F396019

General Info

Members Datasets Scaffolds Average Seq Length
301 210 301 219

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0074389|Ga0373944_0074389_21_788
Length 255
Sequence MFRVSTGTRKKQAGEAGGFCTAAPMRRRANPAQGGSTMSLRINDEAPNFTAETTQGKLNLHDWIGNGWAVLFSHPKDFTPVCTTELGYMAGLMPEFEKRNTKIIGLSVDPVGDHTRWSKDIEETQGHRVTYPLIGDPELKVAKLYDMLPAEAGDTSAGRTPANNATVRSVFVIGPDKKIKTMLTYPMTTGRNFDEVLRILDSVQLTAKHPVATPVNWKPGGDVIIAGSVSDEEAQKRYPGFRAPKPYLRYTAQPR

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 4.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 96.35
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006739 3300000546 Bacteria 1245
2 Ga0058863_11725926 3300004799 Bacteria 700
3 Ga0070658_10006638 3300005327 Bacteria 9373
4 Ga0070683_100000001 3300005329 Bacteria 529385
5 Ga0068869_100039621 3300005334 Bacteria 3365
6 Ga0070666_10071080 3300005335 Bacteria 2368
7 Ga0070680_100283017 3300005336 Bacteria 1405
8 Ga0068868_100727701 3300005338 Bacteria 890
9 Ga0070660_100009054 3300005339 Bacteria 6986
10 Ga0070689_100230220 3300005340 Bacteria 1523
11 Ga0070675_100003759 3300005354 Bacteria 11527
12 Ga0070673_100145502 3300005364 Bacteria 2003
13 Ga0070673_100485489 3300005364 Bacteria 1116
14 Ga0070659_100016387 3300005366 Bacteria 5564
15 Ga0070659_100311784 3300005366 Bacteria 1314
16 Ga0070709_10089344 3300005434 Bacteria 2028
17 Ga0070714_100110330 3300005435 Bacteria 2435
18 Ga0070714_100171495 3300005435 Bacteria 1969
19 Ga0070714_100398307 3300005435 Bacteria 1301
20 Ga0070713_100087695 3300005436 Bacteria 2670
21 Ga0070713_100143395 3300005436 Bacteria 2118
22 Ga0070713_100186607 3300005436 Bacteria 1866
23 Ga0070710_10221998 3300005437 Bacteria 1203
24 Ga0070711_100034153 3300005439 Bacteria 3391
25 Ga0070711_100913939 3300005439 Bacteria 749
26 Ga0070700_100103166 3300005441 Bacteria 1883
27 Ga0070694_100008753 3300005444 Bacteria 6201
28 Ga0070708_100000068 3300005445 Bacteria 68300
29 Ga0070708_100030487 3300005445 Bacteria 4661
30 Ga0070663_100124533 3300005455 Bacteria 1951
31 Ga0070681_10003585 3300005458 Bacteria 14558
32 Ga0070681_10041672 3300005458 Bacteria 4602
33 Ga0070681_10201746 3300005458 Bacteria 1907
34 Ga0070681_10571779 3300005458 Bacteria 1044
35 Ga0070706_100002578 3300005467 Bacteria 18213
36 Ga0070706_100064902 3300005467 Bacteria 3375
37 Ga0070706_100198649 3300005467 Bacteria 1873
38 Ga0070707_100000319 3300005468 Bacteria 47285
39 Ga0070707_100019993 3300005468 Bacteria 6312
40 Ga0070698_100000255 3300005471 Bacteria 53335
41 Ga0070698_100004510 3300005471 Bacteria 15307
42 Ga0070698_100024956 3300005471 Bacteria 6231
43 Ga0070698_100025950 3300005471 Bacteria 6104
44 Ga0070699_100001387 3300005518 Bacteria 22279
45 Ga0070679_100321432 3300005530 Bacteria 1497
46 Ga0070679_100502441 3300005530 Bacteria 1156
47 Ga0070684_100000006 3300005535 Bacteria 227715
48 Ga0070697_100002296 3300005536 Bacteria 14683
49 Ga0070697_100165979 3300005536 Bacteria 1867
50 Ga0070697_100490409 3300005536 Bacteria 1074
51 Ga0070697_101081565 3300005536 Bacteria 714
52 Ga0068853_100000105 3300005539 Bacteria 56438
53 Ga0070672_100171470 3300005543 Bacteria 1805
54 Ga0070686_100040735 3300005544 Bacteria 2899
55 Ga0070665_100093590 3300005548 Bacteria 3010
56 Ga0068855_100021374 3300005563 Bacteria 7760
57 Ga0068855_100092152 3300005563 Bacteria 3495
58 Ga0068855_100286822 3300005563 Bacteria 1826
59 Ga0070664_100089249 3300005564 Bacteria 2667
60 Ga0068854_100000022 3300005578 Bacteria 127908
61 Ga0068856_100047530 3300005614 Bacteria 4227
62 Ga0068856_100199980 3300005614 Bacteria 2013
63 Ga0068856_100778507 3300005614 Bacteria 977
64 Ga0068863_100000571 3300005841 Bacteria 37496
65 Ga0068863_100003423 3300005841 Bacteria 15638
66 Ga0068858_100000862 3300005842 Bacteria 31408
