F396019
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 210 | 301 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300035089|Ga0373944_0074389|Ga0373944_0074389_21_788 |
| Length | 255 |
| Sequence | MFRVSTGTRKKQAGEAGGFCTAAPMRRRANPAQGGSTMSLRINDEAPNFTAETTQGKLNLHDWIGNGWAVLFSHPKDFTPVCTTELGYMAGLMPEFEKRNTKIIGLSVDPVGDHTRWSKDIEETQGHRVTYPLIGDPELKVAKLYDMLPAEAGDTSAGRTPANNATVRSVFVIGPDKKIKTMLTYPMTTGRNFDEVLRILDSVQLTAKHPVATPVNWKPGGDVIIAGSVSDEEAQKRYPGFRAPKPYLRYTAQPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 54 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 77 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 80 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 85 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 137 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 141 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 148 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 149 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 158 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 159 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 163 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 164 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 165 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 182 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 183 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 184 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 200 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.68 |
| Metatranscriptomes | 4.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.66 |
| Rhizosphere | 96.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1006739 | 3300000546 | Bacteria | 1245 |
| 2 | Ga0058863_11725926 | 3300004799 | Bacteria | 700 |
| 3 | Ga0070658_10006638 | 3300005327 | Bacteria | 9373 |
| 4 | Ga0070683_100000001 | 3300005329 | Bacteria | 529385 |
| 5 | Ga0068869_100039621 | 3300005334 | Bacteria | 3365 |
| 6 | Ga0070666_10071080 | 3300005335 | Bacteria | 2368 |
| 7 | Ga0070680_100283017 | 3300005336 | Bacteria | 1405 |
| 8 | Ga0068868_100727701 | 3300005338 | Bacteria | 890 |
| 9 | Ga0070660_100009054 | 3300005339 | Bacteria | 6986 |
| 10 | Ga0070689_100230220 | 3300005340 | Bacteria | 1523 |
| 11 | Ga0070675_100003759 | 3300005354 | Bacteria | 11527 |
| 12 | Ga0070673_100145502 | 3300005364 | Bacteria | 2003 |
| 13 | Ga0070673_100485489 | 3300005364 | Bacteria | 1116 |
| 14 | Ga0070659_100016387 | 3300005366 | Bacteria | 5564 |
| 15 | Ga0070659_100311784 | 3300005366 | Bacteria | 1314 |
| 16 | Ga0070709_10089344 | 3300005434 | Bacteria | 2028 |
| 17 | Ga0070714_100110330 | 3300005435 | Bacteria | 2435 |
| 18 | Ga0070714_100171495 | 3300005435 | Bacteria | 1969 |
| 19 | Ga0070714_100398307 | 3300005435 | Bacteria | 1301 |
| 20 | Ga0070713_100087695 | 3300005436 | Bacteria | 2670 |
| 21 | Ga0070713_100143395 | 3300005436 | Bacteria | 2118 |
| 22 | Ga0070713_100186607 | 3300005436 | Bacteria | 1866 |
| 23 | Ga0070710_10221998 | 3300005437 | Bacteria | 1203 |
| 24 | Ga0070711_100034153 | 3300005439 | Bacteria | 3391 |
| 25 | Ga0070711_100913939 | 3300005439 | Bacteria | 749 |
| 26 | Ga0070700_100103166 | 3300005441 | Bacteria | 1883 |
| 27 | Ga0070694_100008753 | 3300005444 | Bacteria | 6201 |
| 28 | Ga0070708_100000068 | 3300005445 | Bacteria | 68300 |
| 29 | Ga0070708_100030487 | 3300005445 | Bacteria | 4661 |
| 30 | Ga0070663_100124533 | 3300005455 | Bacteria | 1951 |
| 31 | Ga0070681_10003585 | 3300005458 | Bacteria | 14558 |
| 32 | Ga0070681_10041672 | 3300005458 | Bacteria | 4602 |
| 33 | Ga0070681_10201746 | 3300005458 | Bacteria | 1907 |
| 34 | Ga0070681_10571779 | 3300005458 | Bacteria | 1044 |
| 35 | Ga0070706_100002578 | 3300005467 | Bacteria | 18213 |
| 36 | Ga0070706_100064902 | 3300005467 | Bacteria | 3375 |
| 37 | Ga0070706_100198649 | 3300005467 | Bacteria | 1873 |
| 38 | Ga0070707_100000319 | 3300005468 | Bacteria | 47285 |
| 39 | Ga0070707_100019993 | 3300005468 | Bacteria | 6312 |
| 40 | Ga0070698_100000255 | 3300005471 | Bacteria | 53335 |
| 41 | Ga0070698_100004510 | 3300005471 | Bacteria | 15307 |
| 42 | Ga0070698_100024956 | 3300005471 | Bacteria | 6231 |
| 43 | Ga0070698_100025950 | 3300005471 | Bacteria | 6104 |
| 44 | Ga0070699_100001387 | 3300005518 | Bacteria | 22279 |
| 45 | Ga0070679_100321432 | 3300005530 | Bacteria | 1497 |
| 46 | Ga0070679_100502441 | 3300005530 | Bacteria | 1156 |
| 47 | Ga0070684_100000006 | 3300005535 | Bacteria | 227715 |
| 48 | Ga0070697_100002296 | 3300005536 | Bacteria | 14683 |
| 49 | Ga0070697_100165979 | 3300005536 | Bacteria | 1867 |
| 50 | Ga0070697_100490409 | 3300005536 | Bacteria | 1074 |
| 51 | Ga0070697_101081565 | 3300005536 | Bacteria | 714 |
| 52 | Ga0068853_100000105 | 3300005539 | Bacteria | 56438 |
| 53 | Ga0070672_100171470 | 3300005543 | Bacteria | 1805 |
| 54 | Ga0070686_100040735 | 3300005544 | Bacteria | 2899 |
| 55 | Ga0070665_100093590 | 3300005548 | Bacteria | 3010 |
| 56 | Ga0068855_100021374 | 3300005563 | Bacteria | 7760 |
| 57 | Ga0068855_100092152 | 3300005563 | Bacteria | 3495 |
| 58 | Ga0068855_100286822 | 3300005563 | Bacteria | 1826 |
| 59 | Ga0070664_100089249 | 3300005564 | Bacteria | 2667 |
| 60 | Ga0068854_100000022 | 3300005578 | Bacteria | 127908 |
| 61 | Ga0068856_100047530 | 3300005614 | Bacteria | 4227 |
| 62 | Ga0068856_100199980 | 3300005614 | Bacteria | 2013 |
