F395872
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 200 | 297 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10193600|Ga0105245_101936002 |
| Length | 190 |
| Sequence | MRTDGNAEANGPAAIGDGHEAVTGNPVVAALERMLSFCNGVIVVLAALALIAACAVLSYSVLGRALFHLANYWQDEAAVFLLVGATFMTSAYVQGRRGHIGIEAFVGLLSPLANRIRLWLVDIASLLFCAFFTWKSWTLAHEAYVDGQVSNSMWSPPLAIPYSLMAFGMTLLCVQILLQIIIPLTGASRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 3 | 2791355199 | |||
| 4 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 35 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 49 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 52 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 78 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 80 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 81 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 82 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 83 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 84 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 85 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 86 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 87 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 88 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 90 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 92 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 93 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 94 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 95 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 96 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 97 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 109 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 110 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 111 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 112 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 165 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 166 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 167 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 168 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 177 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 180 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 181 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 182 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 183 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 184 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 185 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 186 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 187 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 188 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 189 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 190 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 191 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 192 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 193 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 194 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 196 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 197 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 198 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 199 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.63 |
| Nodule | 1 |
| Rhizoplane | 1.99 |
| Rhizosphere | 80.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10047312 | 3300001979 | Bacteria | 1257 |
| 2 | Ga0070658_10149935 | 3300005327 | Bacteria | 1952 |
| 3 | Ga0070683_100011417 | 3300005329 | Bacteria | 7679 |
| 4 | Ga0070680_100370576 | 3300005336 | Bacteria | 1219 |
| 5 | Ga0070709_10110717 | 3300005434 | Bacteria | 1845 |
| 6 | Ga0070714_100011974 | 3300005435 | Bacteria | 6900 |
| 7 | Ga0070714_100080931 | 3300005435 | Bacteria | 2827 |
| 8 | Ga0070714_100262169 | 3300005435 | Bacteria | 1601 |
| 9 | Ga0070714_100355339 | 3300005435 | Bacteria | 1377 |
| 10 | Ga0070713_100015169 | 3300005436 | Bacteria | 5746 |
| 11 | Ga0070713_100052072 | 3300005436 | Bacteria | 3388 |
| 12 | Ga0070713_100164348 | 3300005436 | Bacteria | 1984 |
| 13 | Ga0070713_100545159 | 3300005436 | Bacteria | 1098 |
| 14 | Ga0070710_10004385 | 3300005437 | Bacteria | 6683 |
| 15 | Ga0070710_10019966 | 3300005437 | Bacteria | 3471 |
| 16 | Ga0070711_100002111 | 3300005439 | Bacteria | 11241 |
| 17 | Ga0070711_100022271 | 3300005439 | Bacteria | 4105 |
| 18 | Ga0070700_100477194 | 3300005441 | Bacteria | 954 |
| 19 | Ga0070663_100353349 | 3300005455 | Bacteria | 1190 |
| 20 | Ga0070681_10067369 | 3300005458 | Bacteria | 3548 |
| 21 | Ga0070681_10087339 | 3300005458 | Bacteria | 3072 |
| 22 | Ga0070681_10257651 | 3300005458 | Bacteria | 1656 |
| 23 | Ga0070681_11055897 | 3300005458 | Bacteria | 733 |
| 24 | Ga0070706_100771302 | 3300005467 | Bacteria | 891 |
| 25 | Ga0070706_101110480 | 3300005467 | Bacteria | 728 |
| 26 | Ga0070707_100483527 | 3300005468 | Bacteria | 1200 |
| 27 | Ga0070698_100103408 | 3300005471 | Bacteria | 2819 |
| 28 | Ga0070698_100363289 | 3300005471 | Bacteria | 1380 |
| 29 | Ga0070699_100819681 | 3300005518 | Bacteria | 852 |
| 30 | Ga0070699_100880374 | 3300005518 | Bacteria | 820 |
| 31 | Ga0070679_100378807 | 3300005530 | Bacteria | 1362 |
| 32 | Ga0070697_100435354 | 3300005536 | Bacteria | 1141 |
| 33 | Ga0068853_100125374 | 3300005539 | Bacteria | 2294 |
| 34 | Ga0068853_100590152 | 3300005539 | Bacteria | 1055 |
| 35 | Ga0070665_100398258 | 3300005548 | Bacteria | 1384 |
| 36 | Ga0068855_100218764 | 3300005563 | Bacteria | 2137 |
| 37 | Ga0068855_100467933 | 3300005563 | Bacteria | 1373 |
| 38 | Ga0068855_100656753 | 3300005563 | Bacteria | 1126 |
