F395872

General Info

Members Datasets Scaffolds Average Seq Length
301 200 297 182

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10193600|Ga0105245_101936002
Length 190
Sequence MRTDGNAEANGPAAIGDGHEAVTGNPVVAALERMLSFCNGVIVVLAALALIAACAVLSYSVLGRALFHLANYWQDEAAVFLLVGATFMTSAYVQGRRGHIGIEAFVGLLSPLANRIRLWLVDIASLLFCAFFTWKSWTLAHEAYVDGQVSNSMWSPPLAIPYSLMAFGMTLLCVQILLQIIIPLTGASRR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
3 2791355199
4 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
86 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
87 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
180 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
185 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
194 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
195 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
196 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
197 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
198 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.33
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 1
Rhizoplane 1.99
Rhizosphere 80.4
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10047312 3300001979 Bacteria 1257
2 Ga0070658_10149935 3300005327 Bacteria 1952
3 Ga0070683_100011417 3300005329 Bacteria 7679
4 Ga0070680_100370576 3300005336 Bacteria 1219
5 Ga0070709_10110717 3300005434 Bacteria 1845
6 Ga0070714_100011974 3300005435 Bacteria 6900
7 Ga0070714_100080931 3300005435 Bacteria 2827
8 Ga0070714_100262169 3300005435 Bacteria 1601
9 Ga0070714_100355339 3300005435 Bacteria 1377
10 Ga0070713_100015169 3300005436 Bacteria 5746
11 Ga0070713_100052072 3300005436 Bacteria 3388
12 Ga0070713_100164348 3300005436 Bacteria 1984
13 Ga0070713_100545159 3300005436 Bacteria 1098
14 Ga0070710_10004385 3300005437 Bacteria 6683
15 Ga0070710_10019966 3300005437 Bacteria 3471
16 Ga0070711_100002111 3300005439 Bacteria 11241
17 Ga0070711_100022271 3300005439 Bacteria 4105
18 Ga0070700_100477194 3300005441 Bacteria 954
19 Ga0070663_100353349 3300005455 Bacteria 1190
20 Ga0070681_10067369 3300005458 Bacteria 3548
21 Ga0070681_10087339 3300005458 Bacteria 3072
22 Ga0070681_10257651 3300005458 Bacteria 1656
23 Ga0070681_11055897 3300005458 Bacteria 733
24 Ga0070706_100771302 3300005467 Bacteria 891
25 Ga0070706_101110480 3300005467 Bacteria 728
26 Ga0070707_100483527 3300005468 Bacteria 1200
27 Ga0070698_100103408 3300005471 Bacteria 2819
28 Ga0070698_100363289 3300005471 Bacteria 1380
29 Ga0070699_100819681 3300005518 Bacteria 852
30 Ga0070699_100880374 3300005518 Bacteria 820
31 Ga0070679_100378807 3300005530 Bacteria 1362
32 Ga0070697_100435354 3300005536 Bacteria 1141
33 Ga0068853_100125374 3300005539 Bacteria 2294
34 Ga0068853_100590152 3300005539 Bacteria 1055
35 Ga0070665_100398258 3300005548 Bacteria 1384
36 Ga0068855_100218764 3300005563 Bacteria 2137
37 Ga0068855_100467933 3300005563 Bacteria 1373
38 Ga0068855_100656753 3300005563 Bacteria 1126
39 Ga0068854_100029506 3300005578 Bacteria 3798
40 Ga0068856_100211860 3300005614 Bacteria 1953
41 Ga0068856_100640282 3300005614 Bacteria 1084
42 Ga0068852_100600580 3300005616 Bacteria 1105
43 Ga0081540_1013526 3300005983 Bacteria 5299
44 Ga0070717_10007360 3300006028 Bacteria 8174
45 Ga0070717_10015633 3300006028 Bacteria 5865
46 Ga0070717_10136114 3300006028 Bacteria 2116
47 Ga0070717_10367380 3300006028 Bacteria 1289
48 Ga0070715_10000184 3300006163 Bacteria 14720
49 Ga0070716_100024999 3300006173 Bacteria 3181
50 Ga0070712_100027542 3300006175 Bacteria 3795
51 Ga0070712_100173050 3300006175 Bacteria 1677
52 Ga0099794_10083136 3300007265 Bacteria 1581
53 Ga0099794_10178133 3300007265 Bacteria 1085
54 Ga0099795_10042306 3300007788 Bacteria 1626
55 Ga0099795_10084703 3300007788 Bacteria 1219
56 Ga0105240_10020983 3300009093 Bacteria 8695
57 Ga0105240_10452215 3300009093 Bacteria 1437
58 Ga0105245_10193600 3300009098 Bacteria 1949
59 Ga0105247_10255126 3300009101 Bacteria 1200
60 Ga0105237_10021913 3300009545 Bacteria 6562
61 Ga0105237_10441171 3300009545 Bacteria 1308
62 Ga0105238_10014562 3300009551 Bacteria 7950
63 Ga0105238_11205980 3300009551 Bacteria 781
64 Ga0105238_11287271 3300009551 Bacteria 757
65 Ga0099796_10001778 3300010159 Bacteria 4502
66 Ga0105239_10272551 3300010375 Bacteria 1904
67 Ga0105239_10508576 3300010375 Bacteria 1370
68 Ga0157335_1012037 3300012492 Bacteria 718
69 Ga0157369_10007712 3300013105 Bacteria 12381