| 63 | Ga0068856_100778507 | 3300005614 | Bacteria | 977 |
| 64 | Ga0068863_100000571 | 3300005841 | Bacteria | 37496 |
| 65 | Ga0068863_100003423 | 3300005841 | Bacteria | 15638 |
| 66 | Ga0068858_100000862 | 3300005842 | Bacteria | 31408 |
| 67 | Ga0068858_100250513 | 3300005842 | Bacteria | 1682 |
| 68 | Ga0068860_100095431 | 3300005843 | Bacteria | 2835 |
| 69 | Ga0070717_10270042 | 3300006028 | Bacteria | 1506 |
| 70 | Ga0070716_100100506 | 3300006173 | Bacteria | 1772 |
| 71 | Ga0070712_100044736 | 3300006175 | Bacteria | 3054 |
| 72 | Ga0070712_100121721 | 3300006175 | Bacteria | 1964 |
| 73 | Ga0097621_100011302 | 3300006237 | Bacteria | 6572 |
| 74 | Ga0068871_100346425 | 3300006358 | Bacteria | 1313 |
| 75 | Ga0075428_100087680 | 3300006844 | Bacteria | 3395 |
| 76 | Ga0075431_100744111 | 3300006847 | Bacteria | 956 |
| 77 | Ga0075433_10001006 | 3300006852 | Bacteria | 20056 |
| 78 | Ga0075434_100000206 | 3300006871 | Bacteria | 40043 |
| 79 | Ga0075434_100101261 | 3300006871 | Bacteria | 2887 |
| 80 | Ga0075434_100227743 | 3300006871 | Bacteria | 1883 |
| 81 | Ga0075436_100022339 | 3300006914 | Bacteria | 4345 |
| 82 | Ga0075435_100010935 | 3300007076 | Bacteria | 6650 |
| 83 | Ga0075435_100026568 | 3300007076 | Bacteria | 4519 |
| 84 | Ga0099795_10101529 | 3300007788 | Bacteria | 1129 |
| 85 | Ga0105250_10025289 | 3300009092 | Bacteria | 2393 |
| 86 | Ga0105240_10011542 | 3300009093 | Bacteria | 12297 |
| 87 | Ga0105240_10053440 | 3300009093 | Bacteria | 5070 |
| 88 | Ga0105240_10219566 | 3300009093 | Bacteria | 2215 |
| 89 | Ga0105240_10465321 | 3300009093 | Bacteria | 1412 |
| 90 | Ga0111539_10469312 | 3300009094 | Bacteria | 1465 |
| 91 | Ga0111539_10499738 | 3300009094 | Bacteria | 1416 |
| 92 | Ga0105247_10000970 | 3300009101 | Bacteria | 21642 |
| 93 | Ga0114129_10000398 | 3300009147 | Bacteria | 50789 |
| 94 | Ga0105242_10157635 | 3300009176 | Bacteria | 1984 |
| 95 | Ga0105248_10049633 | 3300009177 | Bacteria | 4707 |
| 96 | Ga0105248_10262899 | 3300009177 | Bacteria | 1942 |
| 97 | Ga0105237_10165549 | 3300009545 | Bacteria | 2210 |
| 98 | Ga0105238_10133860 | 3300009551 | Bacteria | 2457 |
| 99 | Ga0105249_10546211 | 3300009553 | Bacteria | 1209 |
| 100 | Ga0099796_10006992 | 3300010159 | Bacteria | 2923 |
| 101 | Ga0099796_10092142 | 3300010159 | Bacteria | 1128 |
| 102 | Ga0157370_10034311 | 3300013104 | Bacteria | 4942 |
| 103 | Ga0157370_10071417 | 3300013104 | Bacteria | 3275 |
| 104 | Ga0157369_10062225 | 3300013105 | Bacteria | 4022 |
| 105 | Ga0157369_10287843 | 3300013105 | Bacteria | 1711 |
| 106 | Ga0157374_10075351 | 3300013296 | Bacteria | 3188 |
| 107 | Ga0157374_10096020 | 3300013296 | Bacteria | 2835 |
| 108 | Ga0157374_10646424 | 3300013296 | Bacteria | 1069 |
| 109 | Ga0157378_10056666 | 3300013297 | Bacteria | 3492 |
| 110 | Ga0157378_10066672 | 3300013297 | Bacteria | 3224 |
| 111 | Ga0163162_10304083 | 3300013306 | Bacteria | 1727 |
| 112 | Ga0157372_10100521 | 3300013307 | Bacteria | 3300 |
| 113 | Ga0157375_10799966 | 3300013308 | Bacteria | 1092 |
| 114 | Ga0157380_10174378 | 3300014326 | Bacteria | 1882 |
| 115 | Ga0157377_10025326 | 3300014745 | Bacteria | 3163 |
| 116 | Ga0157379_10077595 | 3300014968 | Bacteria | 2974 |
| 117 | Ga0157376_10142277 | 3300014969 | Bacteria | 2153 |
| 118 | Ga0157376_10178898 | 3300014969 | Bacteria | 1937 |
| 119 | Ga0182007_10133318 | 3300015262 | Bacteria | 837 |
| 120 | Ga0197907_10456435 | 3300020069 | Bacteria | 1215 |
| 121 | Ga0206356_11109720 | 3300020070 | Bacteria | 1320 |
| 122 | Ga0206355_1311596 | 3300020076 | Bacteria | 1503 |
| 123 | Ga0206352_10594573 | 3300020078 | Bacteria | 862 |
| 124 | Ga0206350_11137683 | 3300020080 | Bacteria | 926 |
| 125 | Ga0206350_11151789 | 3300020080 | Bacteria | 826 |
| 126 | Ga0206354_11426302 | 3300020081 | Bacteria | 926 |
| 127 | Ga0154015_1182721 | 3300020610 | Bacteria | 849 |
| 128 | Ga0213873_10019473 | 3300021358 | Bacteria | 1575 |
| 129 | Ga0213873_10053945 | 3300021358 | Bacteria | 1072 |
| 130 | Ga0224712_10023508 | 3300022467 | Bacteria | 2141 |
| 131 | Ga0224712_10186194 | 3300022467 | Bacteria | 938 |
| 132 | Ga0207692_10159592 | 3300025898 | Bacteria | 1298 |
| 133 | Ga0207642_10020816 | 3300025899 | Bacteria | 2570 |
| 134 | Ga0207710_10002089 | 3300025900 | Bacteria | 9454 |
| 135 | Ga0207688_10041713 | 3300025901 | Bacteria | 2554 |
| 136 | Ga0207680_10210955 | 3300025903 | Bacteria | 1328 |
| 137 | Ga0207705_10111085 | 3300025909 | Bacteria | 2025 |
| 138 | Ga0207684_10000081 | 3300025910 | Bacteria | 178619 |
| 139 | Ga0207707_10010321 | 3300025912 | Bacteria | 8103 |
| 140 | Ga0207707_10011132 | 3300025912 | Bacteria | 7823 |
| 141 | Ga0207695_10007745 | 3300025913 | Bacteria | 13607 |
| 142 | Ga0207695_10054480 | 3300025913 | Bacteria | 4176 |
| 143 | Ga0207695_10073834 | 3300025913 | Bacteria | 3474 |
| 144 | Ga0207693_10039556 | 3300025915 | Bacteria | 3714 |
| 145 | Ga0207693_10055963 | 3300025915 | Bacteria | 3093 |
| 146 | Ga0207693_10257577 | 3300025915 | Bacteria | 1368 |
| 147 | Ga0207663_10098595 | 3300025916 | Bacteria | 1957 |
| 148 | Ga0207660_10223849 | 3300025917 | Bacteria | 1477 |
| 149 | Ga0207660_10327930 | 3300025917 | Bacteria | 1223 |
| 150 | Ga0207662_10167175 | 3300025918 | Bacteria | 1409 |
| 151 | Ga0207662_10592172 | 3300025918 | Bacteria | 771 |