| 39 | Ga0068854_100029506 | 3300005578 | Bacteria | 3798 |
| 40 | Ga0068856_100211860 | 3300005614 | Bacteria | 1953 |
| 41 | Ga0068856_100640282 | 3300005614 | Bacteria | 1084 |
| 42 | Ga0068852_100600580 | 3300005616 | Bacteria | 1105 |
| 43 | Ga0081540_1013526 | 3300005983 | Bacteria | 5299 |
| 44 | Ga0070717_10007360 | 3300006028 | Bacteria | 8174 |
| 45 | Ga0070717_10015633 | 3300006028 | Bacteria | 5865 |
| 46 | Ga0070717_10136114 | 3300006028 | Bacteria | 2116 |
| 47 | Ga0070717_10367380 | 3300006028 | Bacteria | 1289 |
| 48 | Ga0070715_10000184 | 3300006163 | Bacteria | 14720 |
| 49 | Ga0070716_100024999 | 3300006173 | Bacteria | 3181 |
| 50 | Ga0070712_100027542 | 3300006175 | Bacteria | 3795 |
| 51 | Ga0070712_100173050 | 3300006175 | Bacteria | 1677 |
| 52 | Ga0099794_10083136 | 3300007265 | Bacteria | 1581 |
| 53 | Ga0099794_10178133 | 3300007265 | Bacteria | 1085 |
| 54 | Ga0099795_10042306 | 3300007788 | Bacteria | 1626 |
| 55 | Ga0099795_10084703 | 3300007788 | Bacteria | 1219 |
| 56 | Ga0105240_10020983 | 3300009093 | Bacteria | 8695 |
| 57 | Ga0105240_10452215 | 3300009093 | Bacteria | 1437 |
| 58 | Ga0105245_10193600 | 3300009098 | Bacteria | 1949 |
| 59 | Ga0105247_10255126 | 3300009101 | Bacteria | 1200 |
| 60 | Ga0105237_10021913 | 3300009545 | Bacteria | 6562 |
| 61 | Ga0105237_10441171 | 3300009545 | Bacteria | 1308 |
| 62 | Ga0105238_10014562 | 3300009551 | Bacteria | 7950 |
| 63 | Ga0105238_11205980 | 3300009551 | Bacteria | 781 |
| 64 | Ga0105238_11287271 | 3300009551 | Bacteria | 757 |
| 65 | Ga0099796_10001778 | 3300010159 | Bacteria | 4502 |
| 66 | Ga0105239_10272551 | 3300010375 | Bacteria | 1904 |
| 67 | Ga0105239_10508576 | 3300010375 | Bacteria | 1370 |
| 68 | Ga0157335_1012037 | 3300012492 | Bacteria | 718 |
| 69 | Ga0157369_10007712 | 3300013105 | Bacteria | 12381 |
| 70 | Ga0157369_10319829 | 3300013105 | Bacteria | 1613 |
| 71 | Ga0157369_10438326 | 3300013105 | Bacteria | 1353 |
| 72 | Ga0157374_10029955 | 3300013296 | Bacteria | 4937 |
| 73 | Ga0157372_10024026 | 3300013307 | Bacteria | 6614 |
| 74 | Ga0157372_10694965 | 3300013307 | Bacteria | 1184 |
| 75 | Ga0157372_11234027 | 3300013307 | Bacteria | 863 |
| 76 | Ga0157372_11390076 | 3300013307 | Bacteria | 809 |
| 77 | Ga0163163_11607320 | 3300014325 | Bacteria | 711 |
| 78 | Ga0182008_10303682 | 3300014497 | Bacteria | 836 |
| 79 | Ga0182005_1081935 | 3300015265 | Bacteria | 891 |
| 80 | Ga0206350_10441736 | 3300020080 | Bacteria | 1204 |
| 81 | Ga0213876_10294587 | 3300021384 | Bacteria | 862 |
| 82 | Ga0207673_1003929 | 3300025290 | Bacteria | 1757 |
| 83 | Ga0207692_10007248 | 3300025898 | Bacteria | 4534 |
| 84 | Ga0207692_10095041 | 3300025898 | Bacteria | 1624 |
| 85 | Ga0207647_10127474 | 3300025904 | Bacteria | 1497 |
| 86 | Ga0207647_10294051 | 3300025904 | Bacteria | 926 |
| 87 | Ga0207685_10000813 | 3300025905 | Bacteria | 5784 |
| 88 | Ga0207699_10012926 | 3300025906 | Bacteria | 4256 |
| 89 | Ga0207699_10032448 | 3300025906 | Bacteria | 2943 |
| 90 | Ga0207707_10060450 | 3300025912 | Bacteria | 3296 |
| 91 | Ga0207695_10771562 | 3300025913 | Bacteria | 842 |
| 92 | Ga0207671_10562765 | 3300025914 | Bacteria | 909 |
| 93 | Ga0207671_10609148 | 3300025914 | Bacteria | 870 |
| 94 | Ga0207693_10003166 | 3300025915 | Bacteria | 14136 |
| 95 | Ga0207693_10024053 | 3300025915 | Bacteria | 4836 |
| 96 | Ga0207693_10039839 | 3300025915 | Bacteria | 3700 |
| 97 | Ga0207693_10091076 | 3300025915 | Bacteria | 2391 |
| 98 | Ga0207663_10000963 | 3300025916 | Bacteria | 13168 |
| 99 | Ga0207663_10020801 | 3300025916 | Bacteria | 3723 |
| 100 | Ga0207660_10131237 | 3300025917 | Bacteria | 1907 |
| 101 | Ga0207660_10234105 | 3300025917 | Bacteria | 1445 |
| 102 | Ga0207660_10267302 | 3300025917 | Bacteria | 1354 |
| 103 | Ga0207652_10149729 | 3300025921 | Bacteria | 2089 |
| 104 | Ga0207646_10401661 | 3300025922 | Bacteria | 1237 |
| 105 | Ga0207700_10102312 | 3300025928 | Bacteria | 2288 |
| 106 | Ga0207700_10131277 | 3300025928 | Bacteria | 2045 |
| 107 | Ga0207700_10500974 | 3300025928 | Bacteria | 1075 |
| 108 | Ga0207700_10962009 | 3300025928 | Bacteria | 764 |
| 109 | Ga0207664_10055227 | 3300025929 | Bacteria | 3151 |
| 110 | Ga0207664_10063626 | 3300025929 | Bacteria | 2949 |
| 111 | Ga0207664_10127911 | 3300025929 | Bacteria | 2135 |
| 112 | Ga0207664_10272524 | 3300025929 | Bacteria | 1483 |
| 113 | Ga0207665_10000304 | 3300025939 | Bacteria | 34057 |
| 114 | Ga0207661_10000872 | 3300025944 | Bacteria | 19829 |
| 115 | Ga0207661_10145220 | 3300025944 | Bacteria | 2046 |
| 116 | Ga0207667_10149691 | 3300025949 | Bacteria | 2403 |
| 117 | Ga0207667_10461949 | 3300025949 | Bacteria | 1289 |
| 118 | Ga0207640_10011821 | 3300025981 | Bacteria | 4955 |
| 119 | Ga0207640_10529992 | 3300025981 | Bacteria | 986 |
| 120 | Ga0207639_10037618 | 3300026041 | Bacteria | 3595 |
| 121 | Ga0207639_10289467 | 3300026041 | Bacteria | 1444 |
| 122 | Ga0207639_10450457 | 3300026041 | Bacteria | 1168 |
| 123 | Ga0207678_10092721 | 3300026067 | Bacteria | 2581 |
| 124 | Ga0207678_10363227 | 3300026067 | Bacteria | 1250 |
| 125 | Ga0207702_10429952 | 3300026078 | Bacteria | 1278 |
| 126 | Ga0207702_11047308 | 3300026078 | Bacteria | 809 |
| 127 | Ga0209179_1002579 | 3300027512 | Bacteria | 2473 |
| 128 | Ga0209588_1055875 | 3300027671 | Bacteria | 1276 |
| 129 | Ga0265328_10105105 | 3300031239 | Bacteria | 1048 |
| 130 | Ga0307514_10340414 | 3300031649 | Bacteria | 808 |
| 131 | Ga0265314_10073682 | 3300031711 | Bacteria | 2276 |
| 132 | Ga0307413_10106062 | 3300031824 | Bacteria | 1869 |