70 Ga0157369_10319829 3300013105 Bacteria 1613
71 Ga0157369_10438326 3300013105 Bacteria 1353
72 Ga0157374_10029955 3300013296 Bacteria 4937
73 Ga0157372_10024026 3300013307 Bacteria 6614
74 Ga0157372_10694965 3300013307 Bacteria 1184
75 Ga0157372_11234027 3300013307 Bacteria 863
76 Ga0157372_11390076 3300013307 Bacteria 809
77 Ga0163163_11607320 3300014325 Bacteria 711
78 Ga0182008_10303682 3300014497 Bacteria 836
79 Ga0182005_1081935 3300015265 Bacteria 891
80 Ga0206350_10441736 3300020080 Bacteria 1204
81 Ga0213876_10294587 3300021384 Bacteria 862
82 Ga0207673_1003929 3300025290 Bacteria 1757
83 Ga0207692_10007248 3300025898 Bacteria 4534
84 Ga0207692_10095041 3300025898 Bacteria 1624
85 Ga0207647_10127474 3300025904 Bacteria 1497
86 Ga0207647_10294051 3300025904 Bacteria 926
87 Ga0207685_10000813 3300025905 Bacteria 5784
88 Ga0207699_10012926 3300025906 Bacteria 4256
89 Ga0207699_10032448 3300025906 Bacteria 2943
90 Ga0207707_10060450 3300025912 Bacteria 3296
91 Ga0207695_10771562 3300025913 Bacteria 842
92 Ga0207671_10562765 3300025914 Bacteria 909
93 Ga0207671_10609148 3300025914 Bacteria 870
94 Ga0207693_10003166 3300025915 Bacteria 14136
95 Ga0207693_10024053 3300025915 Bacteria 4836
96 Ga0207693_10039839 3300025915 Bacteria 3700
97 Ga0207693_10091076 3300025915 Bacteria 2391
98 Ga0207663_10000963 3300025916 Bacteria 13168
99 Ga0207663_10020801 3300025916 Bacteria 3723
100 Ga0207660_10131237 3300025917 Bacteria 1907
101 Ga0207660_10234105 3300025917 Bacteria 1445
102 Ga0207660_10267302 3300025917 Bacteria 1354
103 Ga0207652_10149729 3300025921 Bacteria 2089
104 Ga0207646_10401661 3300025922 Bacteria 1237
105 Ga0207700_10102312 3300025928 Bacteria 2288
106 Ga0207700_10131277 3300025928 Bacteria 2045
107 Ga0207700_10500974 3300025928 Bacteria 1075
108 Ga0207700_10962009 3300025928 Bacteria 764
109 Ga0207664_10055227 3300025929 Bacteria 3151
110 Ga0207664_10063626 3300025929 Bacteria 2949
111 Ga0207664_10127911 3300025929 Bacteria 2135
112 Ga0207664_10272524 3300025929 Bacteria 1483
113 Ga0207665_10000304 3300025939 Bacteria 34057
114 Ga0207661_10000872 3300025944 Bacteria 19829
115 Ga0207661_10145220 3300025944 Bacteria 2046
116 Ga0207667_10149691 3300025949 Bacteria 2403
117 Ga0207667_10461949 3300025949 Bacteria 1289
118 Ga0207640_10011821 3300025981 Bacteria 4955
119 Ga0207640_10529992 3300025981 Bacteria 986
120 Ga0207639_10037618 3300026041 Bacteria 3595
121 Ga0207639_10289467 3300026041 Bacteria 1444
122 Ga0207639_10450457 3300026041 Bacteria 1168
123 Ga0207678_10092721 3300026067 Bacteria 2581
124 Ga0207678_10363227 3300026067 Bacteria 1250
125 Ga0207702_10429952 3300026078 Bacteria 1278
126 Ga0207702_11047308 3300026078 Bacteria 809
127 Ga0209179_1002579 3300027512 Bacteria 2473
128 Ga0209588_1055875 3300027671 Bacteria 1276
129 Ga0265328_10105105 3300031239 Bacteria 1048
130 Ga0307514_10340414 3300031649 Bacteria 808
131 Ga0265314_10073682 3300031711 Bacteria 2276
132 Ga0307413_10106062 3300031824 Bacteria 1869
133 Ga0307406_10232628 3300031901 Bacteria 1377
134 Ga0307412_10768721 3300031911 Bacteria 833
135 Ga0307409_100439253 3300031995 Bacteria 1256
136 Ga0307411_10036956 3300032005 Bacteria 3066
137 Ga0307415_100264511 3300032126 Bacteria 1405
138 Ga0316215_1005838 3300033544 Bacteria 1190
139 Ga0373934_0000684 3300035086 Bacteria 12034
140 Ga0373923_0001610 3300035111 Bacteria 6579
141 Ga0373923_0241346 3300035111 Bacteria 844
142 Ga0373953_0000768 3300035117 Bacteria 8919
143 Ga0373954_0000045 3300035118 Bacteria 43877
144 Ga0373956_0000635 3300035119 Bacteria 14416
145 Ga0373957_0000469 3300035120 Bacteria 10217
146 Ga0373943_0011815 3300035170 Bacteria 3928
147 Ga0373955_0000617 3300035172 Bacteria 15213
148 Ga0373955_0077675 3300035172 Bacteria 1870
149 Ga0373924_0004198 3300035410 Bacteria 5020
150 Ga0373931_0492580 3300035691 Bacteria 789
151 Ga0373935_0002887 3300035692 Bacteria 9889
152 Ga0373927_0003875 3300035695 Bacteria 10608
153 Ga0373933_0000309 3300035724 Bacteria 31558
154 Ga0373933_0001241 3300035724 Bacteria 15060
155 Ga0373947_0006955 3300035725 Bacteria 6556
156 Ga0373937_0000742 3300036401 Bacteria 28122
157 Ga0373937_0167102 3300036401 Bacteria 2063
158 Ga0373925_0003542 3300037068 Bacteria 12045
159 Ga0395900_0034887 3300037418 Bacteria 5182
160 Ga0395900_0039364 3300037418 Bacteria 4871
161 Ga0395900_0075553 3300037418 Bacteria 3464
162 Ga0395900_0239653 3300037418 Bacteria 1820