67 Ga0068858_100250513 3300005842 Bacteria 1682
68 Ga0068860_100095431 3300005843 Bacteria 2835
69 Ga0070717_10270042 3300006028 Bacteria 1506
70 Ga0070716_100100506 3300006173 Bacteria 1772
71 Ga0070712_100044736 3300006175 Bacteria 3054
72 Ga0070712_100121721 3300006175 Bacteria 1964
73 Ga0097621_100011302 3300006237 Bacteria 6572
74 Ga0068871_100346425 3300006358 Bacteria 1313
75 Ga0075428_100087680 3300006844 Bacteria 3395
76 Ga0075431_100744111 3300006847 Bacteria 956
77 Ga0075433_10001006 3300006852 Bacteria 20056
78 Ga0075434_100000206 3300006871 Bacteria 40043
79 Ga0075434_100101261 3300006871 Bacteria 2887
80 Ga0075434_100227743 3300006871 Bacteria 1883
81 Ga0075436_100022339 3300006914 Bacteria 4345
82 Ga0075435_100010935 3300007076 Bacteria 6650
83 Ga0075435_100026568 3300007076 Bacteria 4519
84 Ga0099795_10101529 3300007788 Bacteria 1129
85 Ga0105250_10025289 3300009092 Bacteria 2393
86 Ga0105240_10011542 3300009093 Bacteria 12297
87 Ga0105240_10053440 3300009093 Bacteria 5070
88 Ga0105240_10219566 3300009093 Bacteria 2215
89 Ga0105240_10465321 3300009093 Bacteria 1412
90 Ga0111539_10469312 3300009094 Bacteria 1465
91 Ga0111539_10499738 3300009094 Bacteria 1416
92 Ga0105247_10000970 3300009101 Bacteria 21642
93 Ga0114129_10000398 3300009147 Bacteria 50789
94 Ga0105242_10157635 3300009176 Bacteria 1984
95 Ga0105248_10049633 3300009177 Bacteria 4707
96 Ga0105248_10262899 3300009177 Bacteria 1942
97 Ga0105237_10165549 3300009545 Bacteria 2210
98 Ga0105238_10133860 3300009551 Bacteria 2457
99 Ga0105249_10546211 3300009553 Bacteria 1209
100 Ga0099796_10006992 3300010159 Bacteria 2923
101 Ga0099796_10092142 3300010159 Bacteria 1128
102 Ga0157370_10034311 3300013104 Bacteria 4942
103 Ga0157370_10071417 3300013104 Bacteria 3275
104 Ga0157369_10062225 3300013105 Bacteria 4022
105 Ga0157369_10287843 3300013105 Bacteria 1711
106 Ga0157374_10075351 3300013296 Bacteria 3188
107 Ga0157374_10096020 3300013296 Bacteria 2835
108 Ga0157374_10646424 3300013296 Bacteria 1069
109 Ga0157378_10056666 3300013297 Bacteria 3492
110 Ga0157378_10066672 3300013297 Bacteria 3224
111 Ga0163162_10304083 3300013306 Bacteria 1727
112 Ga0157372_10100521 3300013307 Bacteria 3300
113 Ga0157375_10799966 3300013308 Bacteria 1092
114 Ga0157380_10174378 3300014326 Bacteria 1882
115 Ga0157377_10025326 3300014745 Bacteria 3163
116 Ga0157379_10077595 3300014968 Bacteria 2974
117 Ga0157376_10142277 3300014969 Bacteria 2153
118 Ga0157376_10178898 3300014969 Bacteria 1937
119 Ga0182007_10133318 3300015262 Bacteria 837
120 Ga0197907_10456435 3300020069 Bacteria 1215
121 Ga0206356_11109720 3300020070 Bacteria 1320
122 Ga0206355_1311596 3300020076 Bacteria 1503
123 Ga0206352_10594573 3300020078 Bacteria 862
124 Ga0206350_11137683 3300020080 Bacteria 926
125 Ga0206350_11151789 3300020080 Bacteria 826
126 Ga0206354_11426302 3300020081 Bacteria 926
127 Ga0154015_1182721 3300020610 Bacteria 849
128 Ga0213873_10019473 3300021358 Bacteria 1575
129 Ga0213873_10053945 3300021358 Bacteria 1072
130 Ga0224712_10023508 3300022467 Bacteria 2141
131 Ga0224712_10186194 3300022467 Bacteria 938
132 Ga0207692_10159592 3300025898 Bacteria 1298
133 Ga0207642_10020816 3300025899 Bacteria 2570
134 Ga0207710_10002089 3300025900 Bacteria 9454
135 Ga0207688_10041713 3300025901 Bacteria 2554
136 Ga0207680_10210955 3300025903 Bacteria 1328
137 Ga0207705_10111085 3300025909 Bacteria 2025
138 Ga0207684_10000081 3300025910 Bacteria 178619
139 Ga0207707_10010321 3300025912 Bacteria 8103
140 Ga0207707_10011132 3300025912 Bacteria 7823
141 Ga0207695_10007745 3300025913 Bacteria 13607
142 Ga0207695_10054480 3300025913 Bacteria 4176
143 Ga0207695_10073834 3300025913 Bacteria 3474
144 Ga0207693_10039556 3300025915 Bacteria 3714