| 133 | Ga0307406_10232628 | 3300031901 | Bacteria | 1377 |
| 134 | Ga0307412_10768721 | 3300031911 | Bacteria | 833 |
| 135 | Ga0307409_100439253 | 3300031995 | Bacteria | 1256 |
| 136 | Ga0307411_10036956 | 3300032005 | Bacteria | 3066 |
| 137 | Ga0307415_100264511 | 3300032126 | Bacteria | 1405 |
| 138 | Ga0316215_1005838 | 3300033544 | Bacteria | 1190 |
| 139 | Ga0373934_0000684 | 3300035086 | Bacteria | 12034 |
| 140 | Ga0373923_0001610 | 3300035111 | Bacteria | 6579 |
| 141 | Ga0373923_0241346 | 3300035111 | Bacteria | 844 |
| 142 | Ga0373953_0000768 | 3300035117 | Bacteria | 8919 |
| 143 | Ga0373954_0000045 | 3300035118 | Bacteria | 43877 |
| 144 | Ga0373956_0000635 | 3300035119 | Bacteria | 14416 |
| 145 | Ga0373957_0000469 | 3300035120 | Bacteria | 10217 |
| 146 | Ga0373943_0011815 | 3300035170 | Bacteria | 3928 |
| 147 | Ga0373955_0000617 | 3300035172 | Bacteria | 15213 |
| 148 | Ga0373955_0077675 | 3300035172 | Bacteria | 1870 |
| 149 | Ga0373924_0004198 | 3300035410 | Bacteria | 5020 |
| 150 | Ga0373931_0492580 | 3300035691 | Bacteria | 789 |
| 151 | Ga0373935_0002887 | 3300035692 | Bacteria | 9889 |
| 152 | Ga0373927_0003875 | 3300035695 | Bacteria | 10608 |
| 153 | Ga0373933_0000309 | 3300035724 | Bacteria | 31558 |
| 154 | Ga0373933_0001241 | 3300035724 | Bacteria | 15060 |
| 155 | Ga0373947_0006955 | 3300035725 | Bacteria | 6556 |
| 156 | Ga0373937_0000742 | 3300036401 | Bacteria | 28122 |
| 157 | Ga0373937_0167102 | 3300036401 | Bacteria | 2063 |
| 158 | Ga0373925_0003542 | 3300037068 | Bacteria | 12045 |
| 159 | Ga0395900_0034887 | 3300037418 | Bacteria | 5182 |
| 160 | Ga0395900_0039364 | 3300037418 | Bacteria | 4871 |
| 161 | Ga0395900_0075553 | 3300037418 | Bacteria | 3464 |
| 162 | Ga0395900_0239653 | 3300037418 | Bacteria | 1820 |
| 163 | Ga0395898_0102870 | 3300037466 | Bacteria | 2741 |
| 164 | Ga0395898_0141398 | 3300037466 | Bacteria | 2304 |
| 165 | Ga0395898_0158735 | 3300037466 | Bacteria | 2163 |
| 166 | Ga0395905_0220003 | 3300037471 | Bacteria | 1777 |
| 167 | Ga0436364_1421030 | 3300037853 | Bacteria | 3340 |
| 168 | Ga0395901_0032461 | 3300038443 | Bacteria | 5388 |
| 169 | Ga0395901_0222811 | 3300038443 | Bacteria | 1971 |
| 170 | Ga0395901_0340268 | 3300038443 | Bacteria | 1550 |
| 171 | Ga0436365_0083881 | 3300039437 | Bacteria | 2847 |
| 172 | Ga0436365_0489780 | 3300039437 | Bacteria | 1036 |
| 173 | Ga0436365_0554239 | 3300039437 | Bacteria | 1277 |
| 174 | Ga0436365_1242625 | 3300039437 | Bacteria | 1620 |
| 175 | Ga0436365_1265912 | 3300039437 | Bacteria | 1433 |
| 176 | Ga0436360_0849193 | 3300039438 | Bacteria | 1413 |
| 177 | Ga0436363_0316043 | 3300039450 | Bacteria | 697 |
| 178 | Ga0436363_1218047 | 3300039450 | Bacteria | 7608 |
| 179 | Ga0436363_1436180 | 3300039450 | Bacteria | 1043 |
| 180 | Ga0451791_0315141 | 3300041451 | Bacteria | 1052 |
| 181 | Ga0451793_1240659 | 3300041452 | Bacteria | 948 |
| 182 | Ga0451793_1514426 | 3300041452 | Bacteria | 584 |
| 183 | Ga0439455_0085101 | 3300042012 | Bacteria | 863 |
| 184 | Ga0466966_0219290 | 3300044684 | Bacteria | 1149 |
| 185 | Ga0466963_0150133 | 3300044694 | Bacteria | 1618 |
| 186 | Ga0466963_0254850 | 3300044694 | Bacteria | 1231 |
| 187 | Ga0466959_0026903 | 3300045049 | Bacteria | 4267 |
| 188 | Ga0466967_0098417 | 3300045976 | Bacteria | 2671 |
| 189 | Ga0466967_0707011 | 3300045976 | Bacteria | 998 |
| 190 | Ga0495592_0000436 | 3300046454 | Bacteria | 31448 |
| 191 | Ga0495592_0036798 | 3300046454 | Bacteria | 3685 |
| 192 | Ga0495603_0000973 | 3300046455 | Bacteria | 16500 |
| 193 | Ga0495629_0000257 | 3300046459 | Bacteria | 46305 |
| 194 | Ga0495629_0000861 | 3300046459 | Bacteria | 24506 |
| 195 | Ga0495641_0002730 | 3300046461 | Bacteria | 13691 |
| 196 | Ga0495651_0010911 | 3300046462 | Bacteria | 6989 |
| 197 | Ga0495653_0000288 | 3300046463 | Bacteria | 40866 |
| 198 | Ga0495582_0000147 | 3300046473 | Bacteria | 38047 |
| 199 | Ga0495639_0000208 | 3300046475 | Bacteria | 30262 |
| 200 | Ga0495662_0000336 | 3300046476 | Bacteria | 20519 |
| 201 | Ga0495664_0019294 | 3300046477 | Bacteria | 3919 |
| 202 | Ga0495594_0000210 | 3300046499 | Bacteria | 28417 |
| 203 | Ga0495608_0004461 | 3300046511 | Bacteria | 10011 |
| 204 | Ga0495618_0034054 | 3300046514 | Bacteria | 3193 |
| 205 | Ga0495618_0074586 | 3300046514 | Bacteria | 2160 |
| 206 | Ga0495628_0016660 | 3300046516 | Bacteria | 6129 |
| 207 | Ga0495630_0039317 | 3300046517 | Bacteria | 3537 |
| 208 | Ga0495648_0155691 | 3300046524 | Bacteria | 1187 |
| 209 | Ga0495652_0010508 | 3300046529 | Bacteria | 8388 |
| 210 | Ga0495652_0013083 | 3300046529 | Bacteria | 7474 |
| 211 | Ga0495665_0009748 | 3300046531 | Bacteria | 5199 |
| 212 | Ga0495640_0021122 | 3300046533 | Bacteria | 4784 |
| 213 | Ga0495587_0005778 | 3300046536 | Bacteria | 8058 |
| 214 | Ga0495645_0011099 | 3300046543 | Bacteria | 6334 |
| 215 | Ga0495622_0032381 | 3300046557 | Bacteria | 2441 |
| 216 | Ga0495622_0046315 | 3300046557 | Bacteria | 2020 |
| 217 | Ga0495667_0000700 | 3300046559 | Bacteria | 21464 |
| 218 | Ga0495667_0010539 | 3300046559 | Bacteria | 6256 |
| 219 | Ga0495668_0394440 | 3300046616 | Bacteria | 760 |
| 220 | Ga0495634_0007474 | 3300046642 | Bacteria | 8204 |
| 221 | Ga0495634_0014367 | 3300046642 | Bacteria | 5711 |
| 222 | Ga0495635_0000040 | 3300046663 | Bacteria | 86519 |
| 223 | Ga0495635_0000676 | 3300046663 | Bacteria | 21987 |
| 224 | Ga0495657_0014254 | 3300046675 | Bacteria | 5840 |
| 225 | Ga0495599_0000120 | 3300046678 | Bacteria | 53081 |
| 226 | Ga0495623_0016844 | 3300046679 | Bacteria | 4720 |