163 Ga0395898_0102870 3300037466 Bacteria 2741
164 Ga0395898_0141398 3300037466 Bacteria 2304
165 Ga0395898_0158735 3300037466 Bacteria 2163
166 Ga0395905_0220003 3300037471 Bacteria 1777
167 Ga0436364_1421030 3300037853 Bacteria 3340
168 Ga0395901_0032461 3300038443 Bacteria 5388
169 Ga0395901_0222811 3300038443 Bacteria 1971
170 Ga0395901_0340268 3300038443 Bacteria 1550
171 Ga0436365_0083881 3300039437 Bacteria 2847
172 Ga0436365_0489780 3300039437 Bacteria 1036
173 Ga0436365_0554239 3300039437 Bacteria 1277
174 Ga0436365_1242625 3300039437 Bacteria 1620
175 Ga0436365_1265912 3300039437 Bacteria 1433
176 Ga0436360_0849193 3300039438 Bacteria 1413
177 Ga0436363_0316043 3300039450 Bacteria 697
178 Ga0436363_1218047 3300039450 Bacteria 7608
179 Ga0436363_1436180 3300039450 Bacteria 1043
180 Ga0451791_0315141 3300041451 Bacteria 1052
181 Ga0451793_1240659 3300041452 Bacteria 948
182 Ga0451793_1514426 3300041452 Bacteria 584
183 Ga0439455_0085101 3300042012 Bacteria 863
184 Ga0466966_0219290 3300044684 Bacteria 1149
185 Ga0466963_0150133 3300044694 Bacteria 1618
186 Ga0466963_0254850 3300044694 Bacteria 1231
187 Ga0466959_0026903 3300045049 Bacteria 4267
188 Ga0466967_0098417 3300045976 Bacteria 2671
189 Ga0466967_0707011 3300045976 Bacteria 998
190 Ga0495592_0000436 3300046454 Bacteria 31448
191 Ga0495592_0036798 3300046454 Bacteria 3685
192 Ga0495603_0000973 3300046455 Bacteria 16500
193 Ga0495629_0000257 3300046459 Bacteria 46305
194 Ga0495629_0000861 3300046459 Bacteria 24506
195 Ga0495641_0002730 3300046461 Bacteria 13691
196 Ga0495651_0010911 3300046462 Bacteria 6989
197 Ga0495653_0000288 3300046463 Bacteria 40866
198 Ga0495582_0000147 3300046473 Bacteria 38047
199 Ga0495639_0000208 3300046475 Bacteria 30262
200 Ga0495662_0000336 3300046476 Bacteria 20519
201 Ga0495664_0019294 3300046477 Bacteria 3919
202 Ga0495594_0000210 3300046499 Bacteria 28417
203 Ga0495608_0004461 3300046511 Bacteria 10011
204 Ga0495618_0034054 3300046514 Bacteria 3193
205 Ga0495618_0074586 3300046514 Bacteria 2160
206 Ga0495628_0016660 3300046516 Bacteria 6129
207 Ga0495630_0039317 3300046517 Bacteria 3537
208 Ga0495648_0155691 3300046524 Bacteria 1187
209 Ga0495652_0010508 3300046529 Bacteria 8388
210 Ga0495652_0013083 3300046529 Bacteria 7474
211 Ga0495665_0009748 3300046531 Bacteria 5199
212 Ga0495640_0021122 3300046533 Bacteria 4784
213 Ga0495587_0005778 3300046536 Bacteria 8058
214 Ga0495645_0011099 3300046543 Bacteria 6334
215 Ga0495622_0032381 3300046557 Bacteria 2441
216 Ga0495622_0046315 3300046557 Bacteria 2020
217 Ga0495667_0000700 3300046559 Bacteria 21464
218 Ga0495667_0010539 3300046559 Bacteria 6256
219 Ga0495668_0394440 3300046616 Bacteria 760
220 Ga0495634_0007474 3300046642 Bacteria 8204
221 Ga0495634_0014367 3300046642 Bacteria 5711
222 Ga0495635_0000040 3300046663 Bacteria 86519
223 Ga0495635_0000676 3300046663 Bacteria 21987
224 Ga0495657_0014254 3300046675 Bacteria 5840
225 Ga0495599_0000120 3300046678 Bacteria 53081
226 Ga0495623_0016844 3300046679 Bacteria 4720
227 Ga0495646_0003012 3300046680 Bacteria 10441
228 Ga0495646_0023521 3300046680 Bacteria 3878
229 Ga0495658_0002485 3300046683 Bacteria 9276
230 Ga0495613_0004507 3300046689 Bacteria 10440
231 Ga0495613_0018390 3300046689 Bacteria 5212
232 Ga0495624_0003461 3300046690 Bacteria 11697
233 Ga0495600_0000074 3300046809 Bacteria 55182
234 Ga0495581_0000616 3300047315 Bacteria 18651
235 Ga0495604_0001303 3300047317 Bacteria 20381
236 Ga0495674_0004599 3300047319 Bacteria 13271
237 Ga0495674_0006730 3300047319 Bacteria 11005
238 Ga0495676_0017584 3300047321 Bacteria 6318
239 Ga0495680_0001054 3300047322 Bacteria 30518
240 Ga0495675_0000382 3300047444 Bacteria 30557
241 Ga0495684_0000134 3300047471 Bacteria 54180
242 Ga0495684_0019368 3300047471 Bacteria 5239
243 Ga0495686_0048896 3300047472 Bacteria 2664
244 Ga0495593_0000093 3300047673 Bacteria 39845
245 Ga0495593_0010368 3300047673 Bacteria 5387
246 Ga0495602_0002014 3300048088 Bacteria 20424
247 Ga0495614_0022361 3300048089 Bacteria 2729
248 Ga0496100_0755864 3300048903 Bacteria 760
249 Ga0496102_0857508 3300048905 Bacteria 830
250 Ga0496112_0170538 3300048915 Bacteria 2141
251 Ga0496119_0160031 3300048922 Bacteria 1198
252 Ga0496121_0018922 3300048924 Bacteria 6911
253 Ga0496121_0040361 3300048924 Bacteria 4096
254 Ga0496126_0008771 3300048929 Bacteria 10853
255 Ga0496126_0020819 3300048929 Bacteria 6419