145 Ga0207693_10055963 3300025915 Bacteria 3093
146 Ga0207693_10257577 3300025915 Bacteria 1368
147 Ga0207663_10098595 3300025916 Bacteria 1957
148 Ga0207660_10223849 3300025917 Bacteria 1477
149 Ga0207660_10327930 3300025917 Bacteria 1223
150 Ga0207662_10167175 3300025918 Bacteria 1409
151 Ga0207662_10592172 3300025918 Bacteria 771
152 Ga0207657_10021819 3300025919 Bacteria 6016
153 Ga0207652_10016813 3300025921 Bacteria 5978
154 Ga0207646_10000591 3300025922 Bacteria 47189
155 Ga0207646_10012265 3300025922 Bacteria 8244
156 Ga0207694_10003660 3300025924 Bacteria 12167
157 Ga0207694_10385240 3300025924 Bacteria 1164
158 Ga0207659_10023997 3300025926 Bacteria 4080
159 Ga0207687_10132501 3300025927 Bacteria 1881
160 Ga0207700_10015272 3300025928 Bacteria 5058
161 Ga0207700_10222382 3300025928 Bacteria 1601
162 Ga0207700_10228822 3300025928 Bacteria 1580
163 Ga0207700_10761678 3300025928 Bacteria 865
164 Ga0207664_10041568 3300025929 Bacteria 3582
165 Ga0207664_10120307 3300025929 Bacteria 2196
166 Ga0207644_10961443 3300025931 Bacteria 716
167 Ga0207690_10020295 3300025932 Bacteria 4104
168 Ga0207670_10518313 3300025936 Bacteria 970
169 Ga0207669_10238643 3300025937 Bacteria 1346
170 Ga0207665_10136839 3300025939 Bacteria 1744
171 Ga0207711_10041793 3300025941 Bacteria 3905
172 Ga0207689_10052984 3300025942 Bacteria 3342
173 Ga0207661_10000005 3300025944 Bacteria 557888
174 Ga0207679_10445735 3300025945 Bacteria 1147
175 Ga0207667_10074288 3300025949 Bacteria 3532
176 Ga0207667_10520194 3300025949 Bacteria 1205
177 Ga0207651_10113742 3300025960 Bacteria 2037
178 Ga0207651_10448156 3300025960 Bacteria 1107
179 Ga0207712_10064193 3300025961 Bacteria 2617
180 Ga0207640_10000030 3300025981 Bacteria 127918
181 Ga0207677_10405837 3300026023 Bacteria 1157
182 Ga0207703_10004030 3300026035 Bacteria 12147
183 Ga0207639_10000363 3300026041 Bacteria 31350
184 Ga0207639_10089556 3300026041 Bacteria 2459
185 Ga0207708_10646588 3300026075 Bacteria 900
186 Ga0207702_10229900 3300026078 Bacteria 1733
187 Ga0207702_10270500 3300026078 Bacteria 1603
188 Ga0207702_10929382 3300026078 Bacteria 862
189 Ga0207641_10000812 3300026088 Bacteria 33288
190 Ga0207641_10163323 3300026088 Bacteria 2026
191 Ga0207674_10819234 3300026116 Bacteria 898
192 Ga0209179_1036713 3300027512 Bacteria 1022
193 Ga0209999_1031327 3300027543 Bacteria 987
194 Ga0209982_1006765 3300027552 Bacteria 1671
195 Ga0268266_10051671 3300028379 Bacteria 3528
196 Ga0268265_10689708 3300028380 Bacteria 986
197 Ga0268264_10008023 3300028381 Bacteria 8779
198 Ga0268264_10067865 3300028381 Bacteria 3011
199 Ga0268264_10327263 3300028381 Bacteria 1451
200 Ga0265338_10022550 3300028800 Bacteria 6512
201 Ga0265338_10393789 3300028800 Bacteria 988
202 Ga0265760_10034379 3300031090 Bacteria 1499
203 Ga0265332_10162212 3300031238 Bacteria 934
204 Ga0265325_10162512 3300031241 Bacteria 1050
205 Ga0265339_10000653 3300031249 Bacteria 26815
206 Ga0265339_10009405 3300031249 Bacteria 6145
207 Ga0265316_10002226 3300031344 Bacteria 20351
208 Ga0265314_10001261 3300031711 Bacteria 28854
209 Ga0373926_0030657 3300035083 Bacteria 1894
210 Ga0373928_0089363 3300035084 Bacteria 789
211 Ga0373944_0074389 3300035089 Bacteria 1112
212 Ga0373936_0173449 3300035113 Bacteria 944
213 Ga0373953_0068471 3300035117 Bacteria 1461
214 Ga0373954_0000025 3300035118 Bacteria 57365
215 Ga0373931_0046924 3300035691 Bacteria 2285
216 Ga0373935_0067941 3300035692 Bacteria 2293
217 Ga0373935_0710373 3300035692 Bacteria 739
218 Ga0373927_0097514 3300035695 Bacteria 1911
219 Ga0373933_0149985 3300035724 Bacteria 1476
220 Ga0373947_0037531 3300035725 Bacteria 2875
221 Ga0373947_0540440 3300035725 Bacteria 793
222 Ga0373937_0001823 3300036401 Bacteria 17875
223 Ga0373937_0275544 3300036401 Bacteria 1588