| 227 | Ga0495646_0003012 | 3300046680 | Bacteria | 10441 |
| 228 | Ga0495646_0023521 | 3300046680 | Bacteria | 3878 |
| 229 | Ga0495658_0002485 | 3300046683 | Bacteria | 9276 |
| 230 | Ga0495613_0004507 | 3300046689 | Bacteria | 10440 |
| 231 | Ga0495613_0018390 | 3300046689 | Bacteria | 5212 |
| 232 | Ga0495624_0003461 | 3300046690 | Bacteria | 11697 |
| 233 | Ga0495600_0000074 | 3300046809 | Bacteria | 55182 |
| 234 | Ga0495581_0000616 | 3300047315 | Bacteria | 18651 |
| 235 | Ga0495604_0001303 | 3300047317 | Bacteria | 20381 |
| 236 | Ga0495674_0004599 | 3300047319 | Bacteria | 13271 |
| 237 | Ga0495674_0006730 | 3300047319 | Bacteria | 11005 |
| 238 | Ga0495676_0017584 | 3300047321 | Bacteria | 6318 |
| 239 | Ga0495680_0001054 | 3300047322 | Bacteria | 30518 |
| 240 | Ga0495675_0000382 | 3300047444 | Bacteria | 30557 |
| 241 | Ga0495684_0000134 | 3300047471 | Bacteria | 54180 |
| 242 | Ga0495684_0019368 | 3300047471 | Bacteria | 5239 |
| 243 | Ga0495686_0048896 | 3300047472 | Bacteria | 2664 |
| 244 | Ga0495593_0000093 | 3300047673 | Bacteria | 39845 |
| 245 | Ga0495593_0010368 | 3300047673 | Bacteria | 5387 |
| 246 | Ga0495602_0002014 | 3300048088 | Bacteria | 20424 |
| 247 | Ga0495614_0022361 | 3300048089 | Bacteria | 2729 |
| 248 | Ga0496100_0755864 | 3300048903 | Bacteria | 760 |
| 249 | Ga0496102_0857508 | 3300048905 | Bacteria | 830 |
| 250 | Ga0496112_0170538 | 3300048915 | Bacteria | 2141 |
| 251 | Ga0496119_0160031 | 3300048922 | Bacteria | 1198 |
| 252 | Ga0496121_0018922 | 3300048924 | Bacteria | 6911 |
| 253 | Ga0496121_0040361 | 3300048924 | Bacteria | 4096 |
| 254 | Ga0496126_0008771 | 3300048929 | Bacteria | 10853 |
| 255 | Ga0496126_0020819 | 3300048929 | Bacteria | 6419 |
| 256 | Ga0496126_0025520 | 3300048929 | Bacteria | 5683 |
| 257 | Ga0496126_0106328 | 3300048929 | Bacteria | 2449 |
| 258 | Ga0496126_0493920 | 3300048929 | Bacteria | 979 |
| 259 | Ga0501046_0142843 | 3300049580 | Bacteria | 1810 |
| 260 | Ga0501047_0038384 | 3300049581 | Bacteria | 4634 |
| 261 | Ga0501048_0207119 | 3300049582 | Bacteria | 1391 |
| 262 | Ga0501070_0031734 | 3300049586 | Bacteria | 4426 |
| 263 | Ga0501073_0004712 | 3300049589 | Bacteria | 10246 |
| 264 | Ga0501074_0009908 | 3300049590 | Bacteria | 6924 |
| 265 | Ga0501080_0045717 | 3300049742 | Bacteria | 4075 |
| 266 | Ga0501044_0067378 | 3300049823 | Bacteria | 3647 |
| 267 | Ga0500635_0203801 | 3300053080 | Bacteria | 769 |
| 268 | Ga0495595_0000064 | 3300053084 | Bacteria | 54079 |
| 269 | Ga0495619_0000995 | 3300053085 | Bacteria | 18591 |
| 270 | Ga0500581_181722 | 3300053089 | Bacteria | 954 |
| 271 | Ga0500647_0093049 | 3300053091 | Bacteria | 1442 |
| 272 | Ga0500583_0121253 | 3300053092 | Bacteria | 1294 |
| 273 | Ga0500651_0004509 | 3300053093 | Bacteria | 7806 |
| 274 | Ga0500651_0105355 | 3300053093 | Bacteria | 1725 |
| 275 | Ga0500566_0000010 | 3300053094 | Bacteria | 119976 |
| 276 | Ga0500640_001664 | 3300053095 | Bacteria | 6903 |
| 277 | Ga0500641_0117109 | 3300053096 | Bacteria | 1147 |
| 278 | Ga0500641_0131356 | 3300053096 | Bacteria | 1081 |
| 279 | Ga0500556_0316081 | 3300053104 | Bacteria | 609 |
| 280 | Ga0500572_000031 | 3300053111 | Bacteria | 43489 |
| 281 | Ga0500591_138393 | 3300053115 | Bacteria | 966 |
| 282 | Ga0500594_0066364 | 3300053118 | Bacteria | 1052 |
| 283 | Ga0500595_000914 | 3300053119 | Bacteria | 16816 |
| 284 | Ga0500595_007110 | 3300053119 | Bacteria | 4679 |
| 285 | Ga0500595_070694 | 3300053119 | Bacteria | 1036 |
| 286 | Ga0500614_002975 | 3300053123 | Bacteria | 3700 |
| 287 | Ga0500559_0002572 | 3300053136 | Bacteria | 9295 |
| 288 | Ga0500590_109739 | 3300053148 | Bacteria | 1311 |
| 289 | Ga0500603_000485 | 3300053150 | Bacteria | 10175 |
| 290 | Ga0500603_038241 | 3300053150 | Bacteria | 1269 |
| 291 | Ga0500604_0078776 | 3300053151 | Bacteria | 1061 |
| 292 | Ga0500630_000318 | 3300053159 | Bacteria | 20098 |
| 293 | Ga0500638_063786 | 3300053162 | Bacteria | 1767 |
| 294 | Ga0500639_000287 | 3300053163 | Bacteria | 24838 |
| 295 | Ga0500636_0014700 | 3300053177 | Bacteria | 4605 |
| 296 | Ga0500636_0124352 | 3300053177 | Bacteria | 1443 |
| 297 | Ga0500596_001034 | 3300053735 | Bacteria | 5590 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0034887 | Ga0395900_0034887_1591_2145 | 156 |
| 2 | 3300037466 | Ga0395898_0102870 | Ga0395898_0102870_1962_2516 | 156 |
| 3 | 3300037471 | Ga0395905_0220003 | Ga0395905_0220003_909_1463 | 156 |
| 4 | 3300038443 | Ga0395901_0340268 | Ga0395901_0340268_430_984 | 156 |
| 5 | 3300013296 | Ga0157374_10029955 | Ga0157374_100299557 | 157 |
| 6 | 3300039437 | Ga0436365_0083881 | Ga0436365_0083881_1622_2107 | 161 |
| 7 | 3300039450 | Ga0436363_1218047 | Ga0436363_1218047_6501_6986 | 161 |
| 8 | 3300005563 | Ga0068855_100467933 | Ga0068855_1004679332 | 163 |
| 9 | 3300009545 | Ga0105237_10021913 | Ga0105237_100219132 | 163 |
| 10 | 3300009551 | Ga0105238_10014562 | Ga0105238_100145628 | 163 |
| 11 | 3300025949 | Ga0207667_10149691 | Ga0207667_101496912 | 163 |
| 12 | 3300026078 | Ga0207702_11047308 | Ga0207702_110473081 | 163 |
| 13 | 3300046616 | Ga0495668_0394440 | Ga0495668_0394440_225_716 | 163 |
| 14 | 3300041452 | Ga0451793_1514426 | Ga0451793_1514426_16_567 | 164 |
| 15 | 3300049580 | Ga0501046_0142843 | Ga0501046_0142843_1110_1664 | 165 |
| 16 | 3300049581 | Ga0501047_0038384 | Ga0501047_0038384_237_791 | 165 |
| 17 | 3300049582 | Ga0501048_0207119 | Ga0501048_0207119_70_624 | 165 |
| 18 | 3300049586 | Ga0501070_0031734 | Ga0501070_0031734_1014_1568 | 165 |
| 19 | 3300049589 | Ga0501073_0004712 | Ga0501073_0004712_9113_9667 | 165 |