256 Ga0496126_0025520 3300048929 Bacteria 5683
257 Ga0496126_0106328 3300048929 Bacteria 2449
258 Ga0496126_0493920 3300048929 Bacteria 979
259 Ga0501046_0142843 3300049580 Bacteria 1810
260 Ga0501047_0038384 3300049581 Bacteria 4634
261 Ga0501048_0207119 3300049582 Bacteria 1391
262 Ga0501070_0031734 3300049586 Bacteria 4426
263 Ga0501073_0004712 3300049589 Bacteria 10246
264 Ga0501074_0009908 3300049590 Bacteria 6924
265 Ga0501080_0045717 3300049742 Bacteria 4075
266 Ga0501044_0067378 3300049823 Bacteria 3647
267 Ga0500635_0203801 3300053080 Bacteria 769
268 Ga0495595_0000064 3300053084 Bacteria 54079
269 Ga0495619_0000995 3300053085 Bacteria 18591
270 Ga0500581_181722 3300053089 Bacteria 954
271 Ga0500647_0093049 3300053091 Bacteria 1442
272 Ga0500583_0121253 3300053092 Bacteria 1294
273 Ga0500651_0004509 3300053093 Bacteria 7806
274 Ga0500651_0105355 3300053093 Bacteria 1725
275 Ga0500566_0000010 3300053094 Bacteria 119976
276 Ga0500640_001664 3300053095 Bacteria 6903
277 Ga0500641_0117109 3300053096 Bacteria 1147
278 Ga0500641_0131356 3300053096 Bacteria 1081
279 Ga0500556_0316081 3300053104 Bacteria 609
280 Ga0500572_000031 3300053111 Bacteria 43489
281 Ga0500591_138393 3300053115 Bacteria 966
282 Ga0500594_0066364 3300053118 Bacteria 1052
283 Ga0500595_000914 3300053119 Bacteria 16816
284 Ga0500595_007110 3300053119 Bacteria 4679
285 Ga0500595_070694 3300053119 Bacteria 1036
286 Ga0500614_002975 3300053123 Bacteria 3700
287 Ga0500559_0002572 3300053136 Bacteria 9295
288 Ga0500590_109739 3300053148 Bacteria 1311
289 Ga0500603_000485 3300053150 Bacteria 10175
290 Ga0500603_038241 3300053150 Bacteria 1269
291 Ga0500604_0078776 3300053151 Bacteria 1061
292 Ga0500630_000318 3300053159 Bacteria 20098
293 Ga0500638_063786 3300053162 Bacteria 1767
294 Ga0500639_000287 3300053163 Bacteria 24838
295 Ga0500636_0014700 3300053177 Bacteria 4605
296 Ga0500636_0124352 3300053177 Bacteria 1443
297 Ga0500596_001034 3300053735 Bacteria 5590

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0034887 Ga0395900_0034887_1591_2145 156
2 3300037466 Ga0395898_0102870 Ga0395898_0102870_1962_2516 156
3 3300037471 Ga0395905_0220003 Ga0395905_0220003_909_1463 156
4 3300038443 Ga0395901_0340268 Ga0395901_0340268_430_984 156
5 3300013296 Ga0157374_10029955 Ga0157374_100299557 157
6 3300039437 Ga0436365_0083881 Ga0436365_0083881_1622_2107 161
7 3300039450 Ga0436363_1218047 Ga0436363_1218047_6501_6986 161
8 3300005563 Ga0068855_100467933 Ga0068855_1004679332 163
9 3300009545 Ga0105237_10021913 Ga0105237_100219132 163
10 3300009551 Ga0105238_10014562 Ga0105238_100145628 163
11 3300025949 Ga0207667_10149691 Ga0207667_101496912 163
12 3300026078 Ga0207702_11047308 Ga0207702_110473081 163
13 3300046616 Ga0495668_0394440 Ga0495668_0394440_225_716 163
14 3300041452 Ga0451793_1514426 Ga0451793_1514426_16_567 164
15 3300049580 Ga0501046_0142843 Ga0501046_0142843_1110_1664 165
16 3300049581 Ga0501047_0038384 Ga0501047_0038384_237_791 165
17 3300049582 Ga0501048_0207119 Ga0501048_0207119_70_624 165
18 3300049586 Ga0501070_0031734 Ga0501070_0031734_1014_1568 165
19 3300049589 Ga0501073_0004712 Ga0501073_0004712_9113_9667 165
20 3300049590 Ga0501074_0009908 Ga0501074_0009908_4620_5174 165
21 3300049742 Ga0501080_0045717 Ga0501080_0045717_3104_3658 165
22 3300049823 Ga0501044_0067378 Ga0501044_0067378_2408_2962 165
23 3300005578 Ga0068854_100029506 Ga0068854_1000295066 167
24 3300025290 Ga0207673_1003929 Ga0207673_10039292 167
25 3300025981 Ga0207640_10011821 Ga0207640_100118216 167
26 3300015265 Ga0182005_1081935 Ga0182005_10819352 168
27 3300005518 Ga0070699_100819681 Ga0070699_1008196812 174
28 3300053177 Ga0500636_0014700 Ga0500636_0014700_3602_4153 174
29 3300005327 Ga0070658_10149935 Ga0070658_101499352 175
30 3300014497 Ga0182008_10303682 Ga0182008_103036821 175
31 3300035691 Ga0373931_0492580 Ga0373931_0492580_18_545 175
32 3300048924 Ga0496121_0040361 Ga0496121_0040361_2102_2656 175
33 3300048929 Ga0496126_0020819 Ga0496126_0020819_2463_3017 175
34 3300044694 Ga0466963_0254850 Ga0466963_0254850_140_694 176
35 3300039450 Ga0436363_0316043 Ga0436363_0316043_27_581 177
36 3300005435 Ga0070714_100262169 Ga0070714_1002621692 178
37 3300005436 Ga0070713_100545159 Ga0070713_1005451592 178
38 3300025929 Ga0207664_10272524 Ga0207664_102725242 178
39 3300031239 Ga0265328_10105105 Ga0265328_101051052 178
40 3300041452 Ga0451793_1240659 Ga0451793_1240659_366_920 178