| 152 | Ga0207657_10021819 | 3300025919 | Bacteria | 6016 |
| 153 | Ga0207652_10016813 | 3300025921 | Bacteria | 5978 |
| 154 | Ga0207646_10000591 | 3300025922 | Bacteria | 47189 |
| 155 | Ga0207646_10012265 | 3300025922 | Bacteria | 8244 |
| 156 | Ga0207694_10003660 | 3300025924 | Bacteria | 12167 |
| 157 | Ga0207694_10385240 | 3300025924 | Bacteria | 1164 |
| 158 | Ga0207659_10023997 | 3300025926 | Bacteria | 4080 |
| 159 | Ga0207687_10132501 | 3300025927 | Bacteria | 1881 |
| 160 | Ga0207700_10015272 | 3300025928 | Bacteria | 5058 |
| 161 | Ga0207700_10222382 | 3300025928 | Bacteria | 1601 |
| 162 | Ga0207700_10228822 | 3300025928 | Bacteria | 1580 |
| 163 | Ga0207700_10761678 | 3300025928 | Bacteria | 865 |
| 164 | Ga0207664_10041568 | 3300025929 | Bacteria | 3582 |
| 165 | Ga0207664_10120307 | 3300025929 | Bacteria | 2196 |
| 166 | Ga0207644_10961443 | 3300025931 | Bacteria | 716 |
| 167 | Ga0207690_10020295 | 3300025932 | Bacteria | 4104 |
| 168 | Ga0207670_10518313 | 3300025936 | Bacteria | 970 |
| 169 | Ga0207669_10238643 | 3300025937 | Bacteria | 1346 |
| 170 | Ga0207665_10136839 | 3300025939 | Bacteria | 1744 |
| 171 | Ga0207711_10041793 | 3300025941 | Bacteria | 3905 |
| 172 | Ga0207689_10052984 | 3300025942 | Bacteria | 3342 |
| 173 | Ga0207661_10000005 | 3300025944 | Bacteria | 557888 |
| 174 | Ga0207679_10445735 | 3300025945 | Bacteria | 1147 |
| 175 | Ga0207667_10074288 | 3300025949 | Bacteria | 3532 |
| 176 | Ga0207667_10520194 | 3300025949 | Bacteria | 1205 |
| 177 | Ga0207651_10113742 | 3300025960 | Bacteria | 2037 |
| 178 | Ga0207651_10448156 | 3300025960 | Bacteria | 1107 |
| 179 | Ga0207712_10064193 | 3300025961 | Bacteria | 2617 |
| 180 | Ga0207640_10000030 | 3300025981 | Bacteria | 127918 |
| 181 | Ga0207677_10405837 | 3300026023 | Bacteria | 1157 |
| 182 | Ga0207703_10004030 | 3300026035 | Bacteria | 12147 |
| 183 | Ga0207639_10000363 | 3300026041 | Bacteria | 31350 |
| 184 | Ga0207639_10089556 | 3300026041 | Bacteria | 2459 |
| 185 | Ga0207708_10646588 | 3300026075 | Bacteria | 900 |
| 186 | Ga0207702_10229900 | 3300026078 | Bacteria | 1733 |
| 187 | Ga0207702_10270500 | 3300026078 | Bacteria | 1603 |
| 188 | Ga0207702_10929382 | 3300026078 | Bacteria | 862 |
| 189 | Ga0207641_10000812 | 3300026088 | Bacteria | 33288 |
| 190 | Ga0207641_10163323 | 3300026088 | Bacteria | 2026 |
| 191 | Ga0207674_10819234 | 3300026116 | Bacteria | 898 |
| 192 | Ga0209179_1036713 | 3300027512 | Bacteria | 1022 |
| 193 | Ga0209999_1031327 | 3300027543 | Bacteria | 987 |
| 194 | Ga0209982_1006765 | 3300027552 | Bacteria | 1671 |
| 195 | Ga0268266_10051671 | 3300028379 | Bacteria | 3528 |
| 196 | Ga0268265_10689708 | 3300028380 | Bacteria | 986 |
| 197 | Ga0268264_10008023 | 3300028381 | Bacteria | 8779 |
| 198 | Ga0268264_10067865 | 3300028381 | Bacteria | 3011 |
| 199 | Ga0268264_10327263 | 3300028381 | Bacteria | 1451 |
| 200 | Ga0265338_10022550 | 3300028800 | Bacteria | 6512 |
| 201 | Ga0265338_10393789 | 3300028800 | Bacteria | 988 |
| 202 | Ga0265760_10034379 | 3300031090 | Bacteria | 1499 |
| 203 | Ga0265332_10162212 | 3300031238 | Bacteria | 934 |
| 204 | Ga0265325_10162512 | 3300031241 | Bacteria | 1050 |
| 205 | Ga0265339_10000653 | 3300031249 | Bacteria | 26815 |
| 206 | Ga0265339_10009405 | 3300031249 | Bacteria | 6145 |
| 207 | Ga0265316_10002226 | 3300031344 | Bacteria | 20351 |
| 208 | Ga0265314_10001261 | 3300031711 | Bacteria | 28854 |
| 209 | Ga0373926_0030657 | 3300035083 | Bacteria | 1894 |
| 210 | Ga0373928_0089363 | 3300035084 | Bacteria | 789 |
| 211 | Ga0373944_0074389 | 3300035089 | Bacteria | 1112 |
| 212 | Ga0373936_0173449 | 3300035113 | Bacteria | 944 |
| 213 | Ga0373953_0068471 | 3300035117 | Bacteria | 1461 |
| 214 | Ga0373954_0000025 | 3300035118 | Bacteria | 57365 |
| 215 | Ga0373931_0046924 | 3300035691 | Bacteria | 2285 |
| 216 | Ga0373935_0067941 | 3300035692 | Bacteria | 2293 |
| 217 | Ga0373935_0710373 | 3300035692 | Bacteria | 739 |
| 218 | Ga0373927_0097514 | 3300035695 | Bacteria | 1911 |
| 219 | Ga0373933_0149985 | 3300035724 | Bacteria | 1476 |
| 220 | Ga0373947_0037531 | 3300035725 | Bacteria | 2875 |
| 221 | Ga0373947_0540440 | 3300035725 | Bacteria | 793 |
| 222 | Ga0373937_0001823 | 3300036401 | Bacteria | 17875 |
| 223 | Ga0373937_0275544 | 3300036401 | Bacteria | 1588 |
| 224 | Ga0373937_0303686 | 3300036401 | Bacteria | 1509 |
| 225 | Ga0373925_0067394 | 3300037068 | Bacteria | 2699 |
| 226 | Ga0373925_0069329 | 3300037068 | Bacteria | 2663 |
| 227 | Ga0373925_0599218 | 3300037068 | Bacteria | 907 |
| 228 | Ga0395901_0327961 | 3300038443 | Bacteria | 1583 |
| 229 | Ga0436365_0432212 | 3300039437 | Bacteria | 1293 |
| 230 | Ga0436361_0793823 | 3300039447 | Bacteria | 2280 |
| 231 | Ga0436363_0029113 | 3300039450 | Bacteria | 1218 |
| 232 | Ga0436362_0416739 | 3300039453 | Bacteria | 4120 |
| 233 | Ga0436362_1014264 | 3300039453 | Bacteria | 2896 |
| 234 | Ga0466969_0013199 | 3300044656 | Bacteria | 4352 |
| 235 | Ga0466972_0033145 | 3300044658 | Bacteria | 2534 |
| 236 | Ga0466966_0009428 | 3300044684 | Bacteria | 6465 |
| 237 | Ga0466961_0026909 | 3300044693 | Bacteria | 3698 |
| 238 | Ga0466963_0005734 | 3300044694 | Bacteria | 7303 |
| 239 | Ga0466964_0003648 | 3300044706 | Bacteria | 5627 |
| 240 | Ga0466971_0000160 | 3300044719 | Bacteria | 25173 |
| 241 | Ga0466970_0000837 | 3300044765 | Bacteria | 14804 |