224 Ga0373937_0303686 3300036401 Bacteria 1509
225 Ga0373925_0067394 3300037068 Bacteria 2699
226 Ga0373925_0069329 3300037068 Bacteria 2663
227 Ga0373925_0599218 3300037068 Bacteria 907
228 Ga0395901_0327961 3300038443 Bacteria 1583
229 Ga0436365_0432212 3300039437 Bacteria 1293
230 Ga0436361_0793823 3300039447 Bacteria 2280
231 Ga0436363_0029113 3300039450 Bacteria 1218
232 Ga0436362_0416739 3300039453 Bacteria 4120
233 Ga0436362_1014264 3300039453 Bacteria 2896
234 Ga0466969_0013199 3300044656 Bacteria 4352
235 Ga0466972_0033145 3300044658 Bacteria 2534
236 Ga0466966_0009428 3300044684 Bacteria 6465
237 Ga0466961_0026909 3300044693 Bacteria 3698
238 Ga0466963_0005734 3300044694 Bacteria 7303
239 Ga0466964_0003648 3300044706 Bacteria 5627
240 Ga0466971_0000160 3300044719 Bacteria 25173
241 Ga0466970_0000837 3300044765 Bacteria 14804
242 Ga0466957_0097690 3300044842 Bacteria 1847
243 Ga0466959_0002175 3300045049 Bacteria 12469
244 Ga0466959_0019575 3300045049 Bacteria 4978
245 Ga0495641_0056159 3300046461 Bacteria 1785
246 Ga0495651_0122215 3300046462 Bacteria 1911
247 Ga0495580_0000638 3300046472 Bacteria 29751
248 Ga0495580_0053066 3300046472 Bacteria 2862
249 Ga0495582_0001345 3300046473 Bacteria 13807
250 Ga0495582_0020678 3300046473 Bacteria 3603
251 Ga0495630_0532169 3300046517 Bacteria 901
252 Ga0495622_0233864 3300046557 Bacteria 811
253 Ga0495657_0098911 3300046675 Bacteria 1861
254 Ga0495658_0039903 3300046683 Bacteria 2608
255 Ga0496108_0024282 3300048911 Bacteria 4991
256 Ga0496112_0021385 3300048915 Bacteria 6152
257 Ga0496112_0277210 3300048915 Bacteria 1624
258 Ga0496113_0718924 3300048916 Bacteria 796
259 Ga0496115_0330795 3300048918 Bacteria 1245
260 Ga0496121_0005496 3300048924 Bacteria 16226
261 Ga0496124_0023594 3300048927 Bacteria 5613
262 Ga0496125_0006536 3300048928 Bacteria 12563
263 Ga0496126_0413231 3300048929 Bacteria 1092
264 Ga0501033_0065843 3300049570 Bacteria 2665
265 Ga0501037_0335933 3300049573 Bacteria 1044
266 Ga0501039_0156502 3300049575 Bacteria 1790
267 Ga0501041_0009999 3300049577 Bacteria 5590
268 Ga0501042_0072514 3300049578 Bacteria 2464
269 Ga0501042_0107427 3300049578 Bacteria 2009
270 Ga0501043_0313993 3300049579 Bacteria 1196
271 Ga0501046_0002713 3300049580 Bacteria 16476
272 Ga0501046_0310290 3300049580 Bacteria 1151
273 Ga0501047_0714790 3300049581 Bacteria 819
274 Ga0501048_0094064 3300049582 Bacteria 2114
275 Ga0501048_0162400 3300049582 Bacteria 1581
276 Ga0501067_0055236 3300049583 Bacteria 2201
277 Ga0501068_0098830 3300049584 Bacteria 1808
278 Ga0501071_0084081 3300049587 Bacteria 2332
279 Ga0501071_0091958 3300049587 Bacteria 2229
280 Ga0501072_0073615 3300049588 Bacteria 2700
281 Ga0501076_0068431 3300049592 Bacteria 2836
282 Ga0501077_0019896 3300049593 Bacteria 4247
283 Ga0501201_008023 3300049651 Bacteria 1015
284 Ga0501079_0537208 3300049741 Bacteria 919
285 Ga0501045_0013254 3300049824 Bacteria 5818
286 Ga0501045_0077155 3300049824 Bacteria 2455
287 nmdc:mga05p37_377_c1 3300050507 Bacteria 48005
288 nmdc:mga08y16_389692_c1 3300050511 Bacteria 1427
289 nmdc:mga08y16_617830_c1 3300050511 Bacteria 1091
290 nmdc:mga0n895_1948_c1 3300050512 Bacteria 15852
291 nmdc:mga0n895_224084_c1 3300050512 Bacteria 1908
292 nmdc:mga0n895_45083_c1 3300050512 Bacteria 4302
293 nmdc:mga0n895_516265_c1 3300050512 Bacteria 1203
294 nmdc:mga0rr50_2277_c1 3300050513 Bacteria 10765
295 nmdc:mga0rr50_6079_c1 3300050513 Bacteria 7296
296 nmdc:mga08x19_105395_c1 3300050514 Bacteria 1875
297 nmdc:mga08x19_194471_c1 3300050514 Bacteria 1389
298 nmdc:mga0a205_76164_c1 3300050515 Bacteria 3242
299 Ga0587094_023998 3300059513 Bacteria 906
300 Ga0501082_0005715 3300060353 Bacteria 10788
301 Ga0466962_0004576 3300061719 Bacteria 6640