41 iso_pu_bacteria 2508501128 2509152726 180
42 iso_pu_bacteria 2728368998 2728751604 180
43 iso_pu_bacteria 2791355199 2793083487 180
44 iso_pu_bacteria 2922361189 2922365141 180
45 3300009098 Ga0105245_10193600 Ga0105245_101936002 181
46 3300010375 Ga0105239_10272551 Ga0105239_102725512 181
47 3300025914 Ga0207671_10562765 Ga0207671_105627652 181
48 3300026041 Ga0207639_10450457 Ga0207639_104504572 181
49 3300053150 Ga0500603_038241 Ga0500603_038241_485_1030 181
50 3300053177 Ga0500636_0124352 Ga0500636_0124352_827_1372 181
51 3300009093 Ga0105240_10452215 Ga0105240_104522152 182
52 3300013105 Ga0157369_10319829 Ga0157369_103198292 182
53 3300048929 Ga0496126_0008771 Ga0496126_0008771_3761_4309 182
54 3300053093 Ga0500651_0105355 Ga0500651_0105355_746_1294 182
55 3300005329 Ga0070683_100011417 Ga0070683_1000114178 183
56 3300005435 Ga0070714_100355339 Ga0070714_1003553392 183
57 3300005436 Ga0070713_100164348 Ga0070713_1001643482 183
58 3300005458 Ga0070681_10067369 Ga0070681_100673693 183
59 3300005458 Ga0070681_10087339 Ga0070681_100873394 183
60 3300005458 Ga0070681_10257651 Ga0070681_102576512 183
61 3300005530 Ga0070679_100378807 Ga0070679_1003788072 183
62 3300005539 Ga0068853_100590152 Ga0068853_1005901522 183
63 3300005614 Ga0068856_100640282 Ga0068856_1006402822 183
64 3300006028 Ga0070717_10007360 Ga0070717_100073607 183
65 3300007265 Ga0099794_10178133 Ga0099794_101781331 183
66 3300007788 Ga0099795_10084703 Ga0099795_100847032 183
67 3300009545 Ga0105237_10441171 Ga0105237_104411712 183
68 3300009551 Ga0105238_11205980 Ga0105238_112059802 183
69 3300013307 Ga0157372_11234027 Ga0157372_112340272 183
70 3300021384 Ga0213876_10294587 Ga0213876_102945872 183
71 3300025912 Ga0207707_10060450 Ga0207707_100604503 183
72 3300025913 Ga0207695_10771562 Ga0207695_107715622 183
73 3300025914 Ga0207671_10609148 Ga0207671_106091482 183
74 3300025917 Ga0207660_10234105 Ga0207660_102341052 183
75 3300025921 Ga0207652_10149729 Ga0207652_101497292 183
76 3300025928 Ga0207700_10131277 Ga0207700_101312772 183
77 3300025944 Ga0207661_10000872 Ga0207661_1000087215 183
78 3300025981 Ga0207640_10529992 Ga0207640_105299922 183
79 3300026041 Ga0207639_10289467 Ga0207639_102894672 183
80 3300033544 Ga0316215_1005838 Ga0316215_10058382 183
81 3300035111 Ga0373923_0241346 Ga0373923_0241346_151_702 183
82 3300035170 Ga0373943_0011815 Ga0373943_0011815_1229_1780 183
83 3300035172 Ga0373955_0077675 Ga0373955_0077675_1158_1709 183
84 3300035692 Ga0373935_0002887 Ga0373935_0002887_7962_8513 183
85 3300035695 Ga0373927_0003875 Ga0373927_0003875_5022_5573 183
86 3300035724 Ga0373933_0001241 Ga0373933_0001241_14413_14964 183
87 3300035725 Ga0373947_0006955 Ga0373947_0006955_1216_1767 183
88 3300036401 Ga0373937_0167102 Ga0373937_0167102_1439_1990 183
89 3300037068 Ga0373925_0003542 Ga0373925_0003542_7431_7982 183
90 3300037418 Ga0395900_0039364 Ga0395900_0039364_141_692 183
91 3300037466 Ga0395898_0158735 Ga0395898_0158735_1599_2150 183
92 3300038443 Ga0395901_0222811 Ga0395901_0222811_336_887 183
93 3300039437 Ga0436365_0554239 Ga0436365_0554239_136_687 183
94 3300039437 Ga0436365_1265912 Ga0436365_1265912_872_1423 183
95 3300044694 Ga0466963_0150133 Ga0466963_0150133_666_1217 183
96 3300045976 Ga0466967_0098417 Ga0466967_0098417_256_807 183
97 3300045976 Ga0466967_0707011 Ga0466967_0707011_165_716 183
98 3300046454 Ga0495592_0000436 Ga0495592_0000436_19003_19554 183
99 3300046454 Ga0495592_0036798 Ga0495592_0036798_2911_3462 183
100 3300046455 Ga0495603_0000973 Ga0495603_0000973_1258_1809 183
101 3300046459 Ga0495629_0000861 Ga0495629_0000861_7049_7600 183
102 3300046461 Ga0495641_0002730 Ga0495641_0002730_4104_4655 183
103 3300046473 Ga0495582_0000147 Ga0495582_0000147_20757_21308 183
104 3300046475 Ga0495639_0000208 Ga0495639_0000208_25362_25913 183
105 3300046476 Ga0495662_0000336 Ga0495662_0000336_17572_18123 183
106 3300046477 Ga0495664_0019294 Ga0495664_0019294_1315_1866 183
107 3300046499 Ga0495594_0000210 Ga0495594_0000210_26897_27448 183
108 3300046514 Ga0495618_0074586 Ga0495618_0074586_762_1313 183
109 3300046516 Ga0495628_0016660 Ga0495628_0016660_3979_4530 183
110 3300046517 Ga0495630_0039317 Ga0495630_0039317_773_1324 183
111 3300046524 Ga0495648_0155691 Ga0495648_0155691_370_921 183
112 3300046529 Ga0495652_0010508 Ga0495652_0010508_5500_6051 183
113 3300046531 Ga0495665_0009748 Ga0495665_0009748_765_1316 183