| 242 | Ga0466957_0097690 | 3300044842 | Bacteria | 1847 |
| 243 | Ga0466959_0002175 | 3300045049 | Bacteria | 12469 |
| 244 | Ga0466959_0019575 | 3300045049 | Bacteria | 4978 |
| 245 | Ga0495641_0056159 | 3300046461 | Bacteria | 1785 |
| 246 | Ga0495651_0122215 | 3300046462 | Bacteria | 1911 |
| 247 | Ga0495580_0000638 | 3300046472 | Bacteria | 29751 |
| 248 | Ga0495580_0053066 | 3300046472 | Bacteria | 2862 |
| 249 | Ga0495582_0001345 | 3300046473 | Bacteria | 13807 |
| 250 | Ga0495582_0020678 | 3300046473 | Bacteria | 3603 |
| 251 | Ga0495630_0532169 | 3300046517 | Bacteria | 901 |
| 252 | Ga0495622_0233864 | 3300046557 | Bacteria | 811 |
| 253 | Ga0495657_0098911 | 3300046675 | Bacteria | 1861 |
| 254 | Ga0495658_0039903 | 3300046683 | Bacteria | 2608 |
| 255 | Ga0496108_0024282 | 3300048911 | Bacteria | 4991 |
| 256 | Ga0496112_0021385 | 3300048915 | Bacteria | 6152 |
| 257 | Ga0496112_0277210 | 3300048915 | Bacteria | 1624 |
| 258 | Ga0496113_0718924 | 3300048916 | Bacteria | 796 |
| 259 | Ga0496115_0330795 | 3300048918 | Bacteria | 1245 |
| 260 | Ga0496121_0005496 | 3300048924 | Bacteria | 16226 |
| 261 | Ga0496124_0023594 | 3300048927 | Bacteria | 5613 |
| 262 | Ga0496125_0006536 | 3300048928 | Bacteria | 12563 |
| 263 | Ga0496126_0413231 | 3300048929 | Bacteria | 1092 |
| 264 | Ga0501033_0065843 | 3300049570 | Bacteria | 2665 |
| 265 | Ga0501037_0335933 | 3300049573 | Bacteria | 1044 |
| 266 | Ga0501039_0156502 | 3300049575 | Bacteria | 1790 |
| 267 | Ga0501041_0009999 | 3300049577 | Bacteria | 5590 |
| 268 | Ga0501042_0072514 | 3300049578 | Bacteria | 2464 |
| 269 | Ga0501042_0107427 | 3300049578 | Bacteria | 2009 |
| 270 | Ga0501043_0313993 | 3300049579 | Bacteria | 1196 |
| 271 | Ga0501046_0002713 | 3300049580 | Bacteria | 16476 |
| 272 | Ga0501046_0310290 | 3300049580 | Bacteria | 1151 |
| 273 | Ga0501047_0714790 | 3300049581 | Bacteria | 819 |
| 274 | Ga0501048_0094064 | 3300049582 | Bacteria | 2114 |
| 275 | Ga0501048_0162400 | 3300049582 | Bacteria | 1581 |
| 276 | Ga0501067_0055236 | 3300049583 | Bacteria | 2201 |
| 277 | Ga0501068_0098830 | 3300049584 | Bacteria | 1808 |
| 278 | Ga0501071_0084081 | 3300049587 | Bacteria | 2332 |
| 279 | Ga0501071_0091958 | 3300049587 | Bacteria | 2229 |
| 280 | Ga0501072_0073615 | 3300049588 | Bacteria | 2700 |
| 281 | Ga0501076_0068431 | 3300049592 | Bacteria | 2836 |
| 282 | Ga0501077_0019896 | 3300049593 | Bacteria | 4247 |
| 283 | Ga0501201_008023 | 3300049651 | Bacteria | 1015 |
| 284 | Ga0501079_0537208 | 3300049741 | Bacteria | 919 |
| 285 | Ga0501045_0013254 | 3300049824 | Bacteria | 5818 |
| 286 | Ga0501045_0077155 | 3300049824 | Bacteria | 2455 |
| 287 | nmdc:mga05p37_377_c1 | 3300050507 | Bacteria | 48005 |
| 288 | nmdc:mga08y16_389692_c1 | 3300050511 | Bacteria | 1427 |
| 289 | nmdc:mga08y16_617830_c1 | 3300050511 | Bacteria | 1091 |
| 290 | nmdc:mga0n895_1948_c1 | 3300050512 | Bacteria | 15852 |
| 291 | nmdc:mga0n895_224084_c1 | 3300050512 | Bacteria | 1908 |
| 292 | nmdc:mga0n895_45083_c1 | 3300050512 | Bacteria | 4302 |
| 293 | nmdc:mga0n895_516265_c1 | 3300050512 | Bacteria | 1203 |
| 294 | nmdc:mga0rr50_2277_c1 | 3300050513 | Bacteria | 10765 |
| 295 | nmdc:mga0rr50_6079_c1 | 3300050513 | Bacteria | 7296 |
| 296 | nmdc:mga08x19_105395_c1 | 3300050514 | Bacteria | 1875 |
| 297 | nmdc:mga08x19_194471_c1 | 3300050514 | Bacteria | 1389 |
| 298 | nmdc:mga0a205_76164_c1 | 3300050515 | Bacteria | 3242 |
| 299 | Ga0587094_023998 | 3300059513 | Bacteria | 906 |
| 300 | Ga0501082_0005715 | 3300060353 | Bacteria | 10788 |
| 301 | Ga0466962_0004576 | 3300061719 | Bacteria | 6640 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10022550 | Ga0265338_100225504 | 204 |
| 2 | 3300031241 | Ga0265325_10162512 | Ga0265325_101625122 | 204 |
| 3 | 3300031249 | Ga0265339_10000653 | Ga0265339_1000065316 | 204 |
| 4 | 3300031344 | Ga0265316_10002226 | Ga0265316_100022263 | 204 |
| 5 | 3300031711 | Ga0265314_10001261 | Ga0265314_100012617 | 204 |
| 6 | 3300026075 | Ga0207708_10646588 | Ga0207708_106465881 | 205 |
| 7 | 3300044694 | Ga0466963_0005734 | Ga0466963_0005734_1149_1805 | 206 |
| 8 | 3300049583 | Ga0501067_0055236 | Ga0501067_0055236_1533_2156 | 206 |
| 9 | 3300014969 | Ga0157376_10178898 | Ga0157376_101788982 | 210 |
| 10 | 3300025918 | Ga0207662_10167175 | Ga0207662_101671751 | 210 |
| 11 | 3300046462 | Ga0495651_0122215 | Ga0495651_0122215_22_669 | 213 |
| 12 | 3300004799 | Ga0058863_11725926 | Ga0058863_117259261 | 216 |
| 13 | 3300005334 | Ga0068869_100039621 | Ga0068869_1000396212 | 216 |
| 14 | 3300005338 | Ga0068868_100727701 | Ga0068868_1007277011 | 216 |
| 15 | 3300005354 | Ga0070675_100003759 | Ga0070675_1000037596 | 216 |
| 16 | 3300005364 | Ga0070673_100145502 | Ga0070673_1001455024 | 216 |
| 17 | 3300005364 | Ga0070673_100485489 | Ga0070673_1004854892 | 216 |
| 18 | 3300005441 | Ga0070700_100103166 | Ga0070700_1001031664 | 216 |
| 19 | 3300005543 | Ga0070672_100171470 | Ga0070672_1001714703 | 216 |
| 20 | 3300014745 | Ga0157377_10025326 | Ga0157377_100253264 | 216 |
| 21 | 3300025901 | Ga0207688_10041713 | Ga0207688_100417133 | 216 |
| 22 | 3300025918 | Ga0207662_10592172 | Ga0207662_105921721 | 216 |
| 23 | 3300025926 | Ga0207659_10023997 | Ga0207659_100239972 | 216 |
| 24 | 3300025936 | Ga0207670_10518313 | Ga0207670_105183132 | 216 |
| 25 | 3300025937 | Ga0207669_10238643 | Ga0207669_102386431 | 216 |