| 20 | 3300049590 | Ga0501074_0009908 | Ga0501074_0009908_4620_5174 | 165 |
| 21 | 3300049742 | Ga0501080_0045717 | Ga0501080_0045717_3104_3658 | 165 |
| 22 | 3300049823 | Ga0501044_0067378 | Ga0501044_0067378_2408_2962 | 165 |
| 23 | 3300005578 | Ga0068854_100029506 | Ga0068854_1000295066 | 167 |
| 24 | 3300025290 | Ga0207673_1003929 | Ga0207673_10039292 | 167 |
| 25 | 3300025981 | Ga0207640_10011821 | Ga0207640_100118216 | 167 |
| 26 | 3300015265 | Ga0182005_1081935 | Ga0182005_10819352 | 168 |
| 27 | 3300005518 | Ga0070699_100819681 | Ga0070699_1008196812 | 174 |
| 28 | 3300053177 | Ga0500636_0014700 | Ga0500636_0014700_3602_4153 | 174 |
| 29 | 3300005327 | Ga0070658_10149935 | Ga0070658_101499352 | 175 |
| 30 | 3300014497 | Ga0182008_10303682 | Ga0182008_103036821 | 175 |
| 31 | 3300035691 | Ga0373931_0492580 | Ga0373931_0492580_18_545 | 175 |
| 32 | 3300048924 | Ga0496121_0040361 | Ga0496121_0040361_2102_2656 | 175 |
| 33 | 3300048929 | Ga0496126_0020819 | Ga0496126_0020819_2463_3017 | 175 |
| 34 | 3300044694 | Ga0466963_0254850 | Ga0466963_0254850_140_694 | 176 |
| 35 | 3300039450 | Ga0436363_0316043 | Ga0436363_0316043_27_581 | 177 |
| 36 | 3300005435 | Ga0070714_100262169 | Ga0070714_1002621692 | 178 |
| 37 | 3300005436 | Ga0070713_100545159 | Ga0070713_1005451592 | 178 |
| 38 | 3300025929 | Ga0207664_10272524 | Ga0207664_102725242 | 178 |
| 39 | 3300031239 | Ga0265328_10105105 | Ga0265328_101051052 | 178 |
| 40 | 3300041452 | Ga0451793_1240659 | Ga0451793_1240659_366_920 | 178 |
| 41 | iso_pu_bacteria | 2508501128 | 2509152726 | 180 |
| 42 | iso_pu_bacteria | 2728368998 | 2728751604 | 180 |
| 43 | iso_pu_bacteria | 2791355199 | 2793083487 | 180 |
| 44 | iso_pu_bacteria | 2922361189 | 2922365141 | 180 |
| 45 | 3300009098 | Ga0105245_10193600 | Ga0105245_101936002 | 181 |
| 46 | 3300010375 | Ga0105239_10272551 | Ga0105239_102725512 | 181 |
| 47 | 3300025914 | Ga0207671_10562765 | Ga0207671_105627652 | 181 |
| 48 | 3300026041 | Ga0207639_10450457 | Ga0207639_104504572 | 181 |
| 49 | 3300053150 | Ga0500603_038241 | Ga0500603_038241_485_1030 | 181 |
| 50 | 3300053177 | Ga0500636_0124352 | Ga0500636_0124352_827_1372 | 181 |
| 51 | 3300009093 | Ga0105240_10452215 | Ga0105240_104522152 | 182 |
| 52 | 3300013105 | Ga0157369_10319829 | Ga0157369_103198292 | 182 |
| 53 | 3300048929 | Ga0496126_0008771 | Ga0496126_0008771_3761_4309 | 182 |
| 54 | 3300053093 | Ga0500651_0105355 | Ga0500651_0105355_746_1294 | 182 |
| 55 | 3300005329 | Ga0070683_100011417 | Ga0070683_1000114178 | 183 |
| 56 | 3300005435 | Ga0070714_100355339 | Ga0070714_1003553392 | 183 |
| 57 | 3300005436 | Ga0070713_100164348 | Ga0070713_1001643482 | 183 |
| 58 | 3300005458 | Ga0070681_10067369 | Ga0070681_100673693 | 183 |
| 59 | 3300005458 | Ga0070681_10087339 | Ga0070681_100873394 | 183 |
| 60 | 3300005458 | Ga0070681_10257651 | Ga0070681_102576512 | 183 |
| 61 | 3300005530 | Ga0070679_100378807 | Ga0070679_1003788072 | 183 |
| 62 | 3300005539 | Ga0068853_100590152 | Ga0068853_1005901522 | 183 |
| 63 | 3300005614 | Ga0068856_100640282 | Ga0068856_1006402822 | 183 |
| 64 | 3300006028 | Ga0070717_10007360 | Ga0070717_100073607 | 183 |
| 65 | 3300007265 | Ga0099794_10178133 | Ga0099794_101781331 | 183 |
| 66 | 3300007788 | Ga0099795_10084703 | Ga0099795_100847032 | 183 |
| 67 | 3300009545 | Ga0105237_10441171 | Ga0105237_104411712 | 183 |
| 68 | 3300009551 | Ga0105238_11205980 | Ga0105238_112059802 | 183 |
| 69 | 3300013307 | Ga0157372_11234027 | Ga0157372_112340272 | 183 |
| 70 | 3300021384 | Ga0213876_10294587 | Ga0213876_102945872 | 183 |
| 71 | 3300025912 | Ga0207707_10060450 | Ga0207707_100604503 | 183 |
| 72 | 3300025913 | Ga0207695_10771562 | Ga0207695_107715622 | 183 |
| 73 | 3300025914 | Ga0207671_10609148 | Ga0207671_106091482 | 183 |
| 74 | 3300025917 | Ga0207660_10234105 | Ga0207660_102341052 | 183 |
| 75 | 3300025921 | Ga0207652_10149729 | Ga0207652_101497292 | 183 |
| 76 | 3300025928 | Ga0207700_10131277 | Ga0207700_101312772 | 183 |
| 77 | 3300025944 | Ga0207661_10000872 | Ga0207661_1000087215 | 183 |
| 78 | 3300025981 | Ga0207640_10529992 | Ga0207640_105299922 | 183 |
| 79 | 3300026041 | Ga0207639_10289467 | Ga0207639_102894672 | 183 |
| 80 | 3300033544 | Ga0316215_1005838 | Ga0316215_10058382 | 183 |
| 81 | 3300035111 | Ga0373923_0241346 | Ga0373923_0241346_151_702 | 183 |
| 82 | 3300035170 | Ga0373943_0011815 | Ga0373943_0011815_1229_1780 | 183 |
| 83 | 3300035172 | Ga0373955_0077675 | Ga0373955_0077675_1158_1709 | 183 |
| 84 | 3300035692 | Ga0373935_0002887 | Ga0373935_0002887_7962_8513 | 183 |
| 85 | 3300035695 | Ga0373927_0003875 | Ga0373927_0003875_5022_5573 | 183 |
| 86 | 3300035724 | Ga0373933_0001241 | Ga0373933_0001241_14413_14964 | 183 |
| 87 | 3300035725 | Ga0373947_0006955 | Ga0373947_0006955_1216_1767 | 183 |
| 88 | 3300036401 | Ga0373937_0167102 | Ga0373937_0167102_1439_1990 | 183 |
| 89 | 3300037068 | Ga0373925_0003542 | Ga0373925_0003542_7431_7982 | 183 |
| 90 | 3300037418 | Ga0395900_0039364 | Ga0395900_0039364_141_692 | 183 |
| 91 | 3300037466 | Ga0395898_0158735 | Ga0395898_0158735_1599_2150 | 183 |
| 92 | 3300038443 | Ga0395901_0222811 | Ga0395901_0222811_336_887 | 183 |
| 93 | 3300039437 | Ga0436365_0554239 | Ga0436365_0554239_136_687 | 183 |
| 94 | 3300039437 | Ga0436365_1265912 | Ga0436365_1265912_872_1423 | 183 |
| 95 | 3300044694 | Ga0466963_0150133 | Ga0466963_0150133_666_1217 | 183 |
| 96 | 3300045976 | Ga0466967_0098417 | Ga0466967_0098417_256_807 | 183 |
| 97 | 3300045976 | Ga0466967_0707011 | Ga0466967_0707011_165_716 | 183 |
| 98 | 3300046454 | Ga0495592_0000436 | Ga0495592_0000436_19003_19554 | 183 |