114 3300046533 Ga0495640_0021122 Ga0495640_0021122_55_606 183
115 3300046557 Ga0495622_0046315 Ga0495622_0046315_559_1110 183
116 3300046559 Ga0495667_0010539 Ga0495667_0010539_1790_2341 183
117 3300046642 Ga0495634_0007474 Ga0495634_0007474_7411_7962 183
118 3300046663 Ga0495635_0000676 Ga0495635_0000676_4688_5239 183
119 3300046680 Ga0495646_0023521 Ga0495646_0023521_1133_1684 183
120 3300046683 Ga0495658_0002485 Ga0495658_0002485_3139_3690 183
121 3300046689 Ga0495613_0004507 Ga0495613_0004507_519_1070 183
122 3300046689 Ga0495613_0018390 Ga0495613_0018390_460_1011 183
123 3300046690 Ga0495624_0003461 Ga0495624_0003461_7176_7727 183
124 3300047315 Ga0495581_0000616 Ga0495581_0000616_17990_18541 183
125 3300047319 Ga0495674_0004599 Ga0495674_0004599_2793_3344 183
126 3300047319 Ga0495674_0006730 Ga0495674_0006730_5742_6293 183
127 3300047321 Ga0495676_0017584 Ga0495676_0017584_4036_4587 183
128 3300047471 Ga0495684_0019368 Ga0495684_0019368_695_1246 183
129 3300047472 Ga0495686_0048896 Ga0495686_0048896_1524_2078 183
130 3300047673 Ga0495593_0000093 Ga0495593_0000093_35268_35819 183
131 3300048089 Ga0495614_0022361 Ga0495614_0022361_250_801 183
132 3300048915 Ga0496112_0170538 Ga0496112_0170538_1026_1580 183
133 3300048922 Ga0496119_0160031 Ga0496119_0160031_467_1018 183
134 3300048924 Ga0496121_0018922 Ga0496121_0018922_2489_3040 183
135 3300048929 Ga0496126_0106328 Ga0496126_0106328_956_1507 183
136 3300048929 Ga0496126_0493920 Ga0496126_0493920_210_761 183
137 3300053092 Ga0500583_0121253 Ga0500583_0121253_311_862 183
138 3300053093 Ga0500651_0004509 Ga0500651_0004509_4006_4557 183
139 3300053096 Ga0500641_0131356 Ga0500641_0131356_447_998 183
140 3300053104 Ga0500556_0316081 Ga0500556_0316081_19_570 183
141 3300053119 Ga0500595_000914 Ga0500595_000914_6951_7502 183
142 3300053119 Ga0500595_007110 Ga0500595_007110_167_718 183
143 3300053119 Ga0500595_070694 Ga0500595_070694_106_657 183
144 3300053151 Ga0500604_0078776 Ga0500604_0078776_356_907 183
145 3300001979 JGI24740J21852_10047312 JGI24740J21852_100473122 184
146 3300005336 Ga0070680_100370576 Ga0070680_1003705762 184
147 3300005434 Ga0070709_10110717 Ga0070709_101107172 184
148 3300005435 Ga0070714_100011974 Ga0070714_1000119744 184
149 3300005435 Ga0070714_100080931 Ga0070714_1000809313 184
150 3300005436 Ga0070713_100015169 Ga0070713_1000151691 184
151 3300005436 Ga0070713_100052072 Ga0070713_1000520722 184
152 3300005437 Ga0070710_10004385 Ga0070710_100043857 184
153 3300005437 Ga0070710_10019966 Ga0070710_100199664 184
154 3300005439 Ga0070711_100002111 Ga0070711_1000021114 184
155 3300005439 Ga0070711_100022271 Ga0070711_1000222712 184
156 3300005441 Ga0070700_100477194 Ga0070700_1004771941 184
157 3300005455 Ga0070663_100353349 Ga0070663_1003533492 184
158 3300005458 Ga0070681_11055897 Ga0070681_110558971 184
159 3300005467 Ga0070706_100771302 Ga0070706_1007713022 184
160 3300005467 Ga0070706_101110480 Ga0070706_1011104802 184
161 3300005468 Ga0070707_100483527 Ga0070707_1004835272 184
162 3300005471 Ga0070698_100103408 Ga0070698_1001034082 184
163 3300005471 Ga0070698_100363289 Ga0070698_1003632892 184
164 3300005518 Ga0070699_100880374 Ga0070699_1008803741 184
165 3300005536 Ga0070697_100435354 Ga0070697_1004353542 184
166 3300005539 Ga0068853_100125374 Ga0068853_1001253743 184
167 3300005548 Ga0070665_100398258 Ga0070665_1003982582 184
168 3300005563 Ga0068855_100218764 Ga0068855_1002187642 184
169 3300005563 Ga0068855_100656753 Ga0068855_1006567532 184
170 3300005614 Ga0068856_100211860 Ga0068856_1002118602 184
171 3300005616 Ga0068852_100600580 Ga0068852_1006005802 184
172 3300005983 Ga0081540_1013526 Ga0081540_10135268 184
173 3300006028 Ga0070717_10015633 Ga0070717_100156334 184
174 3300006028 Ga0070717_10136114 Ga0070717_101361142 184
175 3300006028 Ga0070717_10367380 Ga0070717_103673802 184
176 3300006163 Ga0070715_10000184 Ga0070715_100001848 184
177 3300006173 Ga0070716_100024999 Ga0070716_1000249995 184
178 3300006175 Ga0070712_100027542 Ga0070712_1000275424 184
179 3300006175 Ga0070712_100173050 Ga0070712_1001730502 184
180 3300007265 Ga0099794_10083136 Ga0099794_100831362 184
181 3300007788 Ga0099795_10042306 Ga0099795_100423062 184
182 3300009093 Ga0105240_10020983 Ga0105240_100209832 184
183 3300009101 Ga0105247_10255126 Ga0105247_102551262 184
184 3300009551 Ga0105238_11287271 Ga0105238_112872712 184
185 3300010159 Ga0099796_10001778 Ga0099796_100017782 184