| 26 | 3300025942 | Ga0207689_10052984 | Ga0207689_100529844 | 216 |
| 27 | 3300025960 | Ga0207651_10113742 | Ga0207651_101137421 | 216 |
| 28 | 3300026023 | Ga0207677_10405837 | Ga0207677_104058372 | 216 |
| 29 | 3300027543 | Ga0209999_1031327 | Ga0209999_10313272 | 216 |
| 30 | 3300035725 | Ga0373947_0037531 | Ga0373947_0037531_347_1081 | 216 |
| 31 | 3300046473 | Ga0495582_0020678 | Ga0495582_0020678_717_1409 | 216 |
| 32 | 3300046683 | Ga0495658_0039903 | Ga0495658_0039903_643_1335 | 216 |
| 33 | 3300048927 | Ga0496124_0023594 | Ga0496124_0023594_2810_3472 | 216 |
| 34 | 3300050511 | nmdc:mga08y16_617830_c1 | nmdc:mga08y16_617830_c1_251_904 | 216 |
| 35 | 3300005444 | Ga0070694_100008753 | Ga0070694_1000087533 | 217 |
| 36 | 3300005467 | Ga0070706_100064902 | Ga0070706_1000649021 | 217 |
| 37 | 3300005471 | Ga0070698_100004510 | Ga0070698_1000045107 | 217 |
| 38 | 3300005471 | Ga0070698_100024956 | Ga0070698_1000249562 | 217 |
| 39 | 3300005471 | Ga0070698_100025950 | Ga0070698_1000259504 | 217 |
| 40 | 3300005536 | Ga0070697_100165979 | Ga0070697_1001659791 | 217 |
| 41 | 3300005536 | Ga0070697_100490409 | Ga0070697_1004904091 | 217 |
| 42 | 3300005841 | Ga0068863_100000571 | Ga0068863_10000057120 | 217 |
| 43 | 3300005842 | Ga0068858_100250513 | Ga0068858_1002505132 | 217 |
| 44 | 3300005843 | Ga0068860_100095431 | Ga0068860_1000954312 | 217 |
| 45 | 3300006175 | Ga0070712_100044736 | Ga0070712_1000447362 | 217 |
| 46 | 3300006175 | Ga0070712_100121721 | Ga0070712_1001217212 | 217 |
| 47 | 3300006871 | Ga0075434_100101261 | Ga0075434_1001012612 | 217 |
| 48 | 3300006871 | Ga0075434_100227743 | Ga0075434_1002277432 | 217 |
| 49 | 3300007076 | Ga0075435_100026568 | Ga0075435_1000265683 | 217 |
| 50 | 3300009147 | Ga0114129_10000398 | Ga0114129_100003987 | 217 |
| 51 | 3300013297 | Ga0157378_10056666 | Ga0157378_100566663 | 217 |
| 52 | 3300013297 | Ga0157378_10066672 | Ga0157378_100666723 | 217 |
| 53 | 3300013308 | Ga0157375_10799966 | Ga0157375_107999661 | 217 |
| 54 | 3300014968 | Ga0157379_10077595 | Ga0157379_100775954 | 217 |
| 55 | 3300025939 | Ga0207665_10136839 | Ga0207665_101368391 | 217 |
| 56 | 3300026088 | Ga0207641_10000812 | Ga0207641_1000081213 | 217 |
| 57 | 3300028381 | Ga0268264_10067865 | Ga0268264_100678652 | 217 |
| 58 | 3300028381 | Ga0268264_10327263 | Ga0268264_103272633 | 217 |
| 59 | 3300046461 | Ga0495641_0056159 | Ga0495641_0056159_948_1604 | 217 |
| 60 | 3300046472 | Ga0495580_0000638 | Ga0495580_0000638_20593_21249 | 217 |
| 61 | 3300046473 | Ga0495582_0001345 | Ga0495582_0001345_378_1034 | 217 |
| 62 | 3300046557 | Ga0495622_0233864 | Ga0495622_0233864_108_764 | 217 |
| 63 | 3300050507 | nmdc:mga05p37_377_c1 | nmdc:mga05p37_377_c1_8053_8715 | 217 |
| 64 | 3300050512 | nmdc:mga0n895_45083_c1 | nmdc:mga0n895_45083_c1_2730_3386 | 217 |
| 65 | 3300050512 | nmdc:mga0n895_516265_c1 | nmdc:mga0n895_516265_c1_297_953 | 217 |
| 66 | 3300050513 | nmdc:mga0rr50_6079_c1 | nmdc:mga0rr50_6079_c1_2452_3108 | 217 |
| 67 | 3300000546 | LJNas_1006739 | LJNas_10067391 | 218 |
| 68 | 3300005327 | Ga0070658_10006638 | Ga0070658_100066387 | 218 |
| 69 | 3300005329 | Ga0070683_100000001 | Ga0070683_100000001386 | 218 |
| 70 | 3300005335 | Ga0070666_10071080 | Ga0070666_100710803 | 218 |
| 71 | 3300005336 | Ga0070680_100283017 | Ga0070680_1002830172 | 218 |
| 72 | 3300005339 | Ga0070660_100009054 | Ga0070660_1000090543 | 218 |
| 73 | 3300005340 | Ga0070689_100230220 | Ga0070689_1002302202 | 218 |
| 74 | 3300005366 | Ga0070659_100016387 | Ga0070659_1000163874 | 218 |
| 75 | 3300005366 | Ga0070659_100311784 | Ga0070659_1003117842 | 218 |
| 76 | 3300005434 | Ga0070709_10089344 | Ga0070709_100893442 | 218 |
| 77 | 3300005435 | Ga0070714_100110330 | Ga0070714_1001103302 | 218 |
| 78 | 3300005435 | Ga0070714_100171495 | Ga0070714_1001714952 | 218 |
| 79 | 3300005435 | Ga0070714_100398307 | Ga0070714_1003983072 | 218 |
| 80 | 3300005436 | Ga0070713_100087695 | Ga0070713_1000876952 | 218 |
| 81 | 3300005436 | Ga0070713_100143395 | Ga0070713_1001433952 | 218 |
| 82 | 3300005436 | Ga0070713_100186607 | Ga0070713_1001866072 | 218 |
| 83 | 3300005437 | Ga0070710_10221998 | Ga0070710_102219982 | 218 |
| 84 | 3300005439 | Ga0070711_100034153 | Ga0070711_1000341531 | 218 |
| 85 | 3300005439 | Ga0070711_100913939 | Ga0070711_1009139391 | 218 |
| 86 | 3300005445 | Ga0070708_100000068 | Ga0070708_10000006847 | 218 |
| 87 | 3300005445 | Ga0070708_100030487 | Ga0070708_1000304874 | 218 |
| 88 | 3300005455 | Ga0070663_100124533 | Ga0070663_1001245333 | 218 |
| 89 | 3300005458 | Ga0070681_10003585 | Ga0070681_100035858 | 218 |
| 90 | 3300005458 | Ga0070681_10041672 | Ga0070681_100416723 | 218 |
| 91 | 3300005458 | Ga0070681_10201746 | Ga0070681_102017462 | 218 |
| 92 | 3300005458 | Ga0070681_10571779 | Ga0070681_105717791 | 218 |
| 93 | 3300005467 | Ga0070706_100002578 | Ga0070706_1000025784 | 218 |
| 94 | 3300005467 | Ga0070706_100198649 | Ga0070706_1001986492 | 218 |
| 95 | 3300005468 | Ga0070707_100000319 | Ga0070707_10000031924 | 218 |
| 96 | 3300005468 | Ga0070707_100019993 | Ga0070707_1000199933 | 218 |
| 97 | 3300005471 | Ga0070698_100000255 | Ga0070698_1000002557 | 218 |
| 98 | 3300005518 | Ga0070699_100001387 | Ga0070699_1000013877 | 218 |
| 99 | 3300005530 | Ga0070679_100321432 | Ga0070679_1003214322 | 218 |