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10022550 Ga0265338_100225504 204
2 3300031241 Ga0265325_10162512 Ga0265325_101625122 204
3 3300031249 Ga0265339_10000653 Ga0265339_1000065316 204
4 3300031344 Ga0265316_10002226 Ga0265316_100022263 204
5 3300031711 Ga0265314_10001261 Ga0265314_100012617 204
6 3300026075 Ga0207708_10646588 Ga0207708_106465881 205
7 3300044694 Ga0466963_0005734 Ga0466963_0005734_1149_1805 206
8 3300049583 Ga0501067_0055236 Ga0501067_0055236_1533_2156 206
9 3300014969 Ga0157376_10178898 Ga0157376_101788982 210
10 3300025918 Ga0207662_10167175 Ga0207662_101671751 210
11 3300046462 Ga0495651_0122215 Ga0495651_0122215_22_669 213
12 3300004799 Ga0058863_11725926 Ga0058863_117259261 216
13 3300005334 Ga0068869_100039621 Ga0068869_1000396212 216
14 3300005338 Ga0068868_100727701 Ga0068868_1007277011 216
15 3300005354 Ga0070675_100003759 Ga0070675_1000037596 216
16 3300005364 Ga0070673_100145502 Ga0070673_1001455024 216
17 3300005364 Ga0070673_100485489 Ga0070673_1004854892 216
18 3300005441 Ga0070700_100103166 Ga0070700_1001031664 216
19 3300005543 Ga0070672_100171470 Ga0070672_1001714703 216
20 3300014745 Ga0157377_10025326 Ga0157377_100253264 216
21 3300025901 Ga0207688_10041713 Ga0207688_100417133 216
22 3300025918 Ga0207662_10592172 Ga0207662_105921721 216
23 3300025926 Ga0207659_10023997 Ga0207659_100239972 216
24 3300025936 Ga0207670_10518313 Ga0207670_105183132 216
25 3300025937 Ga0207669_10238643 Ga0207669_102386431 216
26 3300025942 Ga0207689_10052984 Ga0207689_100529844 216
27 3300025960 Ga0207651_10113742 Ga0207651_101137421 216
28 3300026023 Ga0207677_10405837 Ga0207677_104058372 216
29 3300027543 Ga0209999_1031327 Ga0209999_10313272 216
30 3300035725 Ga0373947_0037531 Ga0373947_0037531_347_1081 216
31 3300046473 Ga0495582_0020678 Ga0495582_0020678_717_1409 216
32 3300046683 Ga0495658_0039903 Ga0495658_0039903_643_1335 216
33 3300048927 Ga0496124_0023594 Ga0496124_0023594_2810_3472 216
34 3300050511 nmdc:mga08y16_617830_c1 nmdc:mga08y16_617830_c1_251_904 216
35 3300005444 Ga0070694_100008753 Ga0070694_1000087533 217
36 3300005467 Ga0070706_100064902 Ga0070706_1000649021 217
37 3300005471 Ga0070698_100004510 Ga0070698_1000045107 217
38 3300005471 Ga0070698_100024956 Ga0070698_1000249562 217
39 3300005471 Ga0070698_100025950 Ga0070698_1000259504 217
40 3300005536 Ga0070697_100165979 Ga0070697_1001659791 217
41 3300005536 Ga0070697_100490409 Ga0070697_1004904091 217
42 3300005841 Ga0068863_100000571 Ga0068863_10000057120 217
43 3300005842 Ga0068858_100250513 Ga0068858_1002505132 217
44 3300005843 Ga0068860_100095431 Ga0068860_1000954312 217
45 3300006175 Ga0070712_100044736 Ga0070712_1000447362 217
46 3300006175 Ga0070712_100121721 Ga0070712_1001217212 217
47 3300006871 Ga0075434_100101261 Ga0075434_1001012612 217
48 3300006871 Ga0075434_100227743 Ga0075434_1002277432 217
49 3300007076 Ga0075435_100026568 Ga0075435_1000265683 217
50 3300009147 Ga0114129_10000398 Ga0114129_100003987 217
51 3300013297 Ga0157378_10056666 Ga0157378_100566663 217
52 3300013297 Ga0157378_10066672 Ga0157378_100666723 217
53 3300013308 Ga0157375_10799966 Ga0157375_107999661 217
54 3300014968 Ga0157379_10077595 Ga0157379_100775954 217
55 3300025939 Ga0207665_10136839 Ga0207665_101368391 217
56 3300026088 Ga0207641_10000812 Ga0207641_1000081213 217
57 3300028381 Ga0268264_10067865 Ga0268264_100678652 217
58 3300028381 Ga0268264_10327263 Ga0268264_103272633 217
59 3300046461 Ga0495641_0056159 Ga0495641_0056159_948_1604 217
60 3300046472 Ga0495580_0000638 Ga0495580_0000638_20593_21249 217
61 3300046473 Ga0495582_0001345 Ga0495582_0001345_378_1034 217
62 3300046557 Ga0495622_0233864 Ga0495622_0233864_108_764 217
63 3300050507 nmdc:mga05p37_377_c1 nmdc:mga05p37_377_c1_8053_8715 217
64 3300050512 nmdc:mga0n895_45083_c1 nmdc:mga0n895_45083_c1_2730_3386 217
65 3300050512 nmdc:mga0n895_516265_c1 nmdc:mga0n895_516265_c1_297_953 217
66 3300050513 nmdc:mga0rr50_6079_c1 nmdc:mga0rr50_6079_c1_2452_3108 217
67 3300000546 LJNas_1006739 LJNas_10067391 218
68 3300005327 Ga0070658_10006638 Ga0070658_100066387 218
69 3300005329 Ga0070683_100000001 Ga0070683_100000001386 218
70 3300005335 Ga0070666_10071080 Ga0070666_100710803 218
71 3300005336 Ga0070680_100283017 Ga0070680_1002830172 218
72 3300005339 Ga0070660_100009054 Ga0070660_1000090543 218
73 3300005340 Ga0070689_100230220 Ga0070689_1002302202 218
74 3300005366 Ga0070659_100016387 Ga0070659_1000163874 218
75 3300005366 Ga0070659_100311784 Ga0070659_1003117842 218
76 3300005434 Ga0070709_10089344 Ga0070709_100893442 218
77 3300005435 Ga0070714_100110330 Ga0070714_1001103302 218
78 3300005435 Ga0070714_100171495 Ga0070714_1001714952 218
79 3300005435 Ga0070714_100398307 Ga0070714_1003983072 218
80 3300005436 Ga0070713_100087695 Ga0070713_1000876952 218
81 3300005436 Ga0070713_100143395 Ga0070713_1001433952 218
82 3300005436 Ga0070713_100186607 Ga0070713_1001866072 218