186 3300010375 Ga0105239_10508576 Ga0105239_105085762 184
187 3300012492 Ga0157335_1012037 Ga0157335_10120371 184
188 3300013105 Ga0157369_10007712 Ga0157369_100077129 184
189 3300013105 Ga0157369_10438326 Ga0157369_104383262 184
190 3300013307 Ga0157372_10024026 Ga0157372_1002402611 184
191 3300013307 Ga0157372_10694965 Ga0157372_106949651 184
192 3300013307 Ga0157372_11390076 Ga0157372_113900762 184
193 3300014325 Ga0163163_11607320 Ga0163163_116073201 184
194 3300020080 Ga0206350_10441736 Ga0206350_104417362 184
195 3300025898 Ga0207692_10007248 Ga0207692_100072484 184
196 3300025898 Ga0207692_10095041 Ga0207692_100950412 184
197 3300025904 Ga0207647_10127474 Ga0207647_101274742 184
198 3300025904 Ga0207647_10294051 Ga0207647_102940512 184
199 3300025905 Ga0207685_10000813 Ga0207685_100008132 184
200 3300025906 Ga0207699_10012926 Ga0207699_100129262 184
201 3300025906 Ga0207699_10032448 Ga0207699_100324482 184
202 3300025915 Ga0207693_10003166 Ga0207693_100031662 184
203 3300025915 Ga0207693_10024053 Ga0207693_100240533 184
204 3300025915 Ga0207693_10039839 Ga0207693_100398393 184
205 3300025915 Ga0207693_10091076 Ga0207693_100910762 184
206 3300025916 Ga0207663_10000963 Ga0207663_100009635 184
207 3300025916 Ga0207663_10020801 Ga0207663_100208015 184
208 3300025917 Ga0207660_10131237 Ga0207660_101312372 184
209 3300025917 Ga0207660_10267302 Ga0207660_102673022 184
210 3300025922 Ga0207646_10401661 Ga0207646_104016612 184
211 3300025928 Ga0207700_10102312 Ga0207700_101023122 184
212 3300025928 Ga0207700_10500974 Ga0207700_105009742 184
213 3300025928 Ga0207700_10962009 Ga0207700_109620092 184
214 3300025929 Ga0207664_10055227 Ga0207664_100552273 184
215 3300025929 Ga0207664_10063626 Ga0207664_100636265 184
216 3300025929 Ga0207664_10127911 Ga0207664_101279112 184
217 3300025939 Ga0207665_10000304 Ga0207665_1000030426 184
218 3300025944 Ga0207661_10145220 Ga0207661_101452202 184
219 3300025949 Ga0207667_10461949 Ga0207667_104619492 184
220 3300026041 Ga0207639_10037618 Ga0207639_100376183 184
221 3300026067 Ga0207678_10092721 Ga0207678_100927212 184
222 3300026067 Ga0207678_10363227 Ga0207678_103632272 184
223 3300026078 Ga0207702_10429952 Ga0207702_104299522 184
224 3300027512 Ga0209179_1002579 Ga0209179_10025792 184
225 3300027671 Ga0209588_1055875 Ga0209588_10558752 184
226 3300031649 Ga0307514_10340414 Ga0307514_103404142 184
227 3300031711 Ga0265314_10073682 Ga0265314_100736822 184
228 3300031824 Ga0307413_10106062 Ga0307413_101060622 184
229 3300031901 Ga0307406_10232628 Ga0307406_102326282 184
230 3300031911 Ga0307412_10768721 Ga0307412_107687212 184
231 3300031995 Ga0307409_100439253 Ga0307409_1004392531 184
232 3300032005 Ga0307411_10036956 Ga0307411_100369562 184
233 3300032126 Ga0307415_100264511 Ga0307415_1002645111 184
234 3300035086 Ga0373934_0000684 Ga0373934_0000684_10942_11496 184
235 3300035111 Ga0373923_0001610 Ga0373923_0001610_706_1260 184
236 3300035117 Ga0373953_0000768 Ga0373953_0000768_7145_7699 184
237 3300035118 Ga0373954_0000045 Ga0373954_0000045_27264_27818 184
238 3300035119 Ga0373956_0000635 Ga0373956_0000635_11300_11854 184
239 3300035120 Ga0373957_0000469 Ga0373957_0000469_5192_5746 184
240 3300035172 Ga0373955_0000617 Ga0373955_0000617_3815_4369 184
241 3300035410 Ga0373924_0004198 Ga0373924_0004198_3244_3798 184
242 3300035724 Ga0373933_0000309 Ga0373933_0000309_5006_5560 184
243 3300036401 Ga0373937_0000742 Ga0373937_0000742_25949_26503 184
244 3300037418 Ga0395900_0075553 Ga0395900_0075553_2651_3205 184
245 3300037418 Ga0395900_0239653 Ga0395900_0239653_546_1100 184
246 3300037466 Ga0395898_0141398 Ga0395898_0141398_407_961 184
247 3300037853 Ga0436364_1421030 Ga0436364_1421030_785_1339 184
248 3300038443 Ga0395901_0032461 Ga0395901_0032461_2898_3452 184
249 3300039437 Ga0436365_0489780 Ga0436365_0489780_466_1020 184
250 3300039437 Ga0436365_1242625 Ga0436365_1242625_438_992 184
251 3300039438 Ga0436360_0849193 Ga0436360_0849193_607_1161 184
252 3300039450 Ga0436363_1436180 Ga0436363_1436180_41_595 184
253 3300041451 Ga0451791_0315141 Ga0451791_0315141_213_767 184
254 3300042012 Ga0439455_0085101 Ga0439455_0085101_281_835 184
255 3300044684 Ga0466966_0219290 Ga0466966_0219290_389_946 184
256 3300045049 Ga0466959_0026903 Ga0466959_0026903_103_660 184
257 3300046459 Ga0495629_0000257 Ga0495629_0000257_28910_29464 184
258 3300046462 Ga0495651_0010911 Ga0495651_0010911_4339_4893 184