| 100 | 3300005530 | Ga0070679_100502441 | Ga0070679_1005024412 | 218 |
| 101 | 3300005535 | Ga0070684_100000006 | Ga0070684_100000006183 | 218 |
| 102 | 3300005536 | Ga0070697_100002296 | Ga0070697_1000022964 | 218 |
| 103 | 3300005536 | Ga0070697_101081565 | Ga0070697_1010815651 | 218 |
| 104 | 3300005539 | Ga0068853_100000105 | Ga0068853_10000010543 | 218 |
| 105 | 3300005544 | Ga0070686_100040735 | Ga0070686_1000407354 | 218 |
| 106 | 3300005548 | Ga0070665_100093590 | Ga0070665_1000935903 | 218 |
| 107 | 3300005563 | Ga0068855_100021374 | Ga0068855_1000213742 | 218 |
| 108 | 3300005563 | Ga0068855_100092152 | Ga0068855_1000921524 | 218 |
| 109 | 3300005563 | Ga0068855_100286822 | Ga0068855_1002868222 | 218 |
| 110 | 3300005564 | Ga0070664_100089249 | Ga0070664_1000892492 | 218 |
| 111 | 3300005578 | Ga0068854_100000022 | Ga0068854_10000002241 | 218 |
| 112 | 3300005614 | Ga0068856_100047530 | Ga0068856_1000475302 | 218 |
| 113 | 3300005614 | Ga0068856_100199980 | Ga0068856_1001999801 | 218 |
| 114 | 3300005614 | Ga0068856_100778507 | Ga0068856_1007785072 | 218 |
| 115 | 3300005841 | Ga0068863_100003423 | Ga0068863_10000342314 | 218 |
| 116 | 3300005842 | Ga0068858_100000862 | Ga0068858_1000008624 | 218 |
| 117 | 3300006028 | Ga0070717_10270042 | Ga0070717_102700422 | 218 |
| 118 | 3300006173 | Ga0070716_100100506 | Ga0070716_1001005061 | 218 |
| 119 | 3300006237 | Ga0097621_100011302 | Ga0097621_1000113028 | 218 |
| 120 | 3300006358 | Ga0068871_100346425 | Ga0068871_1003464252 | 218 |
| 121 | 3300006844 | Ga0075428_100087680 | Ga0075428_1000876803 | 218 |
| 122 | 3300006847 | Ga0075431_100744111 | Ga0075431_1007441111 | 218 |
| 123 | 3300006852 | Ga0075433_10001006 | Ga0075433_100010063 | 218 |
| 124 | 3300006871 | Ga0075434_100000206 | Ga0075434_10000020638 | 218 |
| 125 | 3300006914 | Ga0075436_100022339 | Ga0075436_1000223395 | 218 |
| 126 | 3300007076 | Ga0075435_100010935 | Ga0075435_1000109356 | 218 |
| 127 | 3300007788 | Ga0099795_10101529 | Ga0099795_101015292 | 218 |
| 128 | 3300009092 | Ga0105250_10025289 | Ga0105250_100252892 | 218 |
| 129 | 3300009093 | Ga0105240_10011542 | Ga0105240_100115426 | 218 |
| 130 | 3300009093 | Ga0105240_10053440 | Ga0105240_100534403 | 218 |
| 131 | 3300009093 | Ga0105240_10219566 | Ga0105240_102195661 | 218 |
| 132 | 3300009093 | Ga0105240_10465321 | Ga0105240_104653211 | 218 |
| 133 | 3300009094 | Ga0111539_10469312 | Ga0111539_104693122 | 218 |
| 134 | 3300009094 | Ga0111539_10499738 | Ga0111539_104997382 | 218 |
| 135 | 3300009101 | Ga0105247_10000970 | Ga0105247_100009704 | 218 |
| 136 | 3300009176 | Ga0105242_10157635 | Ga0105242_101576352 | 218 |
| 137 | 3300009177 | Ga0105248_10049633 | Ga0105248_100496332 | 218 |
| 138 | 3300009177 | Ga0105248_10262899 | Ga0105248_102628992 | 218 |
| 139 | 3300009545 | Ga0105237_10165549 | Ga0105237_101655492 | 218 |
| 140 | 3300009551 | Ga0105238_10133860 | Ga0105238_101338603 | 218 |
| 141 | 3300009553 | Ga0105249_10546211 | Ga0105249_105462111 | 218 |
| 142 | 3300010159 | Ga0099796_10006992 | Ga0099796_100069922 | 218 |
| 143 | 3300010159 | Ga0099796_10092142 | Ga0099796_100921421 | 218 |
| 144 | 3300013104 | Ga0157370_10034311 | Ga0157370_100343112 | 218 |
| 145 | 3300013104 | Ga0157370_10071417 | Ga0157370_100714172 | 218 |
| 146 | 3300013105 | Ga0157369_10062225 | Ga0157369_100622251 | 218 |
| 147 | 3300013105 | Ga0157369_10287843 | Ga0157369_102878432 | 218 |
| 148 | 3300013296 | Ga0157374_10075351 | Ga0157374_100753514 | 218 |
| 149 | 3300013296 | Ga0157374_10096020 | Ga0157374_100960202 | 218 |
| 150 | 3300013296 | Ga0157374_10646424 | Ga0157374_106464242 | 218 |
| 151 | 3300013306 | Ga0163162_10304083 | Ga0163162_103040832 | 218 |
| 152 | 3300013307 | Ga0157372_10100521 | Ga0157372_101005214 | 218 |
| 153 | 3300014326 | Ga0157380_10174378 | Ga0157380_101743784 | 218 |
| 154 | 3300014969 | Ga0157376_10142277 | Ga0157376_101422772 | 218 |
| 155 | 3300015262 | Ga0182007_10133318 | Ga0182007_101333181 | 218 |
| 156 | 3300020069 | Ga0197907_10456435 | Ga0197907_104564351 | 218 |
| 157 | 3300020070 | Ga0206356_11109720 | Ga0206356_111097201 | 218 |
| 158 | 3300020076 | Ga0206355_1311596 | Ga0206355_13115962 | 218 |
| 159 | 3300020078 | Ga0206352_10594573 | Ga0206352_105945731 | 218 |
| 160 | 3300020080 | Ga0206350_11137683 | Ga0206350_111376831 | 218 |
| 161 | 3300020080 | Ga0206350_11151789 | Ga0206350_111517891 | 218 |
| 162 | 3300020081 | Ga0206354_11426302 | Ga0206354_114263021 | 218 |
| 163 | 3300020610 | Ga0154015_1182721 | Ga0154015_11827211 | 218 |
| 164 | 3300021358 | Ga0213873_10019473 | Ga0213873_100194732 | 218 |
| 165 | 3300021358 | Ga0213873_10053945 | Ga0213873_100539452 | 218 |
| 166 | 3300022467 | Ga0224712_10023508 | Ga0224712_100235082 | 218 |
| 167 | 3300022467 | Ga0224712_10186194 | Ga0224712_101861942 | 218 |
| 168 | 3300025898 | Ga0207692_10159592 | Ga0207692_101595922 | 218 |
| 169 | 3300025899 | Ga0207642_10020816 | Ga0207642_100208161 | 218 |
| 170 | 3300025900 | Ga0207710_10002089 | Ga0207710_100020894 | 218 |
| 171 | 3300025903 | Ga0207680_10210955 | Ga0207680_102109552 | 218 |
| 172 | 3300025909 | Ga0207705_10111085 | Ga0207705_101110852 | 218 |
| 173 | 3300025910 | Ga0207684_10000081 | Ga0207684_1000008170 | 218 |
| 174 | 3300025912 | Ga0207707_10010321 | Ga0207707_100103216 | 218 |
| 175 | 3300025912 | Ga0207707_10011132 | Ga0207707_100111324 | 218 |