83 3300005437 Ga0070710_10221998 Ga0070710_102219982 218
84 3300005439 Ga0070711_100034153 Ga0070711_1000341531 218
85 3300005439 Ga0070711_100913939 Ga0070711_1009139391 218
86 3300005445 Ga0070708_100000068 Ga0070708_10000006847 218
87 3300005445 Ga0070708_100030487 Ga0070708_1000304874 218
88 3300005455 Ga0070663_100124533 Ga0070663_1001245333 218
89 3300005458 Ga0070681_10003585 Ga0070681_100035858 218
90 3300005458 Ga0070681_10041672 Ga0070681_100416723 218
91 3300005458 Ga0070681_10201746 Ga0070681_102017462 218
92 3300005458 Ga0070681_10571779 Ga0070681_105717791 218
93 3300005467 Ga0070706_100002578 Ga0070706_1000025784 218
94 3300005467 Ga0070706_100198649 Ga0070706_1001986492 218
95 3300005468 Ga0070707_100000319 Ga0070707_10000031924 218
96 3300005468 Ga0070707_100019993 Ga0070707_1000199933 218
97 3300005471 Ga0070698_100000255 Ga0070698_1000002557 218
98 3300005518 Ga0070699_100001387 Ga0070699_1000013877 218
99 3300005530 Ga0070679_100321432 Ga0070679_1003214322 218
100 3300005530 Ga0070679_100502441 Ga0070679_1005024412 218
101 3300005535 Ga0070684_100000006 Ga0070684_100000006183 218
102 3300005536 Ga0070697_100002296 Ga0070697_1000022964 218
103 3300005536 Ga0070697_101081565 Ga0070697_1010815651 218
104 3300005539 Ga0068853_100000105 Ga0068853_10000010543 218
105 3300005544 Ga0070686_100040735 Ga0070686_1000407354 218
106 3300005548 Ga0070665_100093590 Ga0070665_1000935903 218
107 3300005563 Ga0068855_100021374 Ga0068855_1000213742 218
108 3300005563 Ga0068855_100092152 Ga0068855_1000921524 218
109 3300005563 Ga0068855_100286822 Ga0068855_1002868222 218
110 3300005564 Ga0070664_100089249 Ga0070664_1000892492 218
111 3300005578 Ga0068854_100000022 Ga0068854_10000002241 218
112 3300005614 Ga0068856_100047530 Ga0068856_1000475302 218
113 3300005614 Ga0068856_100199980 Ga0068856_1001999801 218
114 3300005614 Ga0068856_100778507 Ga0068856_1007785072 218
115 3300005841 Ga0068863_100003423 Ga0068863_10000342314 218
116 3300005842 Ga0068858_100000862 Ga0068858_1000008624 218
117 3300006028 Ga0070717_10270042 Ga0070717_102700422 218
118 3300006173 Ga0070716_100100506 Ga0070716_1001005061 218
119 3300006237 Ga0097621_100011302 Ga0097621_1000113028 218
120 3300006358 Ga0068871_100346425 Ga0068871_1003464252 218
121 3300006844 Ga0075428_100087680 Ga0075428_1000876803 218
122 3300006847 Ga0075431_100744111 Ga0075431_1007441111 218
123 3300006852 Ga0075433_10001006 Ga0075433_100010063 218
124 3300006871 Ga0075434_100000206 Ga0075434_10000020638 218
125 3300006914 Ga0075436_100022339 Ga0075436_1000223395 218
126 3300007076 Ga0075435_100010935 Ga0075435_1000109356 218
127 3300007788 Ga0099795_10101529 Ga0099795_101015292 218
128 3300009092 Ga0105250_10025289 Ga0105250_100252892 218
129 3300009093 Ga0105240_10011542 Ga0105240_100115426 218
130 3300009093 Ga0105240_10053440 Ga0105240_100534403 218
131 3300009093 Ga0105240_10219566 Ga0105240_102195661 218
132 3300009093 Ga0105240_10465321 Ga0105240_104653211 218
133 3300009094 Ga0111539_10469312 Ga0111539_104693122 218
134 3300009094 Ga0111539_10499738 Ga0111539_104997382 218
135 3300009101 Ga0105247_10000970 Ga0105247_100009704 218
136 3300009176 Ga0105242_10157635 Ga0105242_101576352 218
137 3300009177 Ga0105248_10049633 Ga0105248_100496332 218
138 3300009177 Ga0105248_10262899 Ga0105248_102628992 218
139 3300009545 Ga0105237_10165549 Ga0105237_101655492 218
140 3300009551 Ga0105238_10133860 Ga0105238_101338603 218
141 3300009553 Ga0105249_10546211 Ga0105249_105462111 218
142 3300010159 Ga0099796_10006992 Ga0099796_100069922 218
143 3300010159 Ga0099796_10092142 Ga0099796_100921421 218
144 3300013104 Ga0157370_10034311 Ga0157370_100343112 218
145 3300013104 Ga0157370_10071417 Ga0157370_100714172 218
146 3300013105 Ga0157369_10062225 Ga0157369_100622251 218
147 3300013105 Ga0157369_10287843 Ga0157369_102878432 218
148 3300013296 Ga0157374_10075351 Ga0157374_100753514 218
149 3300013296 Ga0157374_10096020 Ga0157374_100960202 218
150 3300013296 Ga0157374_10646424 Ga0157374_106464242 218
151 3300013306 Ga0163162_10304083 Ga0163162_103040832 218
152 3300013307 Ga0157372_10100521 Ga0157372_101005214 218
153 3300014326 Ga0157380_10174378 Ga0157380_101743784 218
154 3300014969 Ga0157376_10142277 Ga0157376_101422772 218
155 3300015262 Ga0182007_10133318 Ga0182007_101333181 218
156 3300020069 Ga0197907_10456435 Ga0197907_104564351 218
157 3300020070 Ga0206356_11109720 Ga0206356_111097201 218
158 3300020076 Ga0206355_1311596 Ga0206355_13115962 218
159 3300020078 Ga0206352_10594573 Ga0206352_105945731 218
160 3300020080 Ga0206350_11137683 Ga0206350_111376831 218
161 3300020080 Ga0206350_11151789 Ga0206350_111517891 218
162 3300020081 Ga0206354_11426302 Ga0206354_114263021 218
163 3300020610 Ga0154015_1182721 Ga0154015_11827211 218
164 3300021358 Ga0213873_10019473 Ga0213873_100194732 218
165 3300021358 Ga0213873_10053945 Ga0213873_100539452 218