259 3300046463 Ga0495653_0000288 Ga0495653_0000288_19438_19992 184
260 3300046511 Ga0495608_0004461 Ga0495608_0004461_5664_6218 184
261 3300046514 Ga0495618_0034054 Ga0495618_0034054_366_920 184
262 3300046529 Ga0495652_0013083 Ga0495652_0013083_1365_1919 184
263 3300046536 Ga0495587_0005778 Ga0495587_0005778_2563_3117 184
264 3300046543 Ga0495645_0011099 Ga0495645_0011099_5263_5817 184
265 3300046557 Ga0495622_0032381 Ga0495622_0032381_1845_2399 184
266 3300046559 Ga0495667_0000700 Ga0495667_0000700_9369_9923 184
267 3300046642 Ga0495634_0014367 Ga0495634_0014367_4094_4648 184
268 3300046663 Ga0495635_0000040 Ga0495635_0000040_74601_75155 184
269 3300046675 Ga0495657_0014254 Ga0495657_0014254_3794_4348 184
270 3300046678 Ga0495599_0000120 Ga0495599_0000120_10541_11095 184
271 3300046679 Ga0495623_0016844 Ga0495623_0016844_1394_1948 184
272 3300046680 Ga0495646_0003012 Ga0495646_0003012_1718_2272 184
273 3300046809 Ga0495600_0000074 Ga0495600_0000074_28784_29338 184
274 3300047317 Ga0495604_0001303 Ga0495604_0001303_4218_4772 184
275 3300047322 Ga0495680_0001054 Ga0495680_0001054_18295_18849 184
276 3300047444 Ga0495675_0000382 Ga0495675_0000382_19159_19713 184
277 3300047471 Ga0495684_0000134 Ga0495684_0000134_22458_23012 184
278 3300047673 Ga0495593_0010368 Ga0495593_0010368_3730_4284 184
279 3300048088 Ga0495602_0002014 Ga0495602_0002014_17774_18328 184
280 3300048903 Ga0496100_0755864 Ga0496100_0755864_151_705 184
281 3300048905 Ga0496102_0857508 Ga0496102_0857508_181_735 184
282 3300048929 Ga0496126_0025520 Ga0496126_0025520_176_730 184
283 3300053080 Ga0500635_0203801 Ga0500635_0203801_95_652 184
284 3300053084 Ga0495595_0000064 Ga0495595_0000064_35240_35794 184
285 3300053085 Ga0495619_0000995 Ga0495619_0000995_11848_12402 184
286 3300053089 Ga0500581_181722 Ga0500581_181722_178_732 184
287 3300053091 Ga0500647_0093049 Ga0500647_0093049_827_1384 184
288 3300053094 Ga0500566_0000010 Ga0500566_0000010_94909_95466 184
289 3300053095 Ga0500640_001664 Ga0500640_001664_5425_5982 184
290 3300053096 Ga0500641_0117109 Ga0500641_0117109_329_883 184
291 3300053111 Ga0500572_000031 Ga0500572_000031_24486_25043 184
292 3300053115 Ga0500591_138393 Ga0500591_138393_221_778 184
293 3300053118 Ga0500594_0066364 Ga0500594_0066364_457_1011 184
294 3300053123 Ga0500614_002975 Ga0500614_002975_295_852 184
295 3300053136 Ga0500559_0002572 Ga0500559_0002572_4095_4652 184
296 3300053148 Ga0500590_109739 Ga0500590_109739_582_1139 184
297 3300053150 Ga0500603_000485 Ga0500603_000485_5232_5789 184
298 3300053159 Ga0500630_000318 Ga0500630_000318_19328_19885 184
299 3300053162 Ga0500638_063786 Ga0500638_063786_927_1484 184
300 3300053163 Ga0500639_000287 Ga0500639_000287_2090_2647 184
301 3300053735 Ga0500596_001034 Ga0500596_001034_3064_3621 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

53

186

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zw1-assembly1.cif.gz_A human prph2-rom1 hetero-dimer 0.6347 23 140
6wvg-assembly1.cif.gz_A human cd53 0.5764 31 142
6wvg-assembly2.cif.gz_B human cd53 0.5716 31 142
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.5334 32 176
4rng-assembly4.cif.gz_C-2 crystal structure of a bacterial homologue of sweet transporters 0.5289 70 171
ID Description Score Start End Superfamily
af_E7F587_111_235_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6622 104 183 3.30.40.10
af_A0A6H2EED7_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6501 17 184 1.20.140.150
af_A0A6H2EED7_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6346 17 184 1.20.140.150
af_P24485_1_104_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.601 27 115 1.10.287.70
af_I1LVA8_137_230_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5966 71 184 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A523Q3H0-F1-model_v4 TRAP transporter small permease protein 0.8101 27 184 GO:0005886
GO:0015740
GO:0022857
AF-A0A523Q3H0-F1-model_v4 TRAP transporter small permease protein 0.7567 27 184 GO:0005886
GO:0015740
GO:0022857
AF-Q11BZ3-F1-model_v4 TRAP transporter small permease protein 0.7548 25 183 GO:0005886
GO:0015740
GO:0022857
AF-A0A7Z2SP02-F1-model_v4 TRAP transporter small permease protein 0.7472 20 180 GO:0005886
GO:0015740
GO:0022857
AF-A0A521QWN6-F1-model_v4 TRAP transporter small permease protein 0.7293 17 174 GO:0005886
GO:0015740
GO:0022857

Feature Viewer

pLDDT pTM Quality
70.25 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map