| 176 | 3300025913 | Ga0207695_10007745 | Ga0207695_100077454 | 218 |
| 177 | 3300025913 | Ga0207695_10054480 | Ga0207695_100544804 | 218 |
| 178 | 3300025913 | Ga0207695_10073834 | Ga0207695_100738342 | 218 |
| 179 | 3300025915 | Ga0207693_10039556 | Ga0207693_100395564 | 218 |
| 180 | 3300025915 | Ga0207693_10055963 | Ga0207693_100559632 | 218 |
| 181 | 3300025915 | Ga0207693_10257577 | Ga0207693_102575772 | 218 |
| 182 | 3300025916 | Ga0207663_10098595 | Ga0207663_100985951 | 218 |
| 183 | 3300025917 | Ga0207660_10223849 | Ga0207660_102238491 | 218 |
| 184 | 3300025917 | Ga0207660_10327930 | Ga0207660_103279302 | 218 |
| 185 | 3300025919 | Ga0207657_10021819 | Ga0207657_100218193 | 218 |
| 186 | 3300025921 | Ga0207652_10016813 | Ga0207652_100168135 | 218 |
| 187 | 3300025922 | Ga0207646_10000591 | Ga0207646_1000059124 | 218 |
| 188 | 3300025922 | Ga0207646_10012265 | Ga0207646_100122655 | 218 |
| 189 | 3300025924 | Ga0207694_10003660 | Ga0207694_100036604 | 218 |
| 190 | 3300025924 | Ga0207694_10385240 | Ga0207694_103852402 | 218 |
| 191 | 3300025927 | Ga0207687_10132501 | Ga0207687_101325012 | 218 |
| 192 | 3300025928 | Ga0207700_10015272 | Ga0207700_100152722 | 218 |
| 193 | 3300025928 | Ga0207700_10222382 | Ga0207700_102223822 | 218 |
| 194 | 3300025928 | Ga0207700_10228822 | Ga0207700_102288221 | 218 |
| 195 | 3300025928 | Ga0207700_10761678 | Ga0207700_107616781 | 218 |
| 196 | 3300025929 | Ga0207664_10041568 | Ga0207664_100415682 | 218 |
| 197 | 3300025929 | Ga0207664_10120307 | Ga0207664_101203072 | 218 |
| 198 | 3300025931 | Ga0207644_10961443 | Ga0207644_109614431 | 218 |
| 199 | 3300025932 | Ga0207690_10020295 | Ga0207690_100202953 | 218 |
| 200 | 3300025941 | Ga0207711_10041793 | Ga0207711_100417934 | 218 |
| 201 | 3300025944 | Ga0207661_10000005 | Ga0207661_10000005403 | 218 |
| 202 | 3300025945 | Ga0207679_10445735 | Ga0207679_104457351 | 218 |
| 203 | 3300025949 | Ga0207667_10074288 | Ga0207667_100742884 | 218 |
| 204 | 3300025949 | Ga0207667_10520194 | Ga0207667_105201942 | 218 |
| 205 | 3300025960 | Ga0207651_10448156 | Ga0207651_104481561 | 218 |
| 206 | 3300025961 | Ga0207712_10064193 | Ga0207712_100641932 | 218 |
| 207 | 3300025981 | Ga0207640_10000030 | Ga0207640_1000003069 | 218 |
| 208 | 3300026035 | Ga0207703_10004030 | Ga0207703_100040306 | 218 |
| 209 | 3300026041 | Ga0207639_10000363 | Ga0207639_100003633 | 218 |
| 210 | 3300026041 | Ga0207639_10089556 | Ga0207639_100895562 | 218 |
| 211 | 3300026078 | Ga0207702_10229900 | Ga0207702_102299002 | 218 |
| 212 | 3300026078 | Ga0207702_10270500 | Ga0207702_102705001 | 218 |
| 213 | 3300026078 | Ga0207702_10929382 | Ga0207702_109293821 | 218 |
| 214 | 3300026088 | Ga0207641_10163323 | Ga0207641_101633233 | 218 |
| 215 | 3300026116 | Ga0207674_10819234 | Ga0207674_108192342 | 218 |
| 216 | 3300027512 | Ga0209179_1036713 | Ga0209179_10367132 | 218 |
| 217 | 3300027552 | Ga0209982_1006765 | Ga0209982_10067651 | 218 |
| 218 | 3300028379 | Ga0268266_10051671 | Ga0268266_100516712 | 218 |
| 219 | 3300028380 | Ga0268265_10689708 | Ga0268265_106897082 | 218 |
| 220 | 3300028381 | Ga0268264_10008023 | Ga0268264_100080233 | 218 |
| 221 | 3300028800 | Ga0265338_10393789 | Ga0265338_103937891 | 218 |
| 222 | 3300031090 | Ga0265760_10034379 | Ga0265760_100343792 | 218 |
| 223 | 3300031238 | Ga0265332_10162212 | Ga0265332_101622121 | 218 |
| 224 | 3300031249 | Ga0265339_10009405 | Ga0265339_100094053 | 218 |
| 225 | 3300035083 | Ga0373926_0030657 | Ga0373926_0030657_198_854 | 218 |
| 226 | 3300035084 | Ga0373928_0089363 | Ga0373928_0089363_85_744 | 218 |
| 227 | 3300035089 | Ga0373944_0074389 | Ga0373944_0074389_21_788 | 218 |
| 228 | 3300035113 | Ga0373936_0173449 | Ga0373936_0173449_216_872 | 218 |
| 229 | 3300035117 | Ga0373953_0068471 | Ga0373953_0068471_31_690 | 218 |
| 230 | 3300035118 | Ga0373954_0000025 | Ga0373954_0000025_34146_34805 | 218 |
| 231 | 3300035691 | Ga0373931_0046924 | Ga0373931_0046924_1566_2222 | 218 |
| 232 | 3300035692 | Ga0373935_0067941 | Ga0373935_0067941_1253_1993 | 218 |
| 233 | 3300035692 | Ga0373935_0710373 | Ga0373935_0710373_29_685 | 218 |
| 234 | 3300035695 | Ga0373927_0097514 | Ga0373927_0097514_1236_1895 | 218 |
| 235 | 3300035724 | Ga0373933_0149985 | Ga0373933_0149985_631_1290 | 218 |
| 236 | 3300035725 | Ga0373947_0540440 | Ga0373947_0540440_11_670 | 218 |
| 237 | 3300036401 | Ga0373937_0001823 | Ga0373937_0001823_8485_9144 | 218 |
| 238 | 3300036401 | Ga0373937_0275544 | Ga0373937_0275544_698_1438 | 218 |
| 239 | 3300036401 | Ga0373937_0303686 | Ga0373937_0303686_158_817 | 218 |
| 240 | 3300037068 | Ga0373925_0067394 | Ga0373925_0067394_1168_1908 | 218 |
| 241 | 3300037068 | Ga0373925_0069329 | Ga0373925_0069329_1902_2558 | 218 |
| 242 | 3300037068 | Ga0373925_0599218 | Ga0373925_0599218_228_887 | 218 |
| 243 | 3300038443 | Ga0395901_0327961 | Ga0395901_0327961_898_1560 | 218 |
| 244 | 3300039437 | Ga0436365_0432212 | Ga0436365_0432212_458_1117 | 218 |
| 245 | 3300039447 | Ga0436361_0793823 | Ga0436361_0793823_1416_2147 | 218 |
| 246 | 3300039450 | Ga0436363_0029113 | Ga0436363_0029113_389_1045 | 218 |
| 247 | 3300039453 | Ga0436362_0416739 | Ga0436362_0416739_1528_2184 | 218 |
| 248 | 3300039453 | Ga0436362_1014264 | Ga0436362_1014264_1912_2601 | 218 |
| 249 | 3300044656 | Ga0466969_0013199 | Ga0466969_0013199_2370_3029 | 218 |