| 99 | 3300046454 | Ga0495592_0036798 | Ga0495592_0036798_2911_3462 | 183 |
| 100 | 3300046455 | Ga0495603_0000973 | Ga0495603_0000973_1258_1809 | 183 |
| 101 | 3300046459 | Ga0495629_0000861 | Ga0495629_0000861_7049_7600 | 183 |
| 102 | 3300046461 | Ga0495641_0002730 | Ga0495641_0002730_4104_4655 | 183 |
| 103 | 3300046473 | Ga0495582_0000147 | Ga0495582_0000147_20757_21308 | 183 |
| 104 | 3300046475 | Ga0495639_0000208 | Ga0495639_0000208_25362_25913 | 183 |
| 105 | 3300046476 | Ga0495662_0000336 | Ga0495662_0000336_17572_18123 | 183 |
| 106 | 3300046477 | Ga0495664_0019294 | Ga0495664_0019294_1315_1866 | 183 |
| 107 | 3300046499 | Ga0495594_0000210 | Ga0495594_0000210_26897_27448 | 183 |
| 108 | 3300046514 | Ga0495618_0074586 | Ga0495618_0074586_762_1313 | 183 |
| 109 | 3300046516 | Ga0495628_0016660 | Ga0495628_0016660_3979_4530 | 183 |
| 110 | 3300046517 | Ga0495630_0039317 | Ga0495630_0039317_773_1324 | 183 |
| 111 | 3300046524 | Ga0495648_0155691 | Ga0495648_0155691_370_921 | 183 |
| 112 | 3300046529 | Ga0495652_0010508 | Ga0495652_0010508_5500_6051 | 183 |
| 113 | 3300046531 | Ga0495665_0009748 | Ga0495665_0009748_765_1316 | 183 |
| 114 | 3300046533 | Ga0495640_0021122 | Ga0495640_0021122_55_606 | 183 |
| 115 | 3300046557 | Ga0495622_0046315 | Ga0495622_0046315_559_1110 | 183 |
| 116 | 3300046559 | Ga0495667_0010539 | Ga0495667_0010539_1790_2341 | 183 |
| 117 | 3300046642 | Ga0495634_0007474 | Ga0495634_0007474_7411_7962 | 183 |
| 118 | 3300046663 | Ga0495635_0000676 | Ga0495635_0000676_4688_5239 | 183 |
| 119 | 3300046680 | Ga0495646_0023521 | Ga0495646_0023521_1133_1684 | 183 |
| 120 | 3300046683 | Ga0495658_0002485 | Ga0495658_0002485_3139_3690 | 183 |
| 121 | 3300046689 | Ga0495613_0004507 | Ga0495613_0004507_519_1070 | 183 |
| 122 | 3300046689 | Ga0495613_0018390 | Ga0495613_0018390_460_1011 | 183 |
| 123 | 3300046690 | Ga0495624_0003461 | Ga0495624_0003461_7176_7727 | 183 |
| 124 | 3300047315 | Ga0495581_0000616 | Ga0495581_0000616_17990_18541 | 183 |
| 125 | 3300047319 | Ga0495674_0004599 | Ga0495674_0004599_2793_3344 | 183 |
| 126 | 3300047319 | Ga0495674_0006730 | Ga0495674_0006730_5742_6293 | 183 |
| 127 | 3300047321 | Ga0495676_0017584 | Ga0495676_0017584_4036_4587 | 183 |
| 128 | 3300047471 | Ga0495684_0019368 | Ga0495684_0019368_695_1246 | 183 |
| 129 | 3300047472 | Ga0495686_0048896 | Ga0495686_0048896_1524_2078 | 183 |
| 130 | 3300047673 | Ga0495593_0000093 | Ga0495593_0000093_35268_35819 | 183 |
| 131 | 3300048089 | Ga0495614_0022361 | Ga0495614_0022361_250_801 | 183 |
| 132 | 3300048915 | Ga0496112_0170538 | Ga0496112_0170538_1026_1580 | 183 |
| 133 | 3300048922 | Ga0496119_0160031 | Ga0496119_0160031_467_1018 | 183 |
| 134 | 3300048924 | Ga0496121_0018922 | Ga0496121_0018922_2489_3040 | 183 |
| 135 | 3300048929 | Ga0496126_0106328 | Ga0496126_0106328_956_1507 | 183 |
| 136 | 3300048929 | Ga0496126_0493920 | Ga0496126_0493920_210_761 | 183 |
| 137 | 3300053092 | Ga0500583_0121253 | Ga0500583_0121253_311_862 | 183 |
| 138 | 3300053093 | Ga0500651_0004509 | Ga0500651_0004509_4006_4557 | 183 |
| 139 | 3300053096 | Ga0500641_0131356 | Ga0500641_0131356_447_998 | 183 |
| 140 | 3300053104 | Ga0500556_0316081 | Ga0500556_0316081_19_570 | 183 |
| 141 | 3300053119 | Ga0500595_000914 | Ga0500595_000914_6951_7502 | 183 |
| 142 | 3300053119 | Ga0500595_007110 | Ga0500595_007110_167_718 | 183 |
| 143 | 3300053119 | Ga0500595_070694 | Ga0500595_070694_106_657 | 183 |
| 144 | 3300053151 | Ga0500604_0078776 | Ga0500604_0078776_356_907 | 183 |
| 145 | 3300001979 | JGI24740J21852_10047312 | JGI24740J21852_100473122 | 184 |
| 146 | 3300005336 | Ga0070680_100370576 | Ga0070680_1003705762 | 184 |
| 147 | 3300005434 | Ga0070709_10110717 | Ga0070709_101107172 | 184 |
| 148 | 3300005435 | Ga0070714_100011974 | Ga0070714_1000119744 | 184 |
| 149 | 3300005435 | Ga0070714_100080931 | Ga0070714_1000809313 | 184 |
| 150 | 3300005436 | Ga0070713_100015169 | Ga0070713_1000151691 | 184 |
| 151 | 3300005436 | Ga0070713_100052072 | Ga0070713_1000520722 | 184 |
| 152 | 3300005437 | Ga0070710_10004385 | Ga0070710_100043857 | 184 |
| 153 | 3300005437 | Ga0070710_10019966 | Ga0070710_100199664 | 184 |
| 154 | 3300005439 | Ga0070711_100002111 | Ga0070711_1000021114 | 184 |
| 155 | 3300005439 | Ga0070711_100022271 | Ga0070711_1000222712 | 184 |
| 156 | 3300005441 | Ga0070700_100477194 | Ga0070700_1004771941 | 184 |
| 157 | 3300005455 | Ga0070663_100353349 | Ga0070663_1003533492 | 184 |
| 158 | 3300005458 | Ga0070681_11055897 | Ga0070681_110558971 | 184 |
| 159 | 3300005467 | Ga0070706_100771302 | Ga0070706_1007713022 | 184 |
| 160 | 3300005467 | Ga0070706_101110480 | Ga0070706_1011104802 | 184 |
| 161 | 3300005468 | Ga0070707_100483527 | Ga0070707_1004835272 | 184 |
| 162 | 3300005471 | Ga0070698_100103408 | Ga0070698_1001034082 | 184 |
| 163 | 3300005471 | Ga0070698_100363289 | Ga0070698_1003632892 | 184 |
| 164 | 3300005518 | Ga0070699_100880374 | Ga0070699_1008803741 | 184 |
| 165 | 3300005536 | Ga0070697_100435354 | Ga0070697_1004353542 | 184 |
| 166 | 3300005539 | Ga0068853_100125374 | Ga0068853_1001253743 | 184 |
| 167 | 3300005548 | Ga0070665_100398258 | Ga0070665_1003982582 | 184 |
| 168 | 3300005563 | Ga0068855_100218764 | Ga0068855_1002187642 | 184 |
| 169 | 3300005563 | Ga0068855_100656753 | Ga0068855_1006567532 | 184 |
| 170 | 3300005614 | Ga0068856_100211860 | Ga0068856_1002118602 | 184 |
| 171 | 3300005616 | Ga0068852_100600580 | Ga0068852_1006005802 | 184 |
| 172 | 3300005983 | Ga0081540_1013526 | Ga0081540_10135268 | 184 |
| 173 | 3300006028 | Ga0070717_10015633 | Ga0070717_100156334 | 184 |