166 3300022467 Ga0224712_10023508 Ga0224712_100235082 218
167 3300022467 Ga0224712_10186194 Ga0224712_101861942 218
168 3300025898 Ga0207692_10159592 Ga0207692_101595922 218
169 3300025899 Ga0207642_10020816 Ga0207642_100208161 218
170 3300025900 Ga0207710_10002089 Ga0207710_100020894 218
171 3300025903 Ga0207680_10210955 Ga0207680_102109552 218
172 3300025909 Ga0207705_10111085 Ga0207705_101110852 218
173 3300025910 Ga0207684_10000081 Ga0207684_1000008170 218
174 3300025912 Ga0207707_10010321 Ga0207707_100103216 218
175 3300025912 Ga0207707_10011132 Ga0207707_100111324 218
176 3300025913 Ga0207695_10007745 Ga0207695_100077454 218
177 3300025913 Ga0207695_10054480 Ga0207695_100544804 218
178 3300025913 Ga0207695_10073834 Ga0207695_100738342 218
179 3300025915 Ga0207693_10039556 Ga0207693_100395564 218
180 3300025915 Ga0207693_10055963 Ga0207693_100559632 218
181 3300025915 Ga0207693_10257577 Ga0207693_102575772 218
182 3300025916 Ga0207663_10098595 Ga0207663_100985951 218
183 3300025917 Ga0207660_10223849 Ga0207660_102238491 218
184 3300025917 Ga0207660_10327930 Ga0207660_103279302 218
185 3300025919 Ga0207657_10021819 Ga0207657_100218193 218
186 3300025921 Ga0207652_10016813 Ga0207652_100168135 218
187 3300025922 Ga0207646_10000591 Ga0207646_1000059124 218
188 3300025922 Ga0207646_10012265 Ga0207646_100122655 218
189 3300025924 Ga0207694_10003660 Ga0207694_100036604 218
190 3300025924 Ga0207694_10385240 Ga0207694_103852402 218
191 3300025927 Ga0207687_10132501 Ga0207687_101325012 218
192 3300025928 Ga0207700_10015272 Ga0207700_100152722 218
193 3300025928 Ga0207700_10222382 Ga0207700_102223822 218
194 3300025928 Ga0207700_10228822 Ga0207700_102288221 218
195 3300025928 Ga0207700_10761678 Ga0207700_107616781 218
196 3300025929 Ga0207664_10041568 Ga0207664_100415682 218
197 3300025929 Ga0207664_10120307 Ga0207664_101203072 218
198 3300025931 Ga0207644_10961443 Ga0207644_109614431 218
199 3300025932 Ga0207690_10020295 Ga0207690_100202953 218
200 3300025941 Ga0207711_10041793 Ga0207711_100417934 218
201 3300025944 Ga0207661_10000005 Ga0207661_10000005403 218
202 3300025945 Ga0207679_10445735 Ga0207679_104457351 218
203 3300025949 Ga0207667_10074288 Ga0207667_100742884 218
204 3300025949 Ga0207667_10520194 Ga0207667_105201942 218
205 3300025960 Ga0207651_10448156 Ga0207651_104481561 218
206 3300025961 Ga0207712_10064193 Ga0207712_100641932 218
207 3300025981 Ga0207640_10000030 Ga0207640_1000003069 218
208 3300026035 Ga0207703_10004030 Ga0207703_100040306 218
209 3300026041 Ga0207639_10000363 Ga0207639_100003633 218
210 3300026041 Ga0207639_10089556 Ga0207639_100895562 218
211 3300026078 Ga0207702_10229900 Ga0207702_102299002 218
212 3300026078 Ga0207702_10270500 Ga0207702_102705001 218
213 3300026078 Ga0207702_10929382 Ga0207702_109293821 218
214 3300026088 Ga0207641_10163323 Ga0207641_101633233 218
215 3300026116 Ga0207674_10819234 Ga0207674_108192342 218
216 3300027512 Ga0209179_1036713 Ga0209179_10367132 218
217 3300027552 Ga0209982_1006765 Ga0209982_10067651 218
218 3300028379 Ga0268266_10051671 Ga0268266_100516712 218
219 3300028380 Ga0268265_10689708 Ga0268265_106897082 218
220 3300028381 Ga0268264_10008023 Ga0268264_100080233 218
221 3300028800 Ga0265338_10393789 Ga0265338_103937891 218
222 3300031090 Ga0265760_10034379 Ga0265760_100343792 218
223 3300031238 Ga0265332_10162212 Ga0265332_101622121 218
224 3300031249 Ga0265339_10009405 Ga0265339_100094053 218
225 3300035083 Ga0373926_0030657 Ga0373926_0030657_198_854 218
226 3300035084 Ga0373928_0089363 Ga0373928_0089363_85_744 218
227 3300035089 Ga0373944_0074389 Ga0373944_0074389_21_788 218
228 3300035113 Ga0373936_0173449 Ga0373936_0173449_216_872 218
229 3300035117 Ga0373953_0068471 Ga0373953_0068471_31_690 218
230 3300035118 Ga0373954_0000025 Ga0373954_0000025_34146_34805 218
231 3300035691 Ga0373931_0046924 Ga0373931_0046924_1566_2222 218
232 3300035692 Ga0373935_0067941 Ga0373935_0067941_1253_1993 218
233 3300035692 Ga0373935_0710373 Ga0373935_0710373_29_685 218
234 3300035695 Ga0373927_0097514 Ga0373927_0097514_1236_1895 218
235 3300035724 Ga0373933_0149985 Ga0373933_0149985_631_1290 218
236 3300035725 Ga0373947_0540440 Ga0373947_0540440_11_670 218
237 3300036401 Ga0373937_0001823 Ga0373937_0001823_8485_9144 218
238 3300036401 Ga0373937_0275544 Ga0373937_0275544_698_1438 218
239 3300036401 Ga0373937_0303686 Ga0373937_0303686_158_817 218
240 3300037068 Ga0373925_0067394 Ga0373925_0067394_1168_1908 218
241 3300037068 Ga0373925_0069329 Ga0373925_0069329_1902_2558 218
242 3300037068 Ga0373925_0599218 Ga0373925_0599218_228_887 218
243 3300038443 Ga0395901_0327961 Ga0395901_0327961_898_1560 218
244 3300039437 Ga0436365_0432212 Ga0436365_0432212_458_1117 218
245 3300039447 Ga0436361_0793823 Ga0436361_0793823_1416_2147 218
246 3300039450 Ga0436363_0029113 Ga0436363_0029113_389_1045 218
247 3300039453 Ga0436362_0416739 Ga0436362_0416739_1528_2184 218
248 3300039453 Ga0436362_1014264 Ga0436362_1014264_1912_2601 218
249 3300044656 Ga0466969_0013199 Ga0466969_0013199_2370_3029 218
250 3300044658 Ga0466972_0033145 Ga0466972_0033145_1838_2497 218
251 3300044684 Ga0466966_0009428 Ga0466966_0009428_3212_3871 218
252 3300044693 Ga0466961_0026909 Ga0466961_0026909_1899_2558 218
253 3300044706 Ga0466964_0003648 Ga0466964_0003648_2095_2754 218
254 3300044719 Ga0466971_0000160 Ga0466971_0000160_6895_7554 218
255 3300044765 Ga0466970_0000837 Ga0466970_0000837_9030_9689 218
256 3300044842 Ga0466957_0097690 Ga0466957_0097690_990_1649 218
257 3300045049 Ga0466959_0002175 Ga0466959_0002175_1552_2211 218
258 3300045049 Ga0466959_0019575 Ga0466959_0019575_3164_3823 218
259 3300046472 Ga0495580_0053066 Ga0495580_0053066_1987_2646 218
260 3300046517 Ga0495630_0532169 Ga0495630_0532169_212_871 218
261 3300046675 Ga0495657_0098911 Ga0495657_0098911_944_1603 218
262 3300048911 Ga0496108_0024282 Ga0496108_0024282_2793_3452 218
263 3300048915 Ga0496112_0021385 Ga0496112_0021385_574_1230 218
264 3300048915 Ga0496112_0277210 Ga0496112_0277210_356_1015 218
265 3300048916 Ga0496113_0718924 Ga0496113_0718924_64_720 218
266 3300048918 Ga0496115_0330795 Ga0496115_0330795_331_990 218
267 3300048924 Ga0496121_0005496 Ga0496121_0005496_5628_6287 218
268 3300048928 Ga0496125_0006536 Ga0496125_0006536_614_1273 218
269 3300048929 Ga0496126_0413231 Ga0496126_0413231_350_1006 218
270 3300049570 Ga0501033_0065843 Ga0501033_0065843_844_1515 218
271 3300049573 Ga0501037_0335933 Ga0501037_0335933_184_843 218
272 3300049575 Ga0501039_0156502 Ga0501039_0156502_225_884 218
273 3300049577 Ga0501041_0009999 Ga0501041_0009999_3297_3968 218
274 3300049578 Ga0501042_0072514 Ga0501042_0072514_1372_2031 218
275 3300049578 Ga0501042_0107427 Ga0501042_0107427_155_826 218
276 3300049579 Ga0501043_0313993 Ga0501043_0313993_278_937 218
277 3300049580 Ga0501046_0002713 Ga0501046_0002713_10777_11448 218
278 3300049580 Ga0501046_0310290 Ga0501046_0310290_206_868 218
279 3300049581 Ga0501047_0714790 Ga0501047_0714790_21_692 218
280 3300049582 Ga0501048_0094064 Ga0501048_0094064_1139_1798 218
281 3300049582 Ga0501048_0162400 Ga0501048_0162400_148_819 218
282 3300049584 Ga0501068_0098830 Ga0501068_0098830_900_1559 218
283 3300049587 Ga0501071_0084081 Ga0501071_0084081_300_959 218
284 3300049587 Ga0501071_0091958 Ga0501071_0091958_1372_2031 218
285 3300049588 Ga0501072_0073615 Ga0501072_0073615_1202_1861 218
286 3300049592 Ga0501076_0068431 Ga0501076_0068431_1158_1817 218
287 3300049593 Ga0501077_0019896 Ga0501077_0019896_1138_1797 218
288 3300049651 Ga0501201_008023 Ga0501201_008023_24_683 218
289 3300049741 Ga0501079_0537208 Ga0501079_0537208_44_703 218
290 3300049824 Ga0501045_0013254 Ga0501045_0013254_638_1309 218
291 3300049824 Ga0501045_0077155 Ga0501045_0077155_757_1416 218
292 3300050511 nmdc:mga08y16_389692_c1 nmdc:mga08y16_389692_c1_210_866 218
293 3300050512 nmdc:mga0n895_1948_c1 nmdc:mga0n895_1948_c1_13880_14539 218
294 3300050512 nmdc:mga0n895_224084_c1 nmdc:mga0n895_224084_c1_990_1646 218
295 3300050513 nmdc:mga0rr50_2277_c1 nmdc:mga0rr50_2277_c1_9031_9690 218
296 3300050514 nmdc:mga08x19_105395_c1 nmdc:mga08x19_105395_c1_1173_1832 218
297 3300050514 nmdc:mga08x19_194471_c1 nmdc:mga08x19_194471_c1_229_885 218
298 3300050515 nmdc:mga0a205_76164_c1 nmdc:mga0a205_76164_c1_1226_1885 218
299 3300059513 Ga0587094_023998 Ga0587094_023998_12_695 218
300 3300060353 Ga0501082_0005715 Ga0501082_0005715_4534_5205 218
301 3300061719 Ga0466962_0004576 Ga0466962_0004576_5815_6474 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

42

182

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

202

240

0.96

PF08534

Redoxin

Redoxin

41

200

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.941 3 216
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9406 3 216
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9361 3 216
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.932 3 216
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.918 3 213
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9733 153 215 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9688 153 213 3.30.1020.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9597 153 215 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9593 7 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9442 153 215 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A659YRX5-F1-model_v4 deleted 0.982 1 103
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.982 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3M6WLM4-F1-model_v4 Thioredoxin domain-containing protein 0.9817 1 112 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-C3KLK5-F1-model_v4 Peroxiredoxin 6 (EC 1.11.1.-) 0.9792 1 216 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9758 1 182 GO:0005829
GO:0045454
GO:0051920

Feature Viewer

pLDDT pTM Quality
91.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map