| 250 | 3300044658 | Ga0466972_0033145 | Ga0466972_0033145_1838_2497 | 218 |
| 251 | 3300044684 | Ga0466966_0009428 | Ga0466966_0009428_3212_3871 | 218 |
| 252 | 3300044693 | Ga0466961_0026909 | Ga0466961_0026909_1899_2558 | 218 |
| 253 | 3300044706 | Ga0466964_0003648 | Ga0466964_0003648_2095_2754 | 218 |
| 254 | 3300044719 | Ga0466971_0000160 | Ga0466971_0000160_6895_7554 | 218 |
| 255 | 3300044765 | Ga0466970_0000837 | Ga0466970_0000837_9030_9689 | 218 |
| 256 | 3300044842 | Ga0466957_0097690 | Ga0466957_0097690_990_1649 | 218 |
| 257 | 3300045049 | Ga0466959_0002175 | Ga0466959_0002175_1552_2211 | 218 |
| 258 | 3300045049 | Ga0466959_0019575 | Ga0466959_0019575_3164_3823 | 218 |
| 259 | 3300046472 | Ga0495580_0053066 | Ga0495580_0053066_1987_2646 | 218 |
| 260 | 3300046517 | Ga0495630_0532169 | Ga0495630_0532169_212_871 | 218 |
| 261 | 3300046675 | Ga0495657_0098911 | Ga0495657_0098911_944_1603 | 218 |
| 262 | 3300048911 | Ga0496108_0024282 | Ga0496108_0024282_2793_3452 | 218 |
| 263 | 3300048915 | Ga0496112_0021385 | Ga0496112_0021385_574_1230 | 218 |
| 264 | 3300048915 | Ga0496112_0277210 | Ga0496112_0277210_356_1015 | 218 |
| 265 | 3300048916 | Ga0496113_0718924 | Ga0496113_0718924_64_720 | 218 |
| 266 | 3300048918 | Ga0496115_0330795 | Ga0496115_0330795_331_990 | 218 |
| 267 | 3300048924 | Ga0496121_0005496 | Ga0496121_0005496_5628_6287 | 218 |
| 268 | 3300048928 | Ga0496125_0006536 | Ga0496125_0006536_614_1273 | 218 |
| 269 | 3300048929 | Ga0496126_0413231 | Ga0496126_0413231_350_1006 | 218 |
| 270 | 3300049570 | Ga0501033_0065843 | Ga0501033_0065843_844_1515 | 218 |
| 271 | 3300049573 | Ga0501037_0335933 | Ga0501037_0335933_184_843 | 218 |
| 272 | 3300049575 | Ga0501039_0156502 | Ga0501039_0156502_225_884 | 218 |
| 273 | 3300049577 | Ga0501041_0009999 | Ga0501041_0009999_3297_3968 | 218 |
| 274 | 3300049578 | Ga0501042_0072514 | Ga0501042_0072514_1372_2031 | 218 |
| 275 | 3300049578 | Ga0501042_0107427 | Ga0501042_0107427_155_826 | 218 |
| 276 | 3300049579 | Ga0501043_0313993 | Ga0501043_0313993_278_937 | 218 |
| 277 | 3300049580 | Ga0501046_0002713 | Ga0501046_0002713_10777_11448 | 218 |
| 278 | 3300049580 | Ga0501046_0310290 | Ga0501046_0310290_206_868 | 218 |
| 279 | 3300049581 | Ga0501047_0714790 | Ga0501047_0714790_21_692 | 218 |
| 280 | 3300049582 | Ga0501048_0094064 | Ga0501048_0094064_1139_1798 | 218 |
| 281 | 3300049582 | Ga0501048_0162400 | Ga0501048_0162400_148_819 | 218 |
| 282 | 3300049584 | Ga0501068_0098830 | Ga0501068_0098830_900_1559 | 218 |
| 283 | 3300049587 | Ga0501071_0084081 | Ga0501071_0084081_300_959 | 218 |
| 284 | 3300049587 | Ga0501071_0091958 | Ga0501071_0091958_1372_2031 | 218 |
| 285 | 3300049588 | Ga0501072_0073615 | Ga0501072_0073615_1202_1861 | 218 |
| 286 | 3300049592 | Ga0501076_0068431 | Ga0501076_0068431_1158_1817 | 218 |
| 287 | 3300049593 | Ga0501077_0019896 | Ga0501077_0019896_1138_1797 | 218 |
| 288 | 3300049651 | Ga0501201_008023 | Ga0501201_008023_24_683 | 218 |
| 289 | 3300049741 | Ga0501079_0537208 | Ga0501079_0537208_44_703 | 218 |
| 290 | 3300049824 | Ga0501045_0013254 | Ga0501045_0013254_638_1309 | 218 |
| 291 | 3300049824 | Ga0501045_0077155 | Ga0501045_0077155_757_1416 | 218 |
| 292 | 3300050511 | nmdc:mga08y16_389692_c1 | nmdc:mga08y16_389692_c1_210_866 | 218 |
| 293 | 3300050512 | nmdc:mga0n895_1948_c1 | nmdc:mga0n895_1948_c1_13880_14539 | 218 |
| 294 | 3300050512 | nmdc:mga0n895_224084_c1 | nmdc:mga0n895_224084_c1_990_1646 | 218 |
| 295 | 3300050513 | nmdc:mga0rr50_2277_c1 | nmdc:mga0rr50_2277_c1_9031_9690 | 218 |
| 296 | 3300050514 | nmdc:mga08x19_105395_c1 | nmdc:mga08x19_105395_c1_1173_1832 | 218 |
| 297 | 3300050514 | nmdc:mga08x19_194471_c1 | nmdc:mga08x19_194471_c1_229_885 | 218 |
| 298 | 3300050515 | nmdc:mga0a205_76164_c1 | nmdc:mga0a205_76164_c1_1226_1885 | 218 |
| 299 | 3300059513 | Ga0587094_023998 | Ga0587094_023998_12_695 | 218 |
| 300 | 3300060353 | Ga0501082_0005715 | Ga0501082_0005715_4534_5205 | 218 |
| 301 | 3300061719 | Ga0466962_0004576 | Ga0466962_0004576_5815_6474 | 218 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.941 | 3 | 216 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9406 | 3 | 216 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9361 | 3 | 216 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.932 | 3 | 216 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.918 | 3 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9733 | 153 | 215 | 3.30.1020.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9688 | 153 | 213 | 3.30.1020.10 |
| af_O08709_156_224_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9597 | 153 | 215 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9593 | 7 | 106 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9442 | 153 | 215 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.982 | 1 | 103 |
|
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.982 | 1 | 106 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A3M6WLM4-F1-model_v4 | Thioredoxin domain-containing protein | 0.9817 | 1 | 112 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-C3KLK5-F1-model_v4 | Peroxiredoxin 6 (EC 1.11.1.-) | 0.9792 | 1 | 216 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A534YD48-F1-model_v4 | Peroxiredoxin | 0.9758 | 1 | 182 |
GO:0005829
GO:0045454 GO:0051920 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar