1000123 Ga0207426_1000123175 306
296 3300025303 Ga0209051_1060144 Ga0209051_10601442 306
297 3300025304 Ga0209257_1009301 Ga0209257_10093013 306
298 3300025321 Ga0207656_10003464 Ga0207656_100034644 306
299 3300025914 Ga0207671_10050056 Ga0207671_100500562 306
300 3300025949 Ga0207667_10073761 Ga0207667_100737613 306
301 3300026041 Ga0207639_10056316 Ga0207639_100563164 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

72

131

0.96

PF03466

LysR_substrate

LysR substrate binding domain

153

362

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9054 5 94
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.899 10 79
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.8939 10 95
7trv-assembly1.cif.gz_A crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.8866 5 94
4pzj-assembly1.cif.gz_A-2 1.60 angstrom resolution crystal structure of a transcriptional regulator of the lysr family from eggerthella lenta dsm 2243 0.8754 10 79
ID Description Score Start End Superfamily
af_P0A9F6_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9474 10 93 1.10.10.10
af_P75836_3_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9471 11 94 1.10.10.10
af_Q57083_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9417 7 90 1.10.10.10
af_P52044_6_90_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9384 14 96 1.10.10.10
af_P77333_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9359 12 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5R1NF86-F1-model_v4 deleted 0.9505 11 83
AF-A0A2R7KHJ9-F1-model_v4 deleted 0.9476 10 93
AF-W1XG19-F1-model_v4 HTH-type transcriptional regulator abgR 0.9446 10 89 GO:0003700
GO:0005829
AF-A0A0F4JEL2-F1-model_v4 LysR family transcriptional regulator 0.9337 11 85 GO:0003677
GO:0003700
GO:0032993
AF-A0A519XRV2-F1-model_v4 deleted 0.9296 10 89

Feature Viewer

pLDDT pTM Quality
88.79 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map