| 174 | 3300006028 | Ga0070717_10136114 | Ga0070717_101361142 | 184 |
| 175 | 3300006028 | Ga0070717_10367380 | Ga0070717_103673802 | 184 |
| 176 | 3300006163 | Ga0070715_10000184 | Ga0070715_100001848 | 184 |
| 177 | 3300006173 | Ga0070716_100024999 | Ga0070716_1000249995 | 184 |
| 178 | 3300006175 | Ga0070712_100027542 | Ga0070712_1000275424 | 184 |
| 179 | 3300006175 | Ga0070712_100173050 | Ga0070712_1001730502 | 184 |
| 180 | 3300007265 | Ga0099794_10083136 | Ga0099794_100831362 | 184 |
| 181 | 3300007788 | Ga0099795_10042306 | Ga0099795_100423062 | 184 |
| 182 | 3300009093 | Ga0105240_10020983 | Ga0105240_100209832 | 184 |
| 183 | 3300009101 | Ga0105247_10255126 | Ga0105247_102551262 | 184 |
| 184 | 3300009551 | Ga0105238_11287271 | Ga0105238_112872712 | 184 |
| 185 | 3300010159 | Ga0099796_10001778 | Ga0099796_100017782 | 184 |
| 186 | 3300010375 | Ga0105239_10508576 | Ga0105239_105085762 | 184 |
| 187 | 3300012492 | Ga0157335_1012037 | Ga0157335_10120371 | 184 |
| 188 | 3300013105 | Ga0157369_10007712 | Ga0157369_100077129 | 184 |
| 189 | 3300013105 | Ga0157369_10438326 | Ga0157369_104383262 | 184 |
| 190 | 3300013307 | Ga0157372_10024026 | Ga0157372_1002402611 | 184 |
| 191 | 3300013307 | Ga0157372_10694965 | Ga0157372_106949651 | 184 |
| 192 | 3300013307 | Ga0157372_11390076 | Ga0157372_113900762 | 184 |
| 193 | 3300014325 | Ga0163163_11607320 | Ga0163163_116073201 | 184 |
| 194 | 3300020080 | Ga0206350_10441736 | Ga0206350_104417362 | 184 |
| 195 | 3300025898 | Ga0207692_10007248 | Ga0207692_100072484 | 184 |
| 196 | 3300025898 | Ga0207692_10095041 | Ga0207692_100950412 | 184 |
| 197 | 3300025904 | Ga0207647_10127474 | Ga0207647_101274742 | 184 |
| 198 | 3300025904 | Ga0207647_10294051 | Ga0207647_102940512 | 184 |
| 199 | 3300025905 | Ga0207685_10000813 | Ga0207685_100008132 | 184 |
| 200 | 3300025906 | Ga0207699_10012926 | Ga0207699_100129262 | 184 |
| 201 | 3300025906 | Ga0207699_10032448 | Ga0207699_100324482 | 184 |
| 202 | 3300025915 | Ga0207693_10003166 | Ga0207693_100031662 | 184 |
| 203 | 3300025915 | Ga0207693_10024053 | Ga0207693_100240533 | 184 |
| 204 | 3300025915 | Ga0207693_10039839 | Ga0207693_100398393 | 184 |
| 205 | 3300025915 | Ga0207693_10091076 | Ga0207693_100910762 | 184 |
| 206 | 3300025916 | Ga0207663_10000963 | Ga0207663_100009635 | 184 |
| 207 | 3300025916 | Ga0207663_10020801 | Ga0207663_100208015 | 184 |
| 208 | 3300025917 | Ga0207660_10131237 | Ga0207660_101312372 | 184 |
| 209 | 3300025917 | Ga0207660_10267302 | Ga0207660_102673022 | 184 |
| 210 | 3300025922 | Ga0207646_10401661 | Ga0207646_104016612 | 184 |
| 211 | 3300025928 | Ga0207700_10102312 | Ga0207700_101023122 | 184 |
| 212 | 3300025928 | Ga0207700_10500974 | Ga0207700_105009742 | 184 |
| 213 | 3300025928 | Ga0207700_10962009 | Ga0207700_109620092 | 184 |
| 214 | 3300025929 | Ga0207664_10055227 | Ga0207664_100552273 | 184 |
| 215 | 3300025929 | Ga0207664_10063626 | Ga0207664_100636265 | 184 |
| 216 | 3300025929 | Ga0207664_10127911 | Ga0207664_101279112 | 184 |
| 217 | 3300025939 | Ga0207665_10000304 | Ga0207665_1000030426 | 184 |
| 218 | 3300025944 | Ga0207661_10145220 | Ga0207661_101452202 | 184 |
| 219 | 3300025949 | Ga0207667_10461949 | Ga0207667_104619492 | 184 |
| 220 | 3300026041 | Ga0207639_10037618 | Ga0207639_100376183 | 184 |
| 221 | 3300026067 | Ga0207678_10092721 | Ga0207678_100927212 | 184 |
| 222 | 3300026067 | Ga0207678_10363227 | Ga0207678_103632272 | 184 |
| 223 | 3300026078 | Ga0207702_10429952 | Ga0207702_104299522 | 184 |
| 224 | 3300027512 | Ga0209179_1002579 | Ga0209179_10025792 | 184 |
| 225 | 3300027671 | Ga0209588_1055875 | Ga0209588_10558752 | 184 |
| 226 | 3300031649 | Ga0307514_10340414 | Ga0307514_103404142 | 184 |
| 227 | 3300031711 | Ga0265314_10073682 | Ga0265314_100736822 | 184 |
| 228 | 3300031824 | Ga0307413_10106062 | Ga0307413_101060622 | 184 |
| 229 | 3300031901 | Ga0307406_10232628 | Ga0307406_102326282 | 184 |
| 230 | 3300031911 | Ga0307412_10768721 | Ga0307412_107687212 | 184 |
| 231 | 3300031995 | Ga0307409_100439253 | Ga0307409_1004392531 | 184 |
| 232 | 3300032005 | Ga0307411_10036956 | Ga0307411_100369562 | 184 |
| 233 | 3300032126 | Ga0307415_100264511 | Ga0307415_1002645111 | 184 |
| 234 | 3300035086 | Ga0373934_0000684 | Ga0373934_0000684_10942_11496 | 184 |
| 235 | 3300035111 | Ga0373923_0001610 | Ga0373923_0001610_706_1260 | 184 |
| 236 | 3300035117 | Ga0373953_0000768 | Ga0373953_0000768_7145_7699 | 184 |
| 237 | 3300035118 | Ga0373954_0000045 | Ga0373954_0000045_27264_27818 | 184 |
| 238 | 3300035119 | Ga0373956_0000635 | Ga0373956_0000635_11300_11854 | 184 |
| 239 | 3300035120 | Ga0373957_0000469 | Ga0373957_0000469_5192_5746 | 184 |
| 240 | 3300035172 | Ga0373955_0000617 | Ga0373955_0000617_3815_4369 | 184 |
| 241 | 3300035410 | Ga0373924_0004198 | Ga0373924_0004198_3244_3798 | 184 |
| 242 | 3300035724 | Ga0373933_0000309 | Ga0373933_0000309_5006_5560 | 184 |
| 243 | 3300036401 | Ga0373937_0000742 | Ga0373937_0000742_25949_26503 | 184 |
| 244 | 3300037418 | Ga0395900_0075553 | Ga0395900_0075553_2651_3205 | 184 |
| 245 | 3300037418 | Ga0395900_0239653 | Ga0395900_0239653_546_1100 | 184 |
| 246 | 3300037466 | Ga0395898_0141398 | Ga0395898_0141398_407_961 | 184 |
| 247 | 3300037853 | Ga0436364_1421030 | Ga0436364_1421030_785_1339 | 184 |
| 248 | 3300038443 | Ga0395901_0032461 | Ga0395901_0032461_2898_3452 | 184 |
| 249 | 3300039437 | Ga0436365_0489780 | Ga0436365_0489780_466_1020 | 184 |
| 250 | 3300039437 | Ga0436365_1242625 | Ga0436365_1242625_438_992 | 184 |
| 251 | 3300039438 | Ga0436360_0849193 | Ga0436360_0849193_607_1161 | 184 |
| 252 | 3300039450 | Ga0436363_1436180 | Ga0436363_1436180_41_595 | 184 |
| 253 | 3300041451 | Ga0451791_0315141 | Ga0451791_0315141_213_767 | 184 |
| 254 | 3300042012 | Ga0439455_0085101 | Ga0439455_0085101_281_835 | 184 |
| 255 | 3300044684 | Ga0466966_0219290 | Ga0466966_0219290_389_946 | 184 |
| 256 | 3300045049 | Ga0466959_0026903 | Ga0466959_0026903_103_660 | 184 |
| 257 | 3300046459 | Ga0495629_0000257 | Ga0495629_0000257_28910_29464 | 184 |
| 258 | 3300046462 | Ga0495651_0010911 | Ga0495651_0010911_4339_4893 | 184 |
| 259 | 3300046463 | Ga0495653_0000288 | Ga0495653_0000288_19438_19992 | 184 |
| 260 | 3300046511 | Ga0495608_0004461 | Ga0495608_0004461_5664_6218 | 184 |
| 261 | 3300046514 | Ga0495618_0034054 | Ga0495618_0034054_366_920 | 184 |
| 262 | 3300046529 | Ga0495652_0013083 | Ga0495652_0013083_1365_1919 | 184 |
| 263 | 3300046536 | Ga0495587_0005778 | Ga0495587_0005778_2563_3117 | 184 |
| 264 | 3300046543 | Ga0495645_0011099 | Ga0495645_0011099_5263_5817 | 184 |
| 265 | 3300046557 | Ga0495622_0032381 | Ga0495622_0032381_1845_2399 | 184 |
| 266 | 3300046559 | Ga0495667_0000700 | Ga0495667_0000700_9369_9923 | 184 |
| 267 | 3300046642 | Ga0495634_0014367 | Ga0495634_0014367_4094_4648 | 184 |
| 268 | 3300046663 | Ga0495635_0000040 | Ga0495635_0000040_74601_75155 | 184 |
| 269 | 3300046675 | Ga0495657_0014254 | Ga0495657_0014254_3794_4348 | 184 |
| 270 | 3300046678 | Ga0495599_0000120 | Ga0495599_0000120_10541_11095 | 184 |
| 271 | 3300046679 | Ga0495623_0016844 | Ga0495623_0016844_1394_1948 | 184 |
| 272 | 3300046680 | Ga0495646_0003012 | Ga0495646_0003012_1718_2272 | 184 |
| 273 | 3300046809 | Ga0495600_0000074 | Ga0495600_0000074_28784_29338 | 184 |
| 274 | 3300047317 | Ga0495604_0001303 | Ga0495604_0001303_4218_4772 | 184 |
| 275 | 3300047322 | Ga0495680_0001054 | Ga0495680_0001054_18295_18849 | 184 |
| 276 | 3300047444 | Ga0495675_0000382 | Ga0495675_0000382_19159_19713 | 184 |
| 277 | 3300047471 | Ga0495684_0000134 | Ga0495684_0000134_22458_23012 | 184 |
| 278 | 3300047673 | Ga0495593_0010368 | Ga0495593_0010368_3730_4284 | 184 |
| 279 | 3300048088 | Ga0495602_0002014 | Ga0495602_0002014_17774_18328 | 184 |
| 280 | 3300048903 | Ga0496100_0755864 | Ga0496100_0755864_151_705 | 184 |
| 281 | 3300048905 | Ga0496102_0857508 | Ga0496102_0857508_181_735 | 184 |
| 282 | 3300048929 | Ga0496126_0025520 | Ga0496126_0025520_176_730 | 184 |
| 283 | 3300053080 | Ga0500635_0203801 | Ga0500635_0203801_95_652 | 184 |
| 284 | 3300053084 | Ga0495595_0000064 | Ga0495595_0000064_35240_35794 | 184 |
| 285 | 3300053085 | Ga0495619_0000995 | Ga0495619_0000995_11848_12402 | 184 |
| 286 | 3300053089 | Ga0500581_181722 | Ga0500581_181722_178_732 | 184 |
| 287 | 3300053091 | Ga0500647_0093049 | Ga0500647_0093049_827_1384 | 184 |
| 288 | 3300053094 | Ga0500566_0000010 | Ga0500566_0000010_94909_95466 | 184 |
| 289 | 3300053095 | Ga0500640_001664 | Ga0500640_001664_5425_5982 | 184 |
| 290 | 3300053096 | Ga0500641_0117109 | Ga0500641_0117109_329_883 | 184 |
| 291 | 3300053111 | Ga0500572_000031 | Ga0500572_000031_24486_25043 | 184 |
| 292 | 3300053115 | Ga0500591_138393 | Ga0500591_138393_221_778 | 184 |
| 293 | 3300053118 | Ga0500594_0066364 | Ga0500594_0066364_457_1011 | 184 |
| 294 | 3300053123 | Ga0500614_002975 | Ga0500614_002975_295_852 | 184 |
| 295 | 3300053136 | Ga0500559_0002572 | Ga0500559_0002572_4095_4652 | 184 |
| 296 | 3300053148 | Ga0500590_109739 | Ga0500590_109739_582_1139 | 184 |
| 297 | 3300053150 | Ga0500603_000485 | Ga0500603_000485_5232_5789 | 184 |
| 298 | 3300053159 | Ga0500630_000318 | Ga0500630_000318_19328_19885 | 184 |
| 299 | 3300053162 | Ga0500638_063786 | Ga0500638_063786_927_1484 | 184 |
| 300 | 3300053163 | Ga0500639_000287 | Ga0500639_000287_2090_2647 | 184 |
| 301 | 3300053735 | Ga0500596_001034 | Ga0500596_001034_3064_3621 | 184 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7zw1-assembly1.cif.gz_A | human prph2-rom1 hetero-dimer | 0.6347 | 23 | 140 |
| 6wvg-assembly1.cif.gz_A | human cd53 | 0.5764 | 31 | 142 |
| 6wvg-assembly2.cif.gz_B | human cd53 | 0.5716 | 31 | 142 |
| 8a3k-assembly1.cif.gz_UNK | x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 | 0.5334 | 32 | 176 |
| 4rng-assembly4.cif.gz_C-2 | crystal structure of a bacterial homologue of sweet transporters | 0.5289 | 70 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F587_111_235_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6622 | 104 | 183 | 3.30.40.10 |
| af_A0A6H2EED7_1_133_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6501 | 17 | 184 | 1.20.140.150 |
| af_A0A6H2EED7_1_133_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6346 | 17 | 184 | 1.20.140.150 |
| af_P24485_1_104_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.601 | 27 | 115 | 1.10.287.70 |
| af_I1LVA8_137_230_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5966 | 71 | 184 | 1.20.1280.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523Q3H0-F1-model_v4 | TRAP transporter small permease protein | 0.8101 | 27 | 184 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A523Q3H0-F1-model_v4 | TRAP transporter small permease protein | 0.7567 | 27 | 184 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-Q11BZ3-F1-model_v4 | TRAP transporter small permease protein | 0.7548 | 25 | 183 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A7Z2SP02-F1-model_v4 | TRAP transporter small permease protein | 0.7472 | 20 | 180 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A521QWN6-F1-model_v4 | TRAP transporter small permease protein | 0.7293 | 17 | 174 |
GO:0005886
GO:0015740